LOCUS       BLJS01000001         1933853 bp    DNA     linear   BCT 05-SEP-2020
DEFINITION  Bartonella henselae 623-125 DNA, sequence01.
ACCESSION   BLJS01000001 BLJS01000000
VERSION     BLJS01000001.1
DBLINK      BioProject:PRJDB9171
            Sequence Read Archive:DRR204831, DRR204832
            BioSample:SAMD00200273
KEYWORDS    WGS; STANDARD_DRAFT.
SOURCE      Bartonella henselae
  ORGANISM  Bartonella henselae
            Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales;
            Bartonellaceae; Bartonella.
REFERENCE   1  (bases 1 to 1933853)
  AUTHORS   Tsukamoto,K., Suzuki,M. and Doi,Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (14-JAN-2020) to the DDBJ/EMBL/GenBank databases.
            Contact:Kentaro Tsukamoto
            Fujita Health University School of Medicine, Department of
            Microbiology; Kutsukake-cho, Dengakugakubo 1-98, Toyoake, Aichi
            470-1192, Japan
            URL    :https://www.fujita-hu.ac.jp/
REFERENCE   2
  AUTHORS   Tsukamoto,K., Shinzawa,N., Kawai,A., Suzuki,M., Kidoya,H.,
            Takakura,N., Yamaguchi,H., Kameyama,T., Inagaki,H., Kurahashi,H.,
            Horiguchi,Y. and Doi,Y.
  TITLE     The Bartonella autotransporter BafA activates the host VEGF
            pathway to drive angiogenesis
  JOURNAL   Nat Commun 11, 3571 (2020)
  REMARK    Publication Status: Online-Only
            DOI:10.1038/s41467-020-17391-2
COMMENT     Annotated at DFAST https://dfast.nig.ac.jp/
            
            ##Genome-Assembly-Data-START##
            Assembly Method       :: Unicycler v. 0.4.8
            Genome Coverage       :: 45x
            Sequencing Technology :: Illumina MiSeq; MinION
            ##Genome-Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..1933853
                     /db_xref="taxon:38323"
                     /mol_type="genomic DNA"
                     /organism="Bartonella henselae"
                     /strain="623-125"
                     /submitter_seqid="sequence01"
     CDS             complement(1096..1422)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_00010"
                     /product="hypothetical protein"
                     /protein_id="GFF01567.1"
                     /transl_table=11
                     /translation="MTAENTEMTLHPKKLPPNAGKGRVKGVPNKTTSLLKESVIEAAK
                     RAGSKYGKEGLISYLEKQALKCPAAYLALLGKVLPLQVTGEDGGAIKMIGRVEIAPLG
                     HDNTTD"
     CDS             1721..2179
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_00020"
                     /product="hypothetical protein"
                     /protein_id="GFF01568.1"
                     /transl_table=11
                     /translation="MRDIVIVIVGILILWSIVSDMWEEAENGRNTEFQGTLLLVIVLG
                     VLWYLEFSRNFLLIVAILLFAWRNYLGIIANSEHDRLVEYSQMAFDYENEKINKAIIQ
                     RNEAVKENSRMVDRHYKAIKERDKTIEELSEKLWQQQKQIMIMEKQNESG"
     CDS             complement(2697..2849)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_00030"
                     /product="hypothetical protein"
                     /protein_id="GFF01569.1"
                     /transl_table=11
                     /translation="MRVIGKPLKGQFSGLWRYRVGDYRILCELYDKELVVLVLAVGHR
                     KNIYKG"
     CDS             complement(2949..3176)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011390943.1"
                     /locus_tag="BH623125_00040"
                     /product="CopG family transcriptional regulator"
                     /protein_id="GFF01570.1"
                     /transl_table=11
                     /translation="MTISIRLPSDLETRLNNLAAKTGRTKSFYLREIIERGIEEAEDY
                     YLASQVRERVRKGEGTFYSSEEVRKELGLDD"
     CDS             complement(3273..3767)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_00050"
                     /product="hypothetical protein"
                     /protein_id="GFF01571.1"
                     /transl_table=11
                     /translation="MRKKDTYISQVKVRQDPVNQLAVEMRAKRFGLTIEEAKNPLAGS
                     YVGRLCLQGVLTQDQYDATQKYLEVRNDYSCAKGLPSAVYDEMPSSSDDKAREKWVER
                     ATEQFCSMQEVIKETQCLYKQYNLYAALQYLVSEDQILPHLVNSLQIALNALHKYFDK
                     KNKW"
     CDS             complement(3821..4267)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_00060"
                     /product="hypothetical protein"
                     /protein_id="GFF01572.1"
                     /transl_table=11
                     /translation="MLNKVMLIGYLGDDPESKTMTSGAEVVNFRMATFESYMNKNTHQ
                     KVEKTEWHSVVVFNPHFAKIALQYLHKGSKVYIEGKLQTRKWQDKNGHDRYTTEIVLP
                     QYKGELHLLDAKKEQSASSSSVTSQSYAIASGADDYGISAHDSMPF"
     CDS             4458..4739
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005737444.1"
                     /locus_tag="BH623125_00070"
                     /product="protein killer protein"
                     /protein_id="GFF01573.1"
                     /transl_table=11
                     /translation="MAIVSFKHKGLKLFFERGIVKGIQPAHAKKLANILVILDTISAP
                     EQMTIKSYRLHELTGDLKGYWSMRVNANWRVTFRFIGTNVELVDYQDYH"
     CDS             4756..5049
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011103139.1"
                     /locus_tag="BH623125_00080"
                     /product="transcriptional regulator"
                     /protein_id="GFF01574.1"
                     /transl_table=11
                     /translation="MMYNPPHPGGILKEELLDERGLTITEAANRLGVARLTLSRVLNC
                     HAAISINLALRLEIAGLNDAEFWLKLQQKHDLWQARHNNPMPDISSLEQVSHP"
     CDS             complement(5091..5417)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_00090"
                     /product="hypothetical protein"
                     /protein_id="GFF01575.1"
                     /transl_table=11
                     /translation="MPILKHLLLKNRKQPMQKKFVATAVGYVPWGDGAAEYFYNLYEY
                     EDGTRECEKFDGGQYYKIPENADFSTKAQVKAWIYGGAVPKSVLNYEPLIDEINREIK
                     KLSKNI"
     tRNA            complement(5877..5953)
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="BH623125_t00010"
                     /product="tRNA-Arg"
     CDS             complement(5992..6297)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013532440.1"
                     /locus_tag="BH623125_00100"
                     /product="ETC complex I subunit"
                     /protein_id="GFF01576.1"
                     /transl_table=11
                     /translation="MIARIYSPAKTAMQSGRGNTGFWILQYEPIKAKMLEPLMGYTAT
                     SDMNNQVKIRFNKKEEAVAFARKNAIPYRVEKMHKPIRRVVSYSDNFRSDRQQSWTH"
     tRNA            complement(6388..6464)
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="BH623125_t00020"
                     /product="tRNA-Pro"
     CDS             complement(7291..7980)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013532442.1"
                     /locus_tag="BH623125_00110"
                     /product="hypothetical protein"
                     /protein_id="GFF01577.1"
                     /transl_table=11
                     /translation="MNKRETQLPLNFSYNPIFQFDDLVVTESNRMAFQLIDHWPNWIL
                     PIAVLVGKEGSGKTHFSSVWAEKADALRFHRNEIDQAIAVASSGRSFLIEDIDLGEIS
                     ETGLFHLINSVKQANLDMCQATLLMTARTVPSTWNLKLNDLKSRLNSIMLVAINQPDD
                     ALLTAVAFKLFSDRQITVHPDTVYYLVNRCERSLFSLKRVIDSVDRLALQRKSKITRA
                     VIGEVLNMQVQ"
     CDS             complement(7977..9188)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013532443.1"
                     /locus_tag="BH623125_00120"
                     /product="AI-2E family transporter"
                     /protein_id="GFF01578.1"
                     /transl_table=11
                     /translation="MSKISDNHDHSALQFMKKKVRENGSRDIRQIYVPAYTQVPLPNN
                     MKKQIFFWLGALIFFILFMLVFGSILLPFVAGIVLAYFLNPIVQLLEKFRIRRVFGTI
                     LITLFIVVVFVAALIILIPIISWQIQQFMNDGLPVYINRIQTFFVEHDFDWVRRYFGS
                     DPNELQSNIKGLLGQSSDFITSLLNSLLKSGKSLVNIVSLFVVAPVVAFYMLLDWPRM
                     VTAVDSLIPRDHLETVRSIFHEMDRAIAGFVRGQGTACLILGGYYAIGLTITELNFGL
                     LIGMFIGLISFVPYIGTMSGFLLSVGVAWVQFYPNNWGWIIVVMVIFLIGQFIEGYIL
                     QPKLVGSSVGLHPVWLMFALFAFSSLFGFTGMLIAVPAAAAVGVLVRFALHTYLNSQM
                     YSRSGNSERLE"
     CDS             9346..10431
                     /codon_start=1
                     /gene="purM"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TKG8"
                     /locus_tag="BH623125_00130"
                     /product="phosphoribosylformylglycinamidine cyclo-ligase"
                     /protein_id="GFF01579.1"
                     /transl_table=11
                     /translation="MNNQDLINDKSKNGLTYAKAGVNIDMGNAMVEKIKPFIRATKRA
                     GTDAEIGGFGGLFDLKAAGFTDPILVAANDGVGTKLKIAIEVGIHDTIGIDLVAMCVN
                     DLLVQGAEPLFFLDYFATGKLDPEQGAAIVSGIAKGCQQAGAALIGGETAEMPDMYAK
                     GDYDLAGFAVGAAERSALLPSKDLTEGDIILGLSSSGIHSNGFSLVRRIIQQSDLKWN
                     DHAPFNPQMNLGTALLTPTRIYVKSLLPIIKSYKGIKALAHITGGGFLENIPRVLPSS
                     LCAEINLSAIHVPSIFSWIAKQGKIEKIEMLRTFNCGVGMIIIVAQHEVEKVTQELKM
                     QGETVTLLGKLTKRQNKGITFKGALHL"
     CDS             10428..11039
                     /codon_start=1
                     /gene="purN"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q92QW3"
                     /locus_tag="BH623125_00140"
                     /product="phosphoribosylglycinamide formyltransferase"
                     /protein_id="GFF01580.1"
                     /transl_table=11
                     /translation="MKKQIVVFISGNGSNMVALVKASKQKEYPAEIIAVICDNPHAKG
                     IEKARDNHLPIHIIDRKDYPTKEAYEESIFKVLAKYQPDLICFAGYMRLISSRFVKLY
