LOCUS       BT006883                1218 bp    mRNA    linear   HUM 13-MAY-2003
DEFINITION  Homo sapiens excision repair cross-complementing rodent repair
            deficiency, complementation group 2 (xeroderma pigmentosum D) mRNA,
            complete cds.
ACCESSION   BT006883
VERSION     BT006883.1
KEYWORDS    FLI_CDNA.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1218)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Cloning of human full-length CDSs in BD Creator(TM) System Donor
            vector
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 1218)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow
            Circle, Palo Alto, CA 94303, USA
COMMENT     This CDS clone is a part of a collection of human full length
            expression clones generated by BD Biosciences Clontech and the
            Harvard Institute of Proteomics. Each CDS has been cloned in two
            forms: with and without stop-codon (to allow fusion with C-terminal
            tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
            cloning system between the SalI  and HindIII sites of the pDNR-DUAL
            vector. Additional sequences in the clone:  'ACC' after SalI site
            and before 'ATG' to provide Kozak consensus sequence; 'GG' after
            last codon and before HindIII site to maintain reading frame.
            Clone distribution: http://bioinfo.clontech.com/orfclones.
FEATURES             Location/Qualifiers
     source          1..1218
                     /db_xref="H-InvDB:HIT000099803"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="GH00451X1.0"
                     /clone_lib="BD Creator(TM) CDS Library derived from MGC
                     collection"
                     /lab_host="DH5alpha T1 resistant"
                     /note="Vector: pDNR-Dual"
     CDS             1..1218
                     /codon_start=1
                     /product="excision repair cross-complementing rodent
                     repair deficiency, complementation group 2 (xeroderma
                     pigmentosum D)"
                     /protein_id="AAP35529.1"
                     /translation="MRELKRTLDAKGHGVLEMPSGTGKTVSLLALIMAYQRAYPLEVT
                     KLIYCSRTVPEIEKVIEELRKLLNFYEKQEGEKLPFLGLALSSRKNLCIHPEVTPLRF
                     GKDVDGKCHSLTASYVRAQYQHDTSLPHCRFYEEFDAHGREVPLPAGIYNLDDLKALG
                     RRQGWCPYFLARYSILHANVVVYSYHYLLDPKIADLVSKELARKAVVVFDEAHNIDNV
                     CIDSMSVNLTRRTLDRCQGNLETLQKTVLRIKETDEQRLRDEYRRLVEGLREASAARE
                     TDAHLANPVLPDEVLQEAVPGSIRTAEHFLGFLRRLLEYVKWRLRVQHVVQESPPAFL
                     SGLAQRVCIQRKPLRFCAERLRSLLHTLEITDLADFSPLTLLANFATLVSTYAKGQAQ
                     HCGSSRNQKRSHP"
BASE COUNT          254 a          382 c          356 g          226 t
ORIGIN      
        1 atgcgggagc tcaaacgcac gctggacgcc aagggtcatg gagtcctgga gatgccctca
       61 ggcaccggga agacagtatc cctgttggcc ctgatcatgg cataccagag agcatatccg
      121 ctggaggtga ccaaactcat ctactgctca agaactgtgc cagagattga gaaggtgatt
      181 gaagagcttc gaaagttgct caacttctat gagaagcagg agggcgagaa gctgccgttt
      241 ctgggactgg ctctgagctc ccgcaaaaac ttgtgtattc accctgaggt gacacccctg
      301 cgctttggga aggacgtcga tgggaaatgc cacagcctca cagcctccta tgtgcgggcg
      361 cagtaccagc atgacaccag cctgccccac tgccgattct atgaggaatt tgatgcccat
      421 gggcgtgagg tgcccctccc cgctggcatc tacaacctgg atgacctgaa ggccctgggg
      481 cggcgccagg gctggtgccc atacttcctt gctcgatact caatcctgca tgccaatgtg
      541 gtggtttata gctaccacta cctcctggac cccaagattg cagacctggt gtccaaggaa
      601 ctggcccgca aggccgtcgt ggtcttcgac gaggcccaca acattgacaa cgtctgcatc
      661 gactccatga gcgtcaacct cacccgccgg acccttgacc ggtgccaggg caacctggag
      721 accctgcaga agacggtgct caggatcaaa gagacagacg agcagcgcct gcgggacgag
      781 taccggcgtc tggtggaggg gctgcgggag gccagcgccg cccgggagac ggacgcccac
      841 ctggccaacc ccgtgctgcc cgacgaagtg ctgcaggagg cagtgcctgg ctccatccgc
      901 acggccgagc atttcctggg cttcctgagg cggctgctgg agtacgtgaa gtggcggctg
      961 cgtgtgcagc atgtggtgca ggagagcccg cccgccttcc tgagcggcct ggcccagcgc
     1021 gtgtgcatcc agcgcaagcc cctcagattc tgtgctgaac gcctccggtc cctgctgcat
     1081 actctggaga tcaccgacct tgctgacttc tccccgctca ccctccttgc taactttgcc
     1141 acccttgtca gcacctacgc caaaggccag gctcagcact gtggaagcag caggaaccaa
     1201 aaaagatctc atccctag
//