LOCUS BT006883 1218 bp mRNA linear HUM 13-MAY-2003 DEFINITION Homo sapiens excision repair cross-complementing rodent repair deficiency, complementation group 2 (xeroderma pigmentosum D) mRNA, complete cds. ACCESSION BT006883 VERSION BT006883.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1218) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 1218) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow Circle, Palo Alto, CA 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..1218 /db_xref="H-InvDB:HIT000099803" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH00451X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..1218 /codon_start=1 /product="excision repair cross-complementing rodent repair deficiency, complementation group 2 (xeroderma pigmentosum D)" /protein_id="AAP35529.1" /translation="MRELKRTLDAKGHGVLEMPSGTGKTVSLLALIMAYQRAYPLEVT KLIYCSRTVPEIEKVIEELRKLLNFYEKQEGEKLPFLGLALSSRKNLCIHPEVTPLRF GKDVDGKCHSLTASYVRAQYQHDTSLPHCRFYEEFDAHGREVPLPAGIYNLDDLKALG RRQGWCPYFLARYSILHANVVVYSYHYLLDPKIADLVSKELARKAVVVFDEAHNIDNV CIDSMSVNLTRRTLDRCQGNLETLQKTVLRIKETDEQRLRDEYRRLVEGLREASAARE TDAHLANPVLPDEVLQEAVPGSIRTAEHFLGFLRRLLEYVKWRLRVQHVVQESPPAFL SGLAQRVCIQRKPLRFCAERLRSLLHTLEITDLADFSPLTLLANFATLVSTYAKGQAQ HCGSSRNQKRSHP" BASE COUNT 254 a 382 c 356 g 226 t ORIGIN 1 atgcgggagc tcaaacgcac gctggacgcc aagggtcatg gagtcctgga gatgccctca 61 ggcaccggga agacagtatc cctgttggcc ctgatcatgg cataccagag agcatatccg 121 ctggaggtga ccaaactcat ctactgctca agaactgtgc cagagattga gaaggtgatt 181 gaagagcttc gaaagttgct caacttctat gagaagcagg agggcgagaa gctgccgttt 241 ctgggactgg ctctgagctc ccgcaaaaac ttgtgtattc accctgaggt gacacccctg 301 cgctttggga aggacgtcga tgggaaatgc cacagcctca cagcctccta tgtgcgggcg 361 cagtaccagc atgacaccag cctgccccac tgccgattct atgaggaatt tgatgcccat 421 gggcgtgagg tgcccctccc cgctggcatc tacaacctgg atgacctgaa ggccctgggg 481 cggcgccagg gctggtgccc atacttcctt gctcgatact caatcctgca tgccaatgtg 541 gtggtttata gctaccacta cctcctggac cccaagattg cagacctggt gtccaaggaa 601 ctggcccgca aggccgtcgt ggtcttcgac gaggcccaca acattgacaa cgtctgcatc 661 gactccatga gcgtcaacct cacccgccgg acccttgacc ggtgccaggg caacctggag 721 accctgcaga agacggtgct caggatcaaa gagacagacg agcagcgcct gcgggacgag 781 taccggcgtc tggtggaggg gctgcgggag gccagcgccg cccgggagac ggacgcccac 841 ctggccaacc ccgtgctgcc cgacgaagtg ctgcaggagg cagtgcctgg ctccatccgc 901 acggccgagc atttcctggg cttcctgagg cggctgctgg agtacgtgaa gtggcggctg 961 cgtgtgcagc atgtggtgca ggagagcccg cccgccttcc tgagcggcct ggcccagcgc 1021 gtgtgcatcc agcgcaagcc cctcagattc tgtgctgaac gcctccggtc cctgctgcat 1081 actctggaga tcaccgacct tgctgacttc tccccgctca ccctccttgc taactttgcc 1141 acccttgtca gcacctacgc caaaggccag gctcagcact gtggaagcag caggaaccaa 1201 aaaagatctc atccctag //