                     EGKILNIHPSLLPSFKGLKTHERVLQAGVKITGCTVHLVTEDMDSGKILAQAAVPICP
                     NDTADSLAQRVLKAEHKLYPEALKAFIEGNNKITDAQQQLLSF"
     CDS             complement(12964..13350)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_00150"
                     /product="hypothetical protein"
                     /protein_id="GFF01581.1"
                     /transl_table=11
                     /translation="MKMKNVFSILITIIFIISQVVNVNAGLWRGASQDNRAVFFAQQH
                     NNAITQQYKDHFIRAVNIPFMLSPEASIGKETDLFSEGKVEKVLVITFTGLMIMLGVG
                     GWMSFLTFLGYKAAENDLLGKVGKKK"
     CDS             complement(13459..13860)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_00160"
                     /product="hypothetical protein"
                     /protein_id="GFF01582.1"
                     /transl_table=11
                     /translation="MKMKNVFSILITIIFIISQVVNVNAGLWRGASQDNRAVFFAQQH
                     NNAITQQYKDHFIRAVNIPFMLSPEASIGKETDLFSEGKVENVFIITSTILATGVFGA
                     FLGSIFTTMLMFLGGTFYKWAQEEDARKKKK"
     CDS             15427..15702
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_00170"
                     /product="hypothetical protein"
                     /protein_id="GFF01583.1"
                     /transl_table=11
                     /translation="MRRKPLSAFKIVETLTKRWEYFISAIFFCFDIVNNTKLADAQFP
                     LHSFAVCSDKKISKHFKNQDDVIGMEMSDFVLQAIMNAKELKKKPMQ"
     CDS             15823..16452
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_00180"
                     /note="frameshifted, insertion at around
                     16637,16650,16411,15795, deletion at around
                     16568,15690,16532,16696,16318"
                     /note="possible pseudo due to internal stop codon"
                     /product="hypothetical protein"
                     /protein_id="GFF01584.1"
                     /transl_table=11
                     /translation="MVTDNSKSDFIKVHDNRIIPYKKHLYMTATTRIFIKISKKRSSE
                     INAVLISMDEKKFYGKRLHHYTFIEAVDNELLTPYKTIIILDIDDKFITPAIQNIIAN
                     KNCKLDFDDAVKIIGCHRALTKTDKEVRDGITKDVGVKKFLSAYPGEIITKKYLSLCL
                     QSLTFKEYYACYANNFSQELPHIPCVKSAKNFGIFVYYWIRTLPFVCEL"
     CDS             16669..16863
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_00190"
                     /product="hypothetical protein"
                     /protein_id="GFF01585.1"
                     /transl_table=11
                     /translation="MNYGASICVRVIKQSGAVNDTNCYTVKTFSNLAYLLETFQQLIT
                     ISLETMKIVRNLSELEIKES"
     CDS             complement(17038..19515)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012708184.1"
                     /locus_tag="BH623125_00200"
                     /product="signal transduction histidine kinase"
                     /protein_id="GFF01586.1"
                     /transl_table=11
                     /translation="MILRVVFVIAFLFILGLLGFFYPQGFLQKATLIFFLALAIIGGA
                     ALVLVGMGILRYNAAQLYEDFDFTIFNNTDDAIIISDLSGFVYYSNQNYQKIFTYKPN
                     SSCYAVIADLPGAGALAYRLKVAAYSDLAAQEELRVEQSIFVHSPQKNSVWYNISVQP
                     MARRRKKFLFWRIADISHLQECREVFFSNLQEAINHLDQAPVGFLSVNTQGTILYANA
                     IFAEWFSIDLANFTVGKYSFDQLFDSVGANSSWSDICLQNNKYQSSGYSLPYRFSLSL
                     NSEIGLKILNCFMCASSLLEDKVIYRIVVIPQKIQKEENDNQLKLPSVLVEYFDASPF
                     AIAVVKQEGQLLYMNNAFLSLMGCTGNINLYDVISRRDRVQLERAFLKITTNKNYSVS
                     IETVLENSEERHLRLHVMSITPYHDDALRDLIIISVIETTEQKTLEDKMMQNQKMQAV
                     GQLAGGIAHDFNNVLTAILMSCDLLLNTHRSFDPAYADLINIKNNANRAAALVQQLLA
                     FSRKQTLQPEKVDFTELLSDIRNLILPLLGNNIQLKIIHGRDLWSVEVDQASFQRVIM
                     NLVINARDAMPNGGIVTIATNNITKQQSAEFHHVGFGFGEYVQLTISDTGTGISAAVQ
                     EKMFEPFFTTKEVGKGTGLGLSMVYGIIKQTGGYIYCDSREGEGTTFHIFLPRYIPDT
                     VHVGSQQIEKVEEQEKNTDLTGSATILLVEDEDAVRMGGVRALQMRGYTVLEAATGVE
                     ALAVLEENKGAVDIVISDVVMPEMDGPTLLKESRKNYPDIKFIFVSGYAKDAFAKNLP
                     QDAVFSFLSKPFTLKQLALKVKETLTQ"
     CDS             19789..20310
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_00210"
                     /product="hypothetical protein"
                     /protein_id="GFF01587.1"
                     /transl_table=11
                     /translation="MYVWLSSQIGTSAANIITSLVFFTITITAIAAIILFLRRLNTRR
                     FSINRKKHLSRLTLCDTIAVDRTRRLILVRCDDREHLLLIGGLTDVVIESNIINTSII
                     QKRKIQQALTTTETNQSFNITEKKPFSVSEKEHIQDALSTHFMKQQVEDSAITAEIEG
                     RLEPSLFVPAPPK"
     CDS             complement(20363..20779)
                     /codon_start=1
                     /gene="dksA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TC05"
                     /locus_tag="BH623125_00220"
                     /product="RNA polymerase-binding transcription factor
                     DksA"
                     /protein_id="GFF01588.1"
                     /transl_table=11
                     /translation="MSEEIDDQYRPSEDEPFMNERQKAYFRAKLVSWRNDILREARET
                     LENLQEENAGQPDLTDRASCETDRTIELRARDRQRKLISKIDAALERIDNGTYGFCEE
                     TGEPISIKRLEARPIAVLSLEAQERHERRERVYRDD"
     CDS             complement(21088..21609)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013532115.1"
                     /locus_tag="BH623125_00230"
                     /product="4-hydroxyphenylacetate 3-monooxygenase"
                     /protein_id="GFF01589.1"
                     /transl_table=11
                     /translation="MTHLMPKIQNIVTVSSQEYRDAMSHFAGAVHIVTTNGIKGKRGV
                     TISACCSLSDDPPTLLVCLMRHNLKNHLFIENGNFCVNSLAGKHRSLADIFSRRYNYT
                     ETECFDRAQWGTLQTGAPSLSDALASFDCRLICWHEHATHYILIGEVIAINRNQEKDA
                     LIYLNRGYHTLPL"
     CDS             21767..22441
                     /codon_start=1
                     /gene="rpe"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q92PJ4"
                     /locus_tag="BH623125_00240"
                     /product="ribulose-phosphate 3-epimerase"
                     /protein_id="GFF01590.1"
                     /transl_table=11
                     /translation="MPRSHLIAPSLLASNFSKLGQEVFDVIDAGADWIHLDIMDGHFV
                     PNITFGPDVVKALRPLTKAIFDVHLMIAPADPYLEAFAKAGADIITIHAEAGLHLHRS
                     LQKIKEIGKKAGIAINPSTPEHVLEYLLDQLDLILVMTVNPGFGGQNFIPEIKDKIKR
                     IKSMIANRPIDLEVDGGITVDTIGITAKAGANVFVAGSAIYKDGNKELYKTRINALRQ
                     AATLSQ"
     CDS             22452..23756
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A6U9K7"
                     /locus_tag="BH623125_00250"
                     /product="adenylosuccinate lyase"
                     /protein_id="GFF01591.1"
                     /transl_table=11
                     /translation="MIARYSRPEMITIWSPETKYRIWFEIEAHACDALAQLGIIPKEA
                     AKVIWEKGKAAKFDINRINEIEAITKHDVIAFLTHLAEFIGPEARFVHQGMTSSDVLD
                     TTLNIQLMRASDILLKDIDQLLEALKKRAFEHKETITIGRSHGIHAEPITFGVKFALA
                     YAEFSRCRKRLLAAQEEISTCAISGAVGTFANIDPRVEEHVAKALGLRAEPVSTQVIP
                     RDRHAMFFATLGVIASSIERLAIEIRHLQRTEVLEAEEYFSPGQKGSSAMPHKRNPVL
                     TENLTGLARMVRAFAIPAMENVALWHERDISHSSVERYIGPDATITLDFALARLTSVI
                     ENLIVYPENMQKNLNKFRGLVHSQRVLLALTQAGISREDSYRIVQRNAMKVWEQEKDF
                     LEELLHDKDVTEALSETELREKFDLSYHTKHINTIFKRVFGE"
     CDS             23839..24387
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010971907.1"
                     /locus_tag="BH623125_00260"
                     /product="alpha/beta hydrolase"
                     /protein_id="GFF01592.1"
                     /transl_table=11
                     /translation="MKANQLDILIVPGYKGSDPDHWQTRWEKKLSTARRVQQTHWSKP
                     ICEEWVNEVKIAIAQSQKPIVIIAHSLGVPTTIHATLKNAEKVRGAFFVAPPDVSNEK
                     IRPKHLMTFGPYHCKKLSFPSVVIASRNDEFCQFSVAEKLAGDWGALFVDAGLSGHIN
                     VESGHGPWPEGLMVFSHFLAKI"
     CDS             24562..25326
                     /codon_start=1
                     /gene="purC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A6U9L2"
                     /locus_tag="BH623125_00270"
                     /product="phosphoribosylaminoimidazole-succinocarboxamide
                     synthase"
                     /protein_id="GFF01593.1"
                     /transl_table=11
                     /translation="MNRRHRIYEGKAKILYEGPEPGTYIQFFKDDATAFNAKKHEIID
                     GKGVLNNRISEHIFSHLGRLGIPTHFIKRINMREQLIKAVEIIPLEVVVRNVAAGSLS
                     KRLGLEEGTPLSQSIIEFYYKNDSLDDPMVSEEHITAFGWAVPQEIEDIMQLSIRIND
                     FLSGLFAGVNIQLIDFKMEFGRLWEDEAMRIVLADEISPDSARLWDIQTQEKMDKDRF
                     RRDMGGLINAYQEVAKRLGIINENEPSRPNGPVLVK"
     CDS             25418..25657
                     /codon_start=1
                     /gene="purS"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8UEB6"
                     /locus_tag="BH623125_00280"
                     /product="phosphoribosylformylglycinamidine synthase
                     subunit PurS"
                     /protein_id="GFF01594.1"
                     /transl_table=11
                     /translation="MKARVIVTLKNSVLDPQGEAIIGALKSLSFTGIHSIRQGKVFDI
                     VLDDQSAKNAKQTLEQMCEELLANTVIENYTIELL"
     CDS             25669..26340
                     /codon_start=1
                     /gene="purQ"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:C3MD67"
                     /locus_tag="BH623125_00290"
                     /product="phosphoribosylformylglycinamidine synthase
                     subunit PurQ"
                     /protein_id="GFF01595.1"
                     /transl_table=11
                     /translation="MKTAIIQLPGLNRDRDMVAALHHITGVEPLKIWQTESTIPDVDV
                     IVIPGGFSYGDYLRCGAIGARTPVLQAVREKAQKGVTVIGICNGFQILLEAGLLPGTL
                     MRNTSLKFVCREIKLEVVNVNTKFSRYYSKGQIICCPVAHHDGNYFVDSETLKQMEEN
                     EQIIFRYAENTNPNGSVNDIAGIINKAGNILGMMPHPENFIEPAHGGTDGRLFFQSAL
                     ELAKG"
     CDS             26604..28826
                     /codon_start=1
                     /gene="purL"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q92PH7"
                     /locus_tag="BH623125_00300"
                     /product="phosphoribosylformylglycinamidine synthase
                     subunit PurL"
                     /protein_id="GFF01596.1"
                     /transl_table=11
                     /translation="MDKVLMKPCNNIAITPELIAQHGLKNDEYQHILTLIGREPTFTE
                     LGIFSAMWNEHCSYKSSKKWLKTLPTKGNCVIQGPGENAGVVDIGEGQCVVFKMESHN
                     HPSYIEPYQGAATGVGGILRDVFTMGARPIAAMNALRFGSPDHPRTRYLVAGVVSGIG
                     GYSNAFGVPTVGGEINFDERYNGNILVNAFVAGIAKKDSIFYSKAQGVGLPVVYLGAK
                     TGRDGVGGATMASAEFDDSISEKRPTVQVGDPFTEKCLLEACLELMELGAVVAIQDMG
                     AAGLTSSAVEMGAKGDLGIKLNLDKVPVREENMTAYEMMLSESQERMLMVLKPELEKQ
                     ASAIFHKWGLHFSIIGQTTDDLRFRVLHQGEEVVNLPIKELGNEAPVYDRPWSEPTPQ
                     PILKVEEVKKVENLGDVLLTLLNSAHQSSRRWVYEQYDTLIQGNTLVRPGADAGVIRV
                     SSNDKRALAFSSDVTPRYCEADPYEGGKQAVAECWRNISTTGAMPLAATDNLNFGNPE
                     KPEIMGQLVLAIKGIGEACRVLDFPIVSGNVSLYNETNGEAILPTPTIAGVGLLDDWS
                     KMVTISGMQNGDSIVLIGDCGSHLGQSIYARNVLNINTGAPPHVDLQLEKKHGQFVRD
                     VIHRGFVHAAHDISDGGLAIALAEMVIKAKKGIKAKLSNRLPHHAELFGEDQGRYLLS
                     IKPYVLNHLKELAQVNAVSLTEIGRVEGNSLNIEGILTLSVDKLTQAYESWFPQFMGE
                     "
     CDS             28893..29126
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010909092.1"
                     /locus_tag="BH623125_00310"
                     /product="ATP-binding protein"
                     /protein_id="GFF01597.1"
                     /transl_table=11
                     /translation="MAMSANEIKTLIREGIPDATIIIRDLAGDGEHYAAEVISESFRG
                     KSRVQQHKMVYDALKGNMGNGLHALMLQTNIPK"
     CDS             29233..29565
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q92PH5"
                     /locus_tag="BH623125_00320"
                     /product="glutaredoxin"
                     /protein_id="GFF01598.1"
                     /transl_table=11
                     /translation="MTTIRDFIDSEIKENDVILFMKGTPDAPQCGFSGQVAHILNYLG
                     VPYKGINILTSDELRQGIKDYSNWPTIPQLYVKGEFIGGCDIIKEMFQNNELQELLKE
                     KDIPCNKA"
     CDS             29636..30883
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010971915.1"
                     /locus_tag="BH623125_00330"
                     /product="Bcr/CflA family drug resistance efflux
                     transporter"
                     /protein_id="GFF01599.1"
                     /transl_table=11
                     /translation="MSHSIDEQTHSNALQKKIGYKEFVILIGALMAINSIAVDIMLPA
                     MPNILNSLHVINENDQHYIISSYLMSYGISQIFFGPISDRYGRRKLILIGLAFYSFAA
                     IACAFVSNFSLLLILRILQGIGGAAMRVLTISVVRDLYNGRKMAEVMSIVMMIFLIAP
                     IIGPSTGQFILLFGNWQVIFIFMAIIGFGLMIWIQLRLPETLYTQRSLSFSSIKHNLW
                     IVIINRTTLCYTLAASIILACIFTAVNTAQQTYEGIYNLGLWFPIVFAIGAAFQALSS
                     FFNSRFVGRLGMRRIAHTMLLLFCVTSCILFVGSILTDGIIPFPLYMLLFCILMFAFG
                     GMMANFNTLALESVGEIAGTTSSVSGFLQTSIGTGLSFFIAQQFNETITPNSVGFFFL
                     SLIAILLVLCAERGHLFRQYNTQ"
     CDS             complement(31816..34065)
                     /codon_start=1
                     /gene="parC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8THH2"
                     /locus_tag="BH623125_00340"
                     /product="DNA topoisomerase 4 subunit A"
                     /protein_id="GFF01600.1"
                     /transl_table=11
                     /translation="MSDKMNLPFDKEHIESIELRSALQERYLAYALSTITHRALPDVR
                     DGLKPVHRRIVHAMRLLKLNPGHSYAKCARIVGDVMGKFHPHGDASIYDALVRLAQNF
                     AVRYPLVDGQGNFGNIDGDNAAAMRYTEARMTEVAALLLEGINENAIDFRLTYNEEDE
                     EPIVLPGAFPNLLANGSSGIAVGMATSIPPHNVSELCDAALHLIAHPNARDEELNHFV
                     LGPDFPTGGILVEPKKSIEESYRVGRGFFRLRSRWHQETGNRGSYVLVVTEIPYQVQK
                     SRLIEKTAELLLARRLPMLEDIRDESAEDIRIVLIPKNRTVDPEILMESLFKLTDFEI
                     RFPLNLNVLSFGKVPNVLSLRESLKQWLEHRQEVLIRRSRYQLDEIERRLEILHGYLI
                     TYLNLDEVIQIIREEDEPKKKLIDRFELTENQAEAILNMRLRSLRKLEEFEIRKEFET
                     LRAEKEKLQNLLDSRTKQWKIISEEIIKVRKVFGPHTLLGKRRTTFEEAPRHDFDDIY
                     QAMIEKEPVTIVISEKGWMRALKGHLSDYNALSFKEGDCLKLAFPAFTTDKIVVISTG
                     GKFFAIAANSLPGGRGHGEPIRILVDMDDEHDLLTAFVHHTQEKLLLVSSHGNGFIVP
                     ATEVIANTRKGKQVMNVKFPDKVKLCVPVKGDHVAVVGENRKMLIFAIEQIPEMSRGK
                     GVRLQRYKQGGVVDVKTFNLSEGLSWQDTAERCFNRQASDLIEWMGVRSGVGRVVPKG
                     FPKSGKFTN"
     CDS             complement(34731..36521)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013532280.1"
                     /locus_tag="BH623125_00350"
                     /product="aspartate--tRNA ligase"
                     /protein_id="GFF01601.1"
                     /transl_table=11
                     /translation="MHRYRSHHCAALRKCDVGIKARLSGWVHRVRDHGGILFVDLRDH
                     FGITQIVADPASPAFKIIEKVRSEWVIRVDGEVRARSDEVINTSLPTGEIEIFAKEVE
                     ILSKSDELPLPVFGEPDYPEDIRLKYRFLDLRRETMHRNIMRRTEIIAAIRRSMQENG
                     FTEFTTPLLTASSPEGARDFLVPSRIHQGKFYALPQAPQQYKQLLMMSGFDRYFQIAP
                     CFRDEDPRADRLPGEFYQLDVEMSFVEQEDVLVTMEPIMRSLFEEFADGKPVTQSFPR
                     LSYEEAMRKYGSDKPDLRNPIIMEDVSQHFYDSGFKVFAQILANDENARVWAIPAKTG
                     GSRAFCDRMNGWAQSEGQPGLGYIFWREEQGKFEGAGPIAKNIGEQRTEALRMQLGLE
                     NGDACFFVAGDPKKFLPFAGAARTRVGEELDLVDRDCFSLAWIVDFPFFEWNEEEKKL
                     DFAHNPFSMPQGGKDALECQDPLTLKAFQYDLVCNGYEIASGGIRNHSPEMMLKVFNL
                     AGLSKEVVEDRFGGLYRAFHYGAPPHGGMAAGVDRIIMLLQGVKNLREVALFPMNQQA
                     LDLLMSAPSDVSPVQLRDLGIRIAPAAKND"
     CDS             36551..37810
                     /codon_start=1
                     /gene="rnd"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:C3M9G5"
                     /locus_tag="BH623125_00360"
                     /product="ribonuclease D"
                     /protein_id="GFF01602.1"
                     /transl_table=11
                     /translation="MRYKRFLTTICQDMRTKTQKKSQEKTNLNLSGYNRMMKLITQTT
                     DLEIALATLRNSDFVTIDTEFIRETTFWPQLCLIQLASPDTTVLIDPISQDIDLKPFF
                     DLMVNKKIVKVFHAARQDIETIYHLGGVIPSPLFDTQIAGSICGFGDSISYDQIVQRC
                     TGYQLDKSSRFTDWSFRPLSEKQLLYALADVTYLRDVYLLLKKQLEKNKRTHWMDDEI
                     AVLLEPKTYDMPENEAWKKVKGKIKKPRELAVLQKIAAWRERKARQYNIPRRHIIKDE
                     CLIEIAIQQPKDEADLKRLRSLNKNWDKFSIAHTLIKAVHEGLEVDLATLPALPKHNP
                     LNETSSAVIDLLKVLLKLVANENGIAPKIIATSNDLEKIANGCIKKNIPAMNGWRYEI
                     FGQKAEQMLKGKIGFYLSNGKINTKQL"
     CDS             complement(38351..38515)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_00370"
                     /product="hypothetical protein"
                     /protein_id="GFF01603.1"
                     /transl_table=11
                     /translation="MFERHKWGWRVDKNYKERNKMLRMNHLNAGVVGNIGFLQIDNGT
                     GLQIHFVVVE"
     CDS             complement(38687..40198)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013532415.1"
                     /locus_tag="BH623125_00380"
                     /product="exopolyphosphatase"
                     /protein_id="GFF01604.1"
                     /transl_table=11
                     /translation="MTYINAQGRLKGCKPIAVIDIGSNSVRLVIYEGLVRSPTVLFNE
                     KILCGLGQGVAKTGLLEENSMNMALRTLKRFRALCLQIGADEIYILATAAAREAKNGL
                     AFIQNAENILQNKIYLLSGSEEAVYSAYGVISTFYQPKGISGDLGGGSLELIDIDNSE
                     VGEGITLPLGGLRLQYMSNNDIAVAAKIAQEQFGKSAVVHKSMARCFYAVGGTWRNLA
                     KLHMATKHYRLPVMHGYEVDAVEMEDFLRFVVNGSIENMKGISAVSKNRRQLLSYGAI
                     ILIELIRCVGFEKIIFSGAGVREGFLYSRLPQEVRVSDPLIAACTEMAILRARSPKQA
                     EELIDFTTNAFEVFGILETENECRYRKAACLLADIGWRIHPDYRGNEAANQIALGSYP
                     GISHEGRAYAALAVFFRNTGSLIGEESLPIFQLASKDVIEKARILGEIMRIAHLFSAS
                     TTGVLPHLSWHKKIDHVVLHIPARYADLLGERPLSRLKKLSKIIELPLAFEIF"
     CDS             complement(40205..42385)
                     /codon_start=1
                     /gene="ppk"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q7CZW1"
                     /locus_tag="BH623125_00390"
                     /product="polyphosphate kinase"
                     /protein_id="GFF01605.1"
                     /transl_table=11
                     /translation="MEKTVADQISLSDITMKNPARFINREFSWLQFNNRVLMEAANSK
                     NPLLERLQFLSISATNLDEFFMVRVAGLAAQIRAGVTACSADGRTPQEQLDFVLAEIS
                     CLQDNQLRELSILRHELKQNNIEIICSAGLSETEKSWIEKYFLDTIFPVLTPLSVDPV
                     RPFPFIPNLGFSIALQLSRCADQHSFIALLPLPTTLRRFIPLPQKDNRFRFIACEDVI
                     NLFMRHVFPDYEVEGIGTFRVIRDSDIEVEEEAEDLVHFFETALKRRRRGQVIRIEFE
                     AKMPDHLRQFITNGLAVPENCINVLDGFLALNTVSEIVSIPRNDLKFAPYDPRVPECI
                     CQHKGDCFAAIRQNDIVIHHPYESFDVVVEFLRQAARDPDVIEIKQTLYRTSNDSPIV
                     SALIEAAEQGKSVTALVELKARFDEEANIRWARDLERAGVQVFFGFIALKTHAKMSLV
                     VRREGKRRCSYVHLGTGNYHPINAKVYTDLSFFTTDDDIAHDVALLFNYIAEYVRPNE
                     AMKIAFSPLTLRSRILEHIEGEITNARQGQLAAIWMKVNALVDPEIIDALYRASQAGV
                     QIDLVVRGICCLRPGIPGISDNIRVKSIVGRFLEHSRIFCFGNGVNLPSENALVYFGS
                     ADMMPRNLDYRIEILVPVFNKMVRQQILLQVMLANIIDNQQSFDILNDGTSQLITPQR
                     GESPFNAQEYFMANAGLSRMERSFDSSVSHLVALYQQKVKLYKD"
     CDS             42657..42896
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003495891.1"
                     /locus_tag="BH623125_00400"
                     /product="hypothetical protein"
                     /protein_id="GFF01606.1"
                     /transl_table=11
                     /translation="MADYNIPHFQNDLGYKIIEIGVKEFMCVGATQPFDHPHIFIDMG
                     STDEKICPYCSTLYRYDPSLSYNQTNPTGCLYNPK"
     CDS             42934..44178
                     /codon_start=1
                     /gene="nah"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010971722.1"
                     /locus_tag="BH623125_00410"
                     /product="salicylate hydroxylase"
                     /protein_id="GFF01607.1"
                     /transl_table=11
                     /translation="MNQSPIIVGGGIAGLSSALALAYKGIASTIIEKRKQLESVGAGI
                     QLTPNATCIFARWGILSKLTKMGVIPQFLQLRDGVSLKTHLHADLFNLSEKNWKSPYL
                     MIHRADLQKVLHDAVMGNPLIKYKAGEAVVSSNQTTSGINIKTIKTNVATKTEHYQFY
                     STPLLIGCDGVWSTLRQLAPFHEKANFSGFIAWRATTEFENLPKSFRSILQNRKTITA
                     WMGAKNHLIVYPIHSSEKLFNFVAITYGENVKEGWTYKGKKEKLKFLFQNWNQKILQI
                     FDHIDEWSYWPLFQMKHNRFLGLERQVFVGDCAHAALPFAAQGAAMAIEDAATLAEAL
                     SLKDLSLTKALLLYEKIRTPRITAVKKRGDFNRIAYHATGPIAVVRNFIMKIRTPESI
                     ISSLDWLYTYDAMNLTKNERNI"
     CDS             complement(44620..48108)
                     /codon_start=1
                     /gene="dnaE2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:C3MA80"
                     /locus_tag="BH623125_00420"
                     /product="DNA-directed DNA polymerase"
                     /protein_id="GFF01608.1"
                     /transl_table=11
                     /translation="MSEDKSKIRDEKQPFPHFIHLRVHSAYSLLEGALKIPQIIQHAI
                     SDHTPAVAITDTNNLFGALEFSQYCFSYGIQPIIGCQLTIDFGDGNDNPRLVKWRHPS
                     DFCSIVLLAASEIGYAHLVRLVSRAYLDKCDTDPPHIKADWLLSHNEGIIVLTGGRGG
                     PINFSLAEERKERAIERLIYLKKIFDDRLYVELQRHGSFDQKVEAALIELAYAYEIPL
                     VATNEAFFLNREGYEAHDALMAVAEGQIVSNPDRKRVTPDHYLKSQEEMVALFSDLPE
                     ALENSVEIALRCHTATPTRKPILPRFIEQSVDLNFTLEAEDRELLNQAKAGLKMRLKT
                     IGLAEGYTITDYEQRLDYEISVITRMQFSGYFLIVSDFIKWAKVHDIPVGPGRGSGAG
                     SLVAYALMITDVDPLRFSLLFERFLNPDRVSMPDFDIDFCQERREEVIHYVQKKYGRD
                     QVAQIITFGKLQARAVLRDVGRVLEVPYRQVEYLTKLVPAAPGSQVELADAIKDEPKF
                     EEEKKKDPAIGRTLDIALQLEGLYRHASTHAAGIVIGDRPLSELIPMYRDPRSDMPVT
                     QFNMKYVEQAGLVKFDFLGLKTLTVLKMAVDFVARKGIKINLSNIPLNDETTYAMMAR
                     GETVGIFQVESSGMRKALIGMKPDRIEDIIALVALYRPGPMENIPIYNARKHGEEEIA
                     SIHPKIDHLIKETQGVIVYQEQVMQIAQVLAGYSLGEADLLRRAMGKKIHTEMQKQRT
                     RFVNGAVAGGVDKDQADIIFDLLAKFADYGFNKSHAAAYAIISYQTAYMKAHHPVEFL
                     AASMTYDMMNTEKLNDFRREALRLGIKVIAPCVQTSHRVFEVGDNCIYYSLAAIKGVG
                     EAVVDHIVACRGNKVFKDLEDFCERIDPRIVNKRAMESLVCAGAFDCFNIAREVLLAS
                     LGTLHARALRILDDNSSGQTDIFGITSVLKEPLILSQASPWSLDEKLHREFQAIGFYF
                     SAHPLDEYQAILVKKRIQNWVNFANAVKAGATAARLAGTVVAKQVRKTKSGKKMGIVH
                     FSDTSGQYEAVLFSEALSDYEEILELGKSFIITVSAENRSEGVSLRLETAQSLEKEAA
                     QHHKMMRLFIKTVDMLPQIQQNLNPSGNGEVALILIQEDGLREVEITLPKRYKVNSRV
                     ASALKSIQGVVDVELT"
     CDS             48519..50627
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013531908.1"
                     /locus_tag="BH623125_00430"
                     /product="ATP-dependent DNA helicase RecG"
                     /protein_id="GFF01609.1"
                     /transl_table=11
                     /translation="MLPDLIRPLFTSVRILPGMSPKIYGLLAKVLNINATQREPTIID
                     LLQLMPYSVIDRRMRPNIAFAQEGNTVTLEIIIDQHHSPPIGRNRLPYRVSAHDQTGK
                     INLVFFHAQPPWLKKQLPEGKKVIVSGKVERFNGQLSMVHPDHIAPSKQSNQMPLIEP
                     IYPSTAGLSAKTLRRTIQNALEYIPLLPEWIEESVKKQQNFSSFSVALRRIHAPIDPD
                     DLALESTARKRLAYDELLACQLALGLMRLKTKSLVGTSRPPTGTYTEKLLKILPFQLT
                     NGQKKAIQDIANDLASPEPMLRLLQGDVGAGKTVVALMAMAQIAENRGQSALMTPTEV
                     LARQHFATIAPLAEKIGLQTVLLTGREKGKLRTNILNNISSSQASIIIGTHTLIQNNV
                     TYNNLSLAIIDEQHRFGVNQRLALTAKGHKPDMLVMTATPIPRTLVLTAFGDMDVSKI
                     TEKPMGRQPITTAILSLKRIDELIERIAVALEKGEKLYWICPLVEESITLELTSIESR
                     FAMLQERFGTSVGMIHGKMSTDKKEAAMASFKCGNIGILVATTVIEVGVDIPDASIII
                     IEHAEHFGLSQLHQLRGRVGRGEKKSSCILLYKDPLTKMAATRLNIIRSTEDGFKIAE
                     EDWRLRGEGELLGTRQSGMPEFHIANLAVHGDLLLLARRDARLFLQRDPHLSSEQGQA
                     LRLLLYLFGRDDATRLLRAG"
     CDS             complement(51280..51507)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_00440"
                     /product="hypothetical protein"
                     /protein_id="GFF01610.1"
                     /transl_table=11
                     /translation="MHANLSTTKTCFTVAMDGGNADRKANFTLAECVYKQDFDIFMIQ
                     FSHRTDFNDLLLSKRGNNERKQKQQSKYSFK"
     CDS             complement(51630..51845)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_00450"
                     /product="hypothetical protein"
                     /protein_id="GFF01611.1"
                     /transl_table=11
                     /translation="MRGITCELPPHLRFHDRFPHPLGITLPALVALVKNGCSFTFAIH
                     GTFLQVNRYETDQRSAKAMLDSVTGGA"
     CDS             complement(51888..52097)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_00460"
                     /product="hypothetical protein"
                     /protein_id="GFF01612.1"
                     /transl_table=11
                     /translation="MEMMGISYFIVMPAVLLERSYKLSKELLSSINKHFGIRLIVTHT
                     LSQNSFVSDVKKAKQKADKAREIWQ"
     CDS             complement(52562..52741)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_00470"
                     /product="hypothetical protein"
                     /protein_id="GFF01613.1"
                     /transl_table=11
                     /translation="MRHIFEDQIDGAIWTFSVENIKGKRDVTTEFRVPLSAEVMKVIL
                     SFLFLIVLSFQRMAK"
     CDS             complement(52845..53027)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_00480"
                     /product="hypothetical protein"
                     /protein_id="GFF01614.1"
                     /transl_table=11
                     /translation="MQYPCSYLAYKSCNNRENNLSVSICLKHVITLGLDVNLQGTAKA
                     RALLGKQLYKTTYRPL"
     CDS             complement(53819..55642)
                     /codon_start=1
                     /gene="glmS"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TC54"
                     /locus_tag="BH623125_00490"
                     /product="glutamine--fructose-6-phosphate
                     aminotransferase [isomerizing]"
                     /protein_id="GFF01615.1"
                     /transl_table=11
                     /translation="MCGIIGILGKRCVTSSLVESLKRLEYRGYDSSGIATVHNGRLYR
                     IRAEGKLVHLEEKLQKTPLKGNLGIGHTRWATHGVAVERNAHPHVTERLAIVHNGIIE
                     NFVELQKELIEDGYTFETETDTEVIAHLITRALKSGLSPQEAIRTSWKRLQGAFAIVV
                     IFEGEDNLMIAARSGPPLAIGYGKDEFFVGSDAIALAPFVDSISYMEDGDWAVLTRED
                     ITIYDVDNQPVKRPLTPLFEGALLASKGNHRHFMHKEMFEQPEVISHNLAHYLDLGNY
                     TVRSFQKLIDWKKINRILFASCGTAYYSTLVARYWFESFAALSVDNDVASEFRYREPP
                     INSDVLSVFVSQSGETADTLASLRYCREYGVKTATIVNVEQSTMAREADFVLPTRAGP
                     EIGVASTKAFTCQLATLAAMALDAAKQRGFLAEQAEHQFVQQLAEVPRILNEVLKLDN
                     KIEQICRNLVNVKGVLYLGRGTSYPIALEGALKLKELSYIHAEGYAAGELKHGPIALV
                     DEAIPVIVVAPYDRWFEKTCSNMQEVAARNGRIILITDKKGAEAVHLDILSTIVLPNI
                     PEFIAPIIYALPIQLIAYHTAVLLGTDVDQPRNLAKSVTVE"
     CDS             complement(55815..57161)
                     /codon_start=1
                     /gene="glmU"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TC55"
                     /locus_tag="BH623125_00500"
                     /product="bifunctional protein GlmU"
                     /protein_id="GFF01616.1"
                     /transl_table=11
                     /translation="MRSCLSIVLAAGEGTRMKSSLPKVLHKIAGLPLICHVIKQIELA
                     GVSQLAVVVGFGAKDVVHVVESFVKNAMIFEQKERLGTAHAVLSARLALQKGVDDVLI
                     VFGDTPLIEQDSLLQLRAQLAGGADVVVAGFRAFNPTGYGRLLEKNGKLIAIIEEKDA
                     SDEEKKLSFCNGGILALNGKYALSLLEKIGNNNSKREYYLTDIVSIASQEGLDVRVVE
                     VPFDNIIGVNNCFELFEADSLWQKRKARDLMLSGVTILKPETVYFSYDTQIKPGVMIE
                     PNVYFGLGVKVHSGAVIHAFSYLEGAVVGTDARIGPYARLRPGTELAGSVKIGNFCEV
                     KKAKIGKASKINHLSYIGDAEIGAQVNIGAGTITCNYDGFHKHKIMIGDHAFIGSNSA
                     LVSPLMIGDGSYIASGSVITEDVPMNSIALGRARQVTKKDYAMKLRARLSANQQKK"
     CDS             complement(57178..57966)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013531914.1"
                     /locus_tag="BH623125_00510"
                     /product="cytochrome C biogenesis protein CcdA"
                     /protein_id="GFF01617.1"
                     /transl_table=11
                     /translation="MIVEISTVGVFFAGALSFLSPCVLPLVPPYLCYMAGIGIDDFRS
                     EKHKGRVFIRWALLSSVIAFVMGFTTVFVALGASASTIGKLIAYYRDWFALSAGIIII
                     IFGLNFLGLFKIAFLFREARFQIHKRPSGPLGAYVIGLAFAFGWTPCIGPILGPVITL
                     AGTKETVGEGAVLLGVYALGLGVPFLIAALFSSSFMRFLGAFRIHLGKVEKIIGIFLV
                     VTGILFLTGSMQDFSFWLLEHYPLLNQIETIHWHDIVNFLGFSR"
     CDS             complement(58013..58939)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_006314350.1"
                     /locus_tag="BH623125_00520"
                     /product="hypothetical protein"
                     /protein_id="GFF01618.1"
                     /transl_table=11
                     /translation="MALILLLMWSRCAFSQEEGEQERKQEQSRSFISKSQNNEKENLI
                     SQTQLILHARLTNSNENIVKGLVWRVYAPILGVDNKLPLITTYEGGSARFDLEPGSYL
                     VHVSFGHASAVRHISLENGKSLVQNFNLDAGAVTLNATLLNGIVNEKELRFTLYEDEK
                     ENDDTGVVLSNIKPHSIVRLKAGRYHVASHYGSINAVVHSDIQVDAGKITEVSLEHQA
                     AQIVLKLVRQEGGEALADTSWSITNNSGDIMYETVGAYVSLVLAEGEYIAIAKNKDQI
                     YQKVFSVVSGRDEDINVVAKAQNMQQIDEEID"
     CDS             complement(59045..59368)
                     /codon_start=1
                     /gene="hesB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012707919.1"
                     /locus_tag="BH623125_00530"
                     /product="heme biosynthesis protein HemY"
                     /protein_id="GFF01619.1"
                     /transl_table=11
                     /translation="MGVNISDAAAKRIVQILSSEPDKIGLRVSVEGGGCSGFSYKYNL
                     VSETNEDDFVLKKGGAIVLIDSLSLPFMEGAEIDFVDDLIGQSFQIHNPNAVSSCGCG
                     VSFSI"
     CDS             59477..60679
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TKB0"
                     /locus_tag="BH623125_00540"
                     /product="deoxyguanosinetriphosphate
                     triphosphohydrolase-like protein"
                     /protein_id="GFF01620.1"
                     /transl_table=11
                     /translation="MDKSKINFNYQSRAVYSANPQTSRGRLFHETMNTLRSPFQRDRD
                     RIIHSNAFRRLKHKTQVFIADESDHYRTRLTHSIEVSQIARTLARALYLDEDLAESIA
                     LVHDFGHTPFGHAGEDALNEAMAPYGGFDHNAQALRIVTKLEQRYANFDGLNLTWETL
                     EGLVKHNGPLLGPYAKNKDIPIDILQYNAKQDLQLNCFAGLEAQCAAIADDIAYNAHD
                     VDDGLRSQFLTLDQFEQVSLTAALLNDIKKEHPQLDQTRRGYTLVRRQIKTMVEDVIK
                     QSQENLARVKPKSISDVHQAEQTIVTFSPTMAVYERELKDFLFKNLYYHDQVLNRRNA
                     AKRIVQKLFECYYENPDVMPENWHNKTAHLTNQELARLIADFLSGMTDHYALREYQHL
                     FDCTDNFI"
     CDS             60710..62467
                     /codon_start=1
                     /gene="argS"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TKB1"
                     /locus_tag="BH623125_00550"
                     /product="arginine--tRNA ligase"
                     /protein_id="GFF01621.1"
                     /transl_table=11
                     /translation="MNVFKNFEKKIKKSLESSDIKGKNGEDLDLSKITVDPPRDSSHG
                     HLSTNAAMVLAKSTGLNPRALAEKIIELLKNDPSVESINVAGPGFINIKLTKPFWQDL
                     IKSMLEKGISYGRIPMGQGKRINVEYVSANPTGPMHVGHCRGAVVGDVLSNLLQFVGY
                     NITKEYYINDAGKQIEVLAHSVLLRYREALGQKINEIPEGLYPGEYLIPLGQSLAQEF
                     GDKLLTIDKEEALSIVKERAIHEMMSMIRKDLAALNIYHDIFFSERMLYADNARAIRN
                     TINDLTLKGYIYKGKLPPPKGQNTEDWEPCEQTLFRSTDVGDDQDRVLIKSDGSYTYF
                     AADVAYFRDKFNRHFDEMIYILGADHAGYVKRLEAMAKAISNDKAKLSVFLCQLVKLF
                     RNGHPVRMSKRAGSFVTLRDVVEEVGSDPVRFMMLYRKCEAPLDFDFAKVTEQSKDNP
                     IFYVQYASARCHSVFRQAQETLCIENISNDKIIEHLNRLTDDNEIFLIRKLSEYPRII
                     EQAVVHKEPHRLAFYLYDLASSFHTHWNKGSDNLNLRFIQPDDRNLSFARLGLIQAIM
                     NILSSGLAIVGIKAATEMR"
     CDS             62611..65130
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_00560"
                     /product="hypothetical protein"
                     /protein_id="GFF01622.1"
                     /transl_table=11
                     /translation="MSDNNRKNPYEMKQDYEHHNPLEKLTRIFTPNKQRKNQKDLSSL
                     QIDQSISQSPKTSLHGDDFDLSFLEAEFENNLKNDLPLDEQKKQFNLHKTKNKTNSDV
                     ISTTLFNHPEKDSFLSEEKLSLPQSHNEEQILDALSPLPIQKNLSSQNKTSQTPAHPS
                     FEESNFDPLSENFFFDESERQDNNRIIPELGEQNKRFSQTIAPQQNTSNIQQNYDDNQ
                     SLHNSPINHPYKVSADQENWIEEYYTNVPNPSMKANTGFSSATLISEREGTERSKSTS
                     DFPSPLDSTQTNKSSDLKGFLQENHTDSYPQFYEEKLSEQETYAAQTPQYVDSQDQYI
                     NNAENISKQNNEKEVVYKQNNLNKISSSSKVFKDTQTDRFFAHNTMQRDTSPPSVDTY
                     KFSDEIVEKTGPIMVPEVPYEVPEYDVPTDGLKEEFSDVLNVGNVSAENFSQQKPQDK
                     VFNEIFNQTIQNSKENTYINPQEESTNYFPADNTKHTESLSYKSVDEIPYTSNPLSLE
                     NSIFSKTLTKSIILLILIAVSFVGYSRFFMSSQKNESTPIIHADNTPFKFKHQSTETK
                     NDVEHNLDIYKQTTGQNEKQENTQQFLIDNSEPPEDLAALNQQESTSFSPSSLDDSDV
                     EDAVTEAINHTIPTQKVQTVIVKQDGTVVLSPMHDTEKKTTDKYEEKIDQTTVDQLQE
                     SQPISSHFSDTKDKEAEDNLTSNIDKIIAENISTSSVEKKVENSFVPLPSHAKSNSEV
                     QTPASSHKNPPVQVRTQNSENYYVQLASQPTHALAKDSLKNMKSKFGFLIGTRPLNIQ
                     SAVIPGKGTYYRVRVQAQNRNEAINLCENIKNSGGSCFITR"
     CDS             complement(65321..65596)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_00570"
                     /product="hypothetical protein"
                     /protein_id="GFF01623.1"
                     /transl_table=11
                     /translation="MIDRNYQTYEERIAAEKTKHEQHNSIWKGIFVILLTLFILWFIF
                     GFLGSFFTKSPDRISHYNTTESSQTVTTPRKDLNPISPVPHNYKDTR"
     CDS             65904..67010
                     /codon_start=1
                     /gene="ilvE"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:C3MC47"
                     /locus_tag="BH623125_00580"
                     /product="branched-chain-amino-acid aminotransferase"
                     /protein_id="GFF01624.1"
                     /transl_table=11
                     /translation="MKSPTSSIPFKIEKHPSPLSDEEREHILKNPGFGQFFTDHMVII
                     KWTKDKGWHNAVISQYKSLEINPASTVLHYGQEIFEGLKAYRAKDGRILLFRPDANAQ
                     RFIESARRLAMPELPKDIFLDAVHKLVRIDQNWISGNPNASLYIRPFMFGNENFLGVR
                     PSEKYIFCIIASPVESYFKGEEKPVSVWLETDYSRAGPGGTGVAKCGGNYAASLLAQK
                     NAEQNNCSQVLFLDMVEHKWIEELGGMNVCFIMENNTLVTPALNGTILAGITRHSILK
                     LAQKMGLKIEERPYSFESLQEDARSNHLKEVFACGTAAVVTSIGRFKYKGGEFVIGNG
                     MIGEVTKKLRTQLVDLQKGNREDKNGWVHSVQLS"
     CDS             complement(67136..68122)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TD76"
                     /locus_tag="BH623125_00590"
                     /product="fructose-1,6-bisphosphatase"
                     /protein_id="GFF01625.1"
                     /transl_table=11
                     /translation="MPTTQKILNGLDRILTLELVRVTERAAVAAARWRGRGDEKAADQ
                     AAVDAMRKELNRLPVDGTVVIGEGERDEAPMLYIGEKIGLQNGLAIDIALDPLEGTTI
                     CAKNLPNSLAVVAIAEKGNLLYAPDVYMKKIAIGPGYPKGVVDIDASPTDNIYALAKA
                     KGVVVNQITVCIMDRPRHEKLINEVRSTGASIRLIGDGDVAAVIDTTDPDETGIDIYM
                     GIGGAPEGVLASAALRCIGGQMQGCLLLDTDEKIARAAKMGIDNPHKVYTMEEMAKGD
                     VLFSATGVTDGNILSGVKFTSRYIQTETLVMRSHTGTIRNIKAQHRDHSKFD"
     CDS             complement(68275..69585)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TD79"
                     /locus_tag="BH623125_00600"
                     /product="homoserine dehydrogenase"
                     /protein_id="GFF01626.1"
                     /transl_table=11
                     /translation="MEESLKVGIAGLGTVGSSVVRILREKANSLTCQCGRSIKVVAVS
                     ARDKSRNRGIDLSDVKWFDSPVEMASSDEIDVFVELIGGESDVVYAAVKKALETGHHV
                     VTANKALLAQHGGRLAVSAEKKGVFLHFEAAVAGGIPIIKVMRESLVSNHISRIYGIL
                     NGTCNYILTRMFTEGLSFKECLEDAQRLGYAEVDPTFDIGGNDTAHKLALLTSLAFGT
                     AVSLDDIYVEGISNISQIDIRAADELGYRIKLLGVALKTETGIEQRVHPTMVPTSSMI
                     AQIHGVTNALSIQSDLLGELLLSGPGAGGTATASAVIGDLADIAKARPGFQYAPVLGR
                     PALGLAPHKKARISHHAGGYFIRLNVHDRAGVFAAVAKHMAGNHISLESIVQRSFVES
                     QSVKTIILITHETTEVNVQQALAAIEKDGHLVAKSQFIRIEPMV"
     tRNA            71205..71279
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="BH623125_t00030"
                     /product="tRNA-Glu"
     CDS             71851..73065
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TFE6"
                     /locus_tag="BH623125_00610"
                     /product="isocitrate dehydrogenase [NADP]"
                     /protein_id="GFF01627.1"
                     /transl_table=11
                     /translation="MIKIKVENPIVEIDGDEMTRIIWKYIKDKLIHPYLDIELKYYDL
                     SVENRDATNDQVTIDSANAIKKYGVGIKCATITPDESRVKEFNLKKMWKSPNGTIRNI
                     LGGVIFREPIICKNVPRLVPNWTKPIIIGRHAFGDQYKATDFKFPGKGKLSIKFVGDD
                     NQVIEHDVFDAPSAGIAMAMYNLDESIRDFARASFNYGLQRNLPVYLSTKNTILKTYD
                     GRFKDIFQEIFDAEFKAEFENRKLYYEHRLIDDMVASALKWSGGYVWACKNYDGDVQS
                     DIVAQGFGSLGLMTSVLMTPDGKIVEAEAAHGTVTRHYRQYQKNEETSTNSIASIFAW
                     TRGLTHRAKLDNNEKLKNFATTLESVCIKTVEEGFMTKDLALLIGSKQKWLSTTGFLD
                     KIDENLKKAMGN"
     CDS             73488..74609
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_00620"
                     /product="hypothetical protein"
                     /protein_id="GFF01628.1"
                     /transl_table=11
                     /translation="MPLFLIGRFVQGFGSGSLLSLSYSMIRIIFNPSLWSHALSVISG
                     MWGISTLLGPAIGGISVQYGVWRVSFWIIGILAIIFSLIALKVLPKENKNDIPTSPLP
                     LLQLFILTLLIFIISAGGATDTTITKICGLIIGLSLLFVLAKIELSTLHPMLPRKSFS
                     FSSEFFPVYALILIMTTIVYSTELYFPLFLQELHGQDPLTAGYIAALMNLGWTCGALL
                     SADVSAKKIRRIIVYSPILSLLGVCTLLWLIPTEVSTPEYIFIICLALLTIGVSAGIA
                     WPHLLKRILQCANDEDSLRASESLTSVQLFSGALSATVAGTITNLAGLLDPGGIIGMI
                     LAAKTLLAVLISLLFCLGIPFALRVSYSLFKNPTGQSKN"
     CDS             complement(74654..75844)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:YP_001702169.1"
                     /locus_tag="BH623125_00630"
                     /product="putative permease of the major facilitator
                     superfamily protein"
                     /protein_id="GFF01629.1"
                     /transl_table=11
                     /translation="MKFSHKQNVLASEIDVRTRRLAILALAVGSFAIGTAEFVAMGLQ
                     PEMARNSSVDIPTAGQYISAYALGVVIGAPVLAVATAPFSRKTALIGLMFFYALANIA
                     TAFFSDFSILGTLRFLSGLPHGIYFGLATLVAASMVEMNERSKAVGSVMLGLTIATVL
                     GAPGATWIGQIVGWQIAFILVGALSLLCCLLIGVFLPAVLNAQKTSPLRELCVLKQKQ
                     VWFLLMMVSVGASGLFSVFTYIKSTLMHISGVSLDWVPFIMPLVGLGMVVGNLLGPKL
                     AVKIGISPLIFFSMLWSTFVFFFLSHAPLTAALGCFLVGTSFAAMPSIQTKIMNVAFH
                     GQILAGALMQSAFNIANALGAESGAWVLKLGYSYEYTAVLGGILTLCGLLIFCFLWYM
                     EKRN"
     CDS             complement(76641..77759)
                     /codon_start=1
                     /gene="tgt"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q92PY4"
                     /locus_tag="BH623125_00640"
                     /product="queuine tRNA-ribosyltransferase"
                     /protein_id="GFF01630.1"
                     /transl_table=11
                     /translation="MIKTFHYRKIAQDGSARRGEIITGRGCIRTPAFMPVGTAGTVKA
                     MYMDQIRALGADIILGNTYHLMLRPGAECVARLGGLHHFSRWHGPILTDSGGFQVMSL
                     AGIRKITEQSVIFRSYINGAYYEMSPERSIEIQGLLNSDIQMQLDQCIALPASEKEVE
                     SAMELSLRWAQRCKTAFGDQPDKALFGIVQGGDNMKMRERSAQALKEMGLKGYAIGGL
                     AVGEPQNVMTAVLDVTCPILPEDKPRYLMGVGTPDDILQSVARGIDMFDCVMPTRAGR
                     HGLAFTRFGRINLRNARYAEDPHPLDPQSLCPAANDYSCAYLHHLIRSGESLGGMLLT
                     WNNLFYYQQLMQGIRDAIEEGCYADFCAETRALWTKGR"
     CDS             complement(78923..79435)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A6U8Y6"
                     /locus_tag="BH623125_00650"
                     /product="peptidyl-prolyl cis-trans isomerase"
                     /protein_id="GFF01631.1"
                     /transl_table=11
                     /translation="MAEIKDPENTLILETTKGRVVIEFFADLAPSHVARIKELVREGA
                     YDNVIFHRVIDGFMAQTGDVQFGKKDGEKFNLSRAGMGGSEKPDLTAEFSNLSHKRGT
                     VSMARSQNPDSANSQFFICFANAPWLDRQYSIWGQVIEGMENIDQIKRGEPVVDPDAI
                     IKATIAADIE"
     CDS             complement(79458..80036)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TB08"
                     /locus_tag="BH623125_00660"
                     /product="peptidyl-prolyl cis-trans isomerase"
                     /protein_id="GFF01632.1"
                     /transl_table=11
                     /translation="MIVSLRVLSVLICFFCFFSLSAVADDSNVLVLSLKNGDVVIRLR
                     SDLAPKHVAQIKKLTKEGAYNNVVFHRVIPGFMAQTGDVQFGKKGSVDFDPKRIGMGR
                     SNYPNIPAEFSKEPFKRGTVGMARSQDPNSANSQFFICFSDAAFLNGQYTVVGEVIKG
                     MDVVDKIKKGTTSNNGSLTNPDVINAATLQAK"
     CDS             complement(80020..80541)
                     /codon_start=1
                     /gene="coaD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TB09"
                     /locus_tag="BH623125_00670"
                     /product="phosphopantetheine adenylyltransferase"
                     /protein_id="GFF01633.1"
                     /transl_table=11
                     /translation="MMKIALYAGSFDPLTNGHLDILKASFVLADKVIVAIGIQAKKES
                     LFSFEERVDLITQAGKELLNMGSDRLQVISFETLLIDKAREIGASFLIRGLRDGTDLD
                     YEMQMAGMNGLMAPELQTVFLPAGVLGRVITSTLVRQIASMGGDVAPFVPANVARALH
                     LKFQSSRGSDCVS"
     CDS             complement(80563..83358)
                     /codon_start=1
                     /gene="gyrA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A6U8W1"
                     /locus_tag="BH623125_00680"
                     /product="DNA gyrase subunit A"
                     /protein_id="GFF01634.1"
                     /transl_table=11
                     /translation="MTDLNPHPERDVMAGIEPVSIIDEMQRSYLDYAMSVIVSRALPD
                     VRDGLKPVHRRILHAMNEMGLSFNKPYRKSAGVVGEVMGKFHPHGDASIYDALVRMAQ
                     DFSLRNPLIDGQGNFGSVDGDPPAAMRYTECRLEKVSEELLADIDKDTVDFQDNYDGR
                     EREPVVLPARFPNLLVNGSGGIAVGMATNIPPHNLGEVLDACIALIDNPDITLDKIIE
                     IIPGPDFPTGGIILGHSGVRSAYETGRGSIIMRAKVDIEETRNGRQAIIVSEIPYQVN
                     KATMIEKMAELVRDKRIEGISDLRDESDRDGYRVVIELKRDVIADVVLNQLYRYTPLQ
                     TSFGCNMVALNGGKPEQMTLLDMLRAFVSFREEVVSRRTKYLLRKARERAHVLVGLAL
                     AVANIDEIIALIRKAPDPQTARIKLMERRWPAADVAPLIKLIDDPRHIIHADNTYNLS
                     EEQARAILELRLQRLTALGRDEIADELNKIGVDITDYLHILASRSRIMSIIKDELNVL
                     REAFATPRRTVFGFGSAEMDCEDLIAPEDMVVTVSHSGYIKRVPLSTYRAQRRGGKGR
                     SGMSTKDEDFVTRLFVVNTHTPVLFFSTRGIVYKEKVWRLPLGTPQSRGRALINMLPL
                     QQGERITTIMPLPEDEARWSALDVMFATTRGTVRRNKLSDFVQINRNGKIAMKLDEED
                     EILSVETCTERHDVVLTTAKGQCIRFPVVEVRVFAGRNSVGVRGINLANDDKVISMTI
                     LEHVEATSVERSAYIKRVINERRAAGSDAEDLVTLDEEDEAVDTELTEGRYLELHARE
                     QMLLTVSEFGYGKRSSSYEFRISGRGGKGIRATDPSKTAEIGKLVAAFPVKAQDQIML
                     VSDGGQLIRVPVEGIRIAGRSTKGVTIFNTAEGEKVVSVERISESEDDDNQLDDETEK
                     CSEAVDDSEMIDLSEGK"
     CDS             complement(83591..84109)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TB16"
                     /locus_tag="BH623125_00690"
                     /product="single-stranded DNA-binding protein"
                     /protein_id="GFF01635.1"
                     /transl_table=11
                     /translation="MAGSLNKVILIGNLGADPEIRRLNSGDQVANLRIATSESWRDRN
                     TNERKERTEWHNIVIFNENLVKVVEQYLKKGSKIYIEGQLQTRKWQDQNGNDRYTTEI
                     VLQKYRGELQMLDGRAAAGGEQMQGANQSSGAYSSVGFGDNSANQRDVFGSNNSQLGE
                     SFSHKLDDDVPF"
     CDS             84450..87365
                     /codon_start=1
                     /gene="uvrA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TB22"
                     /locus_tag="BH623125_00700"
                     /product="UvrABC system protein A"
                     /protein_id="GFF01636.1"
                     /transl_table=11
                     /translation="MAYQKYISIRGAREHNLKNIDIDLPRNKLIVITGLSGSGKSSLA
                     FDTIYAEGQRRYVESLSAYARQFLEMMQKPDVDRIDGLSPAISIEQKTTSRNPRSTVG
                     TVTEIHDYMRLLFARIGIPHSPATGLPIESQTVSQMVDQIMALPEDTRIFIMAPLVRG
                     RKGEYKKELTELLKKGFQRAKVDGIFYEIPDIPSLDKKYKHDIDVVVDRIVVRGDIAA
                     RLADSIETCLQLADGIAVVEMADQPLAQKATAKESAHKSKNETHKRLIFSEKFSCPIS
                     GFSIPEIEPRLFSFNNPFGACPSCDGLGTKKAIDPKKIVPNEDLTLEAGAIAPWSKSA
                     SSSQSQILEALGKIYGFKLTDKWNTLSNEAQQAILYGIKRKEIPFDNKSDPSAYKTIQ
                     YYEGIIPNMERRWKETDSAWSREEIEHYMSSSLCPACHGYRLKPEALAVKINGKHIGQ
                     ISELSILKADDWFANIHQYLTEKQWNIAVRILKEIRERLAFLNHVGLEYLSLSRNSGT
                     LSGGESQRIRLASQIGSGLTGVLYILDEPSIGLHQRDNERLLKMLHHLRDLGNTVIVV
                     EHDEDAIRIADHVVDMGPAAGVHGGEVIAQGTPQEIIESPSSLTGQYLSGKMAVTVPV
                     QRRKISKSKILKIIGAKGNNLKNISATIPLGTFTCITGVSGGGKSTFLIETLFKAASH
                     HIMGTHQSPAIYDKIEGLEFLDKVIDINQSPIGRTPRSNPATYTGAFTPIREWFAELP
                     ESKARGYQAGRFSFNVKGGRCEACQGDGVIKIEMHFLPDIYVTCDICQGKRYNRETLE
                     IKFKGKSIADILDMTIEKAEDFFQAVPNIHNKMKTLMKVGLGYIKVGQQATTLSGGEA
                     QRVKLAKELSRKTTGRTLYILDEPTTGLHFHDISKLLEVLHELVEQGNTVAVIEHNLE
                     VIKTADWIIDLGPEGGDRGGEIVAIGRPEDIINVSASYTGKFLKEILLRQPFINPNS"
     CDS             87642..87980
                     /codon_start=1
                     /gene="glnB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:P14179"
                     /locus_tag="BH623125_00710"
                     /product="nitrogen regulatory protein P-II"
                     /protein_id="GFF01637.1"
                     /transl_table=11
                     /translation="MKKIEAIIKPFKLDEVKEALQKIGLHSITVTEAKGFGCQKGHTE
                     LYRGAKYVIDFLPKVKIEIVIADEKLEQAIDTIRKAAQTKHIGDGKIFVSSIDHAIRI
                     GTGKSGIDAL"
     CDS             88037..89446
                     /codon_start=1
                     /gene="glnA3"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:C3MCG7"
                     /locus_tag="BH623125_00720"
                     /product="glutamine synthetase"
                     /protein_id="GFF01638.1"
                     /transl_table=11
                     /translation="MTTASDILKQIADNDIRFVDLRFTDPRGKLHHITIDIAEISEDT
                     FNDGVMFDGSSISGWKTIHESDMVLMPDPETAHIDPFFAQSTLVIFCDVLDPVSGEFY
                     RRDPRSIAKRAEVYMKSLGIGDTINVGPEAEFFIFDDVRYKVAPYNTGFKLDSSELPS
                     NDDTEYETGNLGHRPRMKGGYLPVPPIDPCQDMRSEMLTVLKDMGIRVEKHHHEVAAG
                     QHELGIRFDTLVREADKMQIFKYVVHQIANSYGKTATFMPKPVFGDNGSGMHVHMSIW
                     KDGKPIFAGNEYAGLSETCLFFIGGIIKHAKAINAFTNPSTNSYKRLVPGYEAPVLLA
                     YSVRNRSASCRIPMTPSPNSKRVEVRFPDPTANPYLAFAALLMAGLDGIKNKIHPGHA
                     MDKDLYDLPLKELKDIPTVSGSLREALEALDKDRSFLKAGDVFDDDQINSFIQVKMQE
                     VLRYETTPHPIEFDMYYSV"
     CDS             89598..90143
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_00730"
                     /product="hypothetical protein"
                     /protein_id="GFF01639.1"
                     /transl_table=11
                     /translation="MLRTRNLFPIFLCIAFIISITQAYTITSPKLIAFEKAASAYSKA
                     LQNADANAILNAIPPQIINSLMAKKNLSKSQFQQIMKSQIQRLAENYKIESIQINQKQ
                     KREGKLDNGIPYFVIPVNFITTTNSGKKRSIQTEVIALFSNNQWYFIRGNDEAILNIT
                     NDAFPGLEKIKINPQKITKIM"
     CDS             complement(90188..90970)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010971649.1"
                     /locus_tag="BH623125_00740"
                     /product="ATPase"
                     /protein_id="GFF01640.1"
                     /transl_table=11
                     /translation="MREILNHFDRPLNKKNSFQKIQNLSCQTHTKRFYREVKISCEEG
                     GFSVLLDGCPVKTPAKRHFCLPTEVFAAFVAEEFENQKQVIDPAKMPMTRLVNTVIDG
                     IADNMQAVFEDLLRFVACDMIFYRAQTPKELVQRQCEQWDPLLDWAEEKLGARFHVTE
                     GLMHIEQSRESIQAVSNYLRKVESPYMLAALHTITTLTGSALIALAFSEGKIDSEHAW
                     KIAHLDENWMMEQWGIDEETLARSSHKKSEFDAAGTIITTCL"
     CDS             complement(91714..92697)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TMF5"
                     /locus_tag="BH623125_00750"
                     /product="pseudouridine synthase"
                     /protein_id="GFF01641.1"
                     /transl_table=11
                     /translation="MAGVEIKKVEVDESGMRLDRWFKAHYPGLGFGHLQKLLRSGQIR
                     IDGRRVKADTRLLMGQVVRIPPLPVNDMGSLPVTDKTLRGQDDEVILKKMLLYEDPKI
                     FVFNKPAGLAVQGGSGLTRHVDSMLRVWRNKKGEKPRLVHRLDRETSGVLIVARSRGA
                     AQALTTAFRTRETKKTYWALVRGVPKKKQDKISTWMVKDISTQVDKMRVCEHGEPDSY
                     HAVSYYRVVDTRGRALSWLEMEPYTGRTHQLRVHAAHMDHPIIGDAKYFFSDSNWTLP
                     GGIQNRLHLHARRIRIPHPSGGILDIVAPLPPHMVQSFNLLAFDEHEGETE"
     CDS             92936..94723
                     /codon_start=1
                     /gene="ndvA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8THJ1"
                     /locus_tag="BH623125_00760"
                     /product="beta-(1-->2)glucan export ATP-binding/permease
                     protein NdvA"
                     /protein_id="GFF01642.1"
                     /transl_table=11
                     /translation="MSLFRTYARVLTYLNKEKNASLLICSANVMLAIITIAEPILFGH
                     VIDSIAEKSAIIPTLTIWVCFGISHILAYVLIARGADRLVHRRRLAVLTESFERIIAM
                     PLIWHQQRGTSNALHILLRAVDSMATIWLDFMRQHLSTLVALFVLIPIAFNMNWRLSI
                     VLVVLAIIYVLIARLVMRKTKDGQAAVECYHHNLFQHVSDSISNVSIVQSYNRIKEET
                     SILHQHTNDLLKAQNPVLNWWALASGLNRMASTISIVCVLLLGAFFVAKGQLRVGEVV
                     SFVGFAQLMISRLDQMSNFINLTISSQAKLQEFFAMEDSTFQSKEPENLPSLQNVKGA
                     IQFHHVTYKFPNSSQGIFDISFEVKTGQTVAIVGPTGAGKTTLINLLQRIYDPTLGHI
                     SIDGINIRSVNRESLRKSLATVFQDAGLFNRTIHDNISIGRTTATNEELYEAAKIAAA
                     HDFILKKTDRYNTMIGEQGSQLSGGEKQRLAIARAVLKNAPILILDEATSALDVETEA
                     RVKDALDCISHNRTTFIIAHRLSTVRNADLVLFLEQGHLIEKGSFQELIAKGGRFYKL
                     LKAGSLAINQPTIETKDENVIPLHEAIAS"
     CDS             complement(94812..97499)
                     /codon_start=1
                     /gene="alaS"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:P27866"
                     /locus_tag="BH623125_00770"
                     /product="alanine--tRNA ligase"
                     /protein_id="GFF01643.1"
                     /transl_table=11
                     /translation="MLYSAGVDMNSVNSIRSTFLDYFQLNGHKIVSSSPLVPRNDPTL
                     MFTNAGMVQFKNVFTGLEQRPYKQATTAQKCVRAGGKHNDLDNVGYTARHHTFFEMLG
                     NFSFGDYFKEEAIFLSWNLLTKEFCLPEDKLLVTVYHNDDVSTELWRKISGLPDEKIV
                     RIATADNFWAMGDTGPCGPCSEIFYDHGDEIWGGPPGSAYEDGDRFIEIWNLVFMQYE
                     QVNKEKRVELPHPSIDTGMGLERIAAVLQGGHDNYDIDLFRALIAVSQEITGVKATGD
                     FIASHRVIADHLRSSAFLIADGVLPSNEGRGYVLRRIMRRAMRHAHLLGAKEPLMWRL
                     LPVLIHEMGQAYPELVRAESLISETLKLEEIRFRKTLERGLGLLSEASTDLKEGDHLN
                     GEIAFKLYDTYGFPLDLTQDALRCRGISVDVAAFNKAMEGQKAKARANWSGSGETVTE
                     AIWFSVRDQLGATEFLGYETEKSEGILTALVRDGEIVDDISSGQKAILVVNQTPFYGE
                     SGGQIGDSGTISGKNFVFEVHDTQKKADGVFIHIGEVKSGQARMSECVELTVDGVRRK
                     KIRVNHSATHLLHEALRQVLGSHVTQKGSLVSPDRLRFDFSHPKSVSLEELEKIEDLA
                     NEIVLQNSEVTTRLMLVDDAISEGAMALFGEKYGDEVRVVSMGNRLEKGKLKSRWSIE
                     LCGGTHVERTGDIGLIHIVSESSVAAGVRRIEALTGTAARLYLSRQDARVHEIADLLK
                     TSATDVEERVRILLEDRRKLEKELNDERKKSVLSGGIVKSDQEDITIINGISFMGRVV
                     KNISPRDLKTLVDSGKKKIGSGVVAFIGVSEDGKGSAVLGVTDDLTHKLNAVDLVRIL
                     SGILGGQGGGGRPDMAQSGGPKGNKADEALAVLKASLEG"
     CDS             complement(97684..98727)
                     /codon_start=1
                     /gene="recA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TG98"
                     /locus_tag="BH623125_00780"
                     /product="protein RecA"
                     /protein_id="GFF01644.1"
                     /transl_table=11
                     /translation="MDKIKALDAALSQIERSFGKGSIMRLGQKEQVVEIETIPTGSLS
                     LDIALGVGGLPKGRIVEIYGPESSGKTTLALHAIAEAQKNGGVCAFIDAEHALDPIYA
                     RKLGVDLENLFISQPDTGEQALEITETLVRSGAVDVLVVDSVAALTPRAEIDGEMGDA
                     LPGLQARLMSKALRKLTASIFRSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYAS
                     VRLDIRRIGSIKDRDMIVGNQTRVKVVKNKLAPPFKQVEFDIIYGEGISKLGELIDLG
                     VKVGTVEKSGSWFSYNSQRLGQGRENAKQFLREHPEIATEIETALRQNAGLIAIELLE
                     NAGSENTESDEVI"
     CDS             complement(99343..100593)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011975192.1"
                     /locus_tag="BH623125_00790"
                     /product="ATPase AAA"
                     /protein_id="GFF01645.1"
                     /transl_table=11
                     /translation="MRPHSLNDVTGQSHLVGEKGLLSRIVAAGSIGSMIFWGPPGTGK
                     TTVARLLALETNFAFEQVSAIFTGVAELKKIFESAQARFMSGSQTVLFVDEIHRFNRA
                     QQDSFLPVMEDGTVILIGATTENPSFELNAALLSRARVLTFLPHDNESLGMLLKRAEA
                     LEEKTLPLDDNARDVLIDMSDGDARAALTLAEEVWSVARPGEIFDAAALRKIVQRRAP
                     IYDKGRDGHYNLISALHKSVRGSDPDAALYYLARMFDAGEDPLYIGRRLVRMAVEDVG
                     LADPQALVICNAAKDAYDYLGSPEGELALAQACLYVATAPKSNATYLAYKAAMRCARK
                     NGSLPPPKHILNAPTKFMKEEGYGHGYCYDHDEPDAFSGQEYFPEKLGRQSYYQPVER
                     GFEREIAKRLEWWKQLRKKRANQK"
     CDS             complement(100671..102062)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013531440.1"
                     /locus_tag="BH623125_00800"
                     /product="serine endoprotease DegQ"
                     /protein_id="GFF01646.1"
                     /transl_table=11
                     /translation="MRYSFVGWFFWAIMAQISFHCAYAEIPQTQKEITLSFAPLVKKT
                     IPSVVNIYAARQIRARSPFEGDPFFEQFFSRFQNNLPVRKQSSLGSGVIVDKRGLVVT
                     NYHVIKDANEIKVALSDGREFESKVMLKDEATDIAVLEIDAKEAQFPVLPLGDSDAVK
                     VGDLVLAIGNPFGVGQTVTSGIVSAQARTRVGISDFDFFIQTDAAINPGNSGGALIDM
                     KGQLIGINTAIYSRSGGSVGIGFAIPANLVKVMLDTVRRGGKYFVPPYIGASFQNVTP
                     DIAGGLGLERPYGALVIEVIKDSPAKKAGLRVGDVILSVQGIRVDSPDSLGYRLMTAG
                     IGDSLVLEYLRSGKTFQTKITISSIPDAFSKSEKIIDEGPLSGAEVLDLTPQNSRRFH
                     LSTSAKGVVISNLDEMSNAAGIFRTGDILRVINGHKIQTVSQLKKILMQDRPRVWQLE
                     YERDGMYIRQFIR"
     CDS             complement(102347..102775)
                     /codon_start=1
                     /gene="rplQ"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:C3MB04"
                     /locus_tag="BH623125_00810"
                     /product="50S ribosomal protein L17"
                     /protein_id="GFF01647.1"
                     /transl_table=11
                     /translation="MRHSKSGRKLNRTASHRKAMFANMAISLIEHEQIVTTLPKAKEI
                     RPIVERLVTLGKRGGLHARRQAIASLRDAGKVAKLFDTLAPRYASRNGGYLRIMKAGF
                     RTGDNAPMAVIEFVDRDVDAKGAVDRVRTESSANEKEASS"
     CDS             complement(102800..103813)
                     /codon_start=1
                     /gene="rpoA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TME8"
                     /locus_tag="BH623125_00820"
                     /product="DNA-directed RNA polymerase subunit alpha"
                     /protein_id="GFF01648.1"
                     /transl_table=11
                     /translation="MIQKNWQELIKPNKVEFSKHDNPNISSVIVEPLERGFGLTLGNA
                     LRRVLLSSLRGAAITAVQIDGVLHEFSSIPGVREDVTDIILNIKEIALRMREEGPKRI
                     VVCKEGPGVLRAGDISTVGDMEILNPDHVICTLDEDAEIRMEFIVNTGKGYVPSDRNC
                     IDDARIGLIPVDSLYSPIRKVSYKVENTREGQVLDYDKLTLTVETNGAVNGEDALAFA
                     ARILQDQLALFINFKEPEKPTVEESNSELAFNPALLKKVDELELSVRSANCLKNDNIV
                     YIGDLIQKTESEMLRTPNFGRKSLNEIKEVLACMGLHLGMEVPTWPPENIDDLAKRYE
                     DQY"
     CDS             complement(103908..104297)
                     /codon_start=1
                     /gene="rpsK"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q925W7"
                     /locus_tag="BH623125_00830"
                     /product="30S ribosomal protein S11"
                     /protein_id="GFF01649.1"
                     /transl_table=11
                     /translation="MAKEATRVRRRERKNISSGVVHINSTFNNTMITITDAQGNAIAW
                     SSAGAQGFKGSRKSTPFAAQVAAEDCARKAQEHGMRSLEVEVCGPGSGRESALRALQS
                     VGFIITSIRDVTPIPHNGCRPRKRRRV"
     CDS             complement(104446..104814)
                     /codon_start=1
                     /gene="rpsM"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TME6"
                     /locus_tag="BH623125_00840"
                     /product="30S ribosomal protein S13"
                     /protein_id="GFF01650.1"
                     /transl_table=11
                     /translation="MARIAGVNIPTNKRVIIALQYIHGIGPKFAQEITKKVGIPIGRR
                     VHELSDAEVLQIREAIDQGYQVEGDLRREVAMNVKRLMDLGCYRGLRHRRSLPVRGQR
                     THTNARTRKGPAKAIAGKKK"
     CDS             complement(104996..105574)
                     /codon_start=1
                     /gene="adk"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:C3MB00"
                     /locus_tag="BH623125_00850"
                     /product="adenylate kinase"
                     /protein_id="GFF01651.1"
                     /transl_table=11
                     /translation="MRIVLLGPPGAGKGTQAKMLCEEYHIPQLSTGDMLREVIRRETE
                     IGKKAKAMINAGTLVSDSIVNQIVSDRIDESDCINGFVLDGYPRTVGQAEVLQQVLQS
                     KNMQLDAVIELIVDEDALLERMKKRVQETIIAGGQVRSDDNPVAFAKRLVEYREKTAP
                     LSEFYLQRRLLKLVDGMIGVTEVSRKIREVLK"
     CDS             complement(105571..106917)
                     /codon_start=1
                     /gene="secY"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TME4"
                     /locus_tag="BH623125_00860"
                     /product="protein translocase subunit SecY"
                     /protein_id="GFF01652.1"
                     /transl_table=11
                     /translation="MASAAEQFASNINFGTFSRATELKKRIWFTLGALLVYRFGTYIS
                     LPGINIDALRQTFEHHASGVLGLFNMFAGGAVGRMAIFALGIMPYISASIIVQLLTSI
                     IPSLETLKKEGELGRKIINQYTRYVTVVLAILQAFGIAVALETGIGTGLQIVLEPGFM
                     FRISSVITLVGGTMFLMWLGEQITSRGVGNGVSLIIFTGIVANLPSTFAQLLTAHSQA
                     DLSTFLFITIIFIAVSVIAIIVFVERAQRRILIQYPKRQVGNQMFQGDMSHLPLKLNT
                     AGVIPPIFASSLLLLPATVNNFSDKMPQWVQAISYSLGHGQPLYMIVYAILMAFFCFF
                     YTAIVFNPSDTADQLKKHSGFIPGIRPGERTAEYIDYVLTRITVVGAIYIILVCLLPE
                     FMISALQVPFYLGGTSLLIVVTVTLDTVAQIQGHLVAHQYEGLIKKSKLRGGRRNR"
     CDS             complement(107082..107546)
                     /codon_start=1
                     /gene="rplO"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A6U878"
                     /locus_tag="BH623125_00870"
                     /product="50S ribosomal protein L15"
                     /protein_id="GFF01653.1"
                     /transl_table=11
                     /translation="MKLNELSDCKGAIRNRKRVGRGIGSGTGKTGGRGVKGQRSRSGV
                     SLNGFEGGQMPIYRRLPKRGFRNFFAKDYNEVSLGRIQSAIDTGKLNIEKPVDIIALK
                     EAGIIRRVKDGVRLLSDGELKVKISFNVSYASKAARLKIEKAGGQVHFPETV"
     CDS             complement(107567..107773)
                     /codon_start=1
                     /gene="rpmD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:P68995"
                     /locus_tag="BH623125_00880"
                     /product="50S ribosomal protein L30"
                     /protein_id="GFF01654.1"
                     /transl_table=11
                     /translation="MVQKKSQSSKTVTVEQIGSPIRNSQIQRATLKGLGLNKMHRRRV
                     LEDTLCVRGMIAKVQHLVRVIDES"
     CDS             complement(107805..108353)
                     /codon_start=1
                     /gene="rpsE"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TME1"
                     /locus_tag="BH623125_00890"
                     /product="30S ribosomal protein S5"
                     /protein_id="GFF01655.1"
                     /transl_table=11
                     /translation="MAQKERSERDERESEFVDRLVHINRVAKVVKGGRRFGFAALVVV
                     GDQKGRVGFGHGKAREVPEAVRKATESAKRGMIYVPLRSGRTLHHDLEGHHGAGRVLL
                     RSASAGTGIIAGGPMRAIFETLGMQDVVAKSLGSSNPYNMVRATFDALKRQMHPRDIA
                     AQRGIKYSTLQARRQHLVDAEG"
     CDS             complement(108471..108833)
                     /codon_start=1
                     /gene="rplR"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q92QF4"
                     /locus_tag="BH623125_00900"
                     /product="50S ribosomal protein L18"
                     /protein_id="GFF01656.1"
                     /transl_table=11
                     /translation="MVSSKDIIQRRARRVRRRIKMVSGNRLRLSIYRSNQNIYAQIID
                     DLRGCTLVSASTLDGDLKKSLKSGSDKEAAFAVGKLIAERAKKAGVNEVVFDRGAYVY
                     HGRVKALAEAAREGGLNF"
     CDS             complement(108846..109379)
                     /codon_start=1
                     /gene="rplF"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TMD9"
                     /locus_tag="BH623125_00910"
                     /product="50S ribosomal protein L6"
                     /protein_id="GFF01657.1"
                     /transl_table=11
                     /translation="MSRIGKKPISVPSGVTATVEGQLVKAKGPKGELSYLVNDEVLVK
                     LEESFISVSPRDQSKDARSKWGMSRSMIENIFCGVKDGFEKRLEINGVGYRAALQGKD
                     IQLSLGFSHDVIYKVPSGVTVSIPKPTEIVVSGIDKQQVGQVAAEIREYRRPEPYKGK
                     GIKHADERIFRKEGKKK"
     CDS             complement(109418..109816)
                     /codon_start=1
                     /gene="rpsH"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:C3MAZ4"
                     /locus_tag="BH623125_00920"
                     /product="30S ribosomal protein S8"
                     /protein_id="GFF01658.1"
                     /transl_table=11
                     /translation="MSMSDPLGDMLTRIRNALARKKGKVVTPASKLRARVLDVLQSEG
                     YIRGYNQVDLGDGKSEIEIELKYFEGLAAIREISRVSKPGRRVYVSAKSIPHVANGLG
                     ISILSTPKGVMADYEARKQNVGGELLCRVF"
     CDS             complement(109831..110136)
                     /codon_start=1
                     /gene="rpsN"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:C3MAZ3"
                     /locus_tag="BH623125_00930"
                     /product="30S ribosomal protein S14"
                     /protein_id="GFF01659.1"
                     /transl_table=11
                     /translation="MAKVSAVEKNKRREIMVKRYAARRARLKAIVMDQKISLEERFKA
                     SVQLAELPRNSAKVRVRNRCEVSGRPRAYYRKLKMSRIALRELGSVGHIPGIIKSSW"
     CDS             complement(110161..110718)
                     /codon_start=1
                     /gene="rplE"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TMD6"
                     /locus_tag="BH623125_00940"
                     /product="50S ribosomal protein L5"
                     /protein_id="GFF01660.1"
                     /transl_table=11
                     /translation="MAEEKQTPRMKTHYFEVVRKTLQEKFNYKNVMQIPRVDKIVINM
                     GIGEATADSKKPSIAAEDLGLITGQKAVVTRARNSIATFKVREGMPLGAKVTLRKDRM
                     FEFLDRLVTIALPRVRDFRGLNPKSFDGRGNFAMGIKEHIVFPEINYDKVDQIWGMDI
                     IVCTTAKTDDEARELLRAFNFPFRS"
     CDS             complement(110711..111025)
                     /codon_start=1
                     /gene="rplX"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:C3MAZ1"
                     /locus_tag="BH623125_00950"
                     /product="50S ribosomal protein L24"
                     /protein_id="GFF01661.1"
                     /transl_table=11
                     /translation="MQKIRKGDKVIVLSGKDKGCSGEVIKVNPKENRAFVRGVNMIKR
                     HQRQTQNQEAGIISKEAPIHLSNLAIADPKDGKPTRVGFRVNADGNKVRFAKRSGELI
                     NG"
     CDS             complement(111038..111406)
                     /codon_start=1
                     /gene="rplN"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8UE28"
                     /locus_tag="BH623125_00960"
                     /product="50S ribosomal protein L14"
                     /protein_id="GFF01662.1"
                     /transl_table=11
                     /translation="MIQMQTNLDVADNSGARRVMCIKVLGGSKRKYASVGDIIVVSVK
                     DAIPRGRVKKGDVMKAVVVRTAKDIRRADGSVIRFDGNAAVLVDNKKEPIGTRIFGPV
                     PRELRARNHMKIISLAPEVL"
     CDS             complement(111551..111790)
                     /codon_start=1
                     /gene="rpsQ"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TMD3"
                     /locus_tag="BH623125_00970"
                     /product="30S ribosomal protein S17"
                     /protein_id="GFF01663.1"
                     /transl_table=11
                     /translation="MPKRVLQGVVVSDKNDKTVVVKVERRYSHPLLKKTVRQSKKYKA
                     HDESNQFKIGDQIFIQESKPISKDKRWIVVKDSVA"
     CDS             complement(111802..112002)
                     /codon_start=1
                     /gene="rpmC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q92QG2"
                     /locus_tag="BH623125_00980"
                     /product="50S ribosomal protein L29"
                     /protein_id="GFF01664.1"
                     /transl_table=11
                     /translation="MRARELRAQTLDQMKDELVKLKKEQFNLRFQKATGQLEKVSRVK
                     QVRRDIARVKTFLRQKINENKV"
     CDS             complement(112015..112428)
                     /codon_start=1
                     /gene="rplP"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:B8H4E1"
                     /locus_tag="BH623125_00990"
                     /product="50S ribosomal protein L16"
                     /protein_id="GFF01665.1"
                     /transl_table=11
                     /translation="MLQPKRTRFRKQFKGRIHGVSKGGTDLNFGAYGLKAVEPERITA
                     RQIEAARRAITRYMKRSGRVWIRIFPDLPVTSKPTEVRMGKGKGSVDYWAARVAPGRI
                     MFELDGIPEDVAREALRLGAAKLPIKTRFIQRIAE"
     CDS             complement(112464..113174)
                     /codon_start=1
                     /gene="rpsC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q92QG4"
                     /locus_tag="BH623125_01000"
                     /product="30S ribosomal protein S3"
                     /protein_id="GFF01666.1"
                     /transl_table=11
                     /translation="MGQKINPIGLRLGVNRTWDSRWYADSGEYGRLLHEDLKIRLYVL
                     EELKQAAVSKIVIERPHKKCRVTIYSARPGLIIGKKGADIEKLRRKLSEMTNAETSLN
                     IVEIHKPEIDATIIAQSIAQQLERRVAFRRAMKRAVQSALRLGAEGIRINCSGRLGGA
                     EIARMEWYREGRVPLHTLRSDVDYGTAEAKTAYGICGVKVWVFKGEILEYDPMASERR
                     AAEVDHSGSSSNRRRENA"
     CDS             complement(113174..113563)
                     /codon_start=1
                     /gene="rplV"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:C3MAY5"
                     /locus_tag="BH623125_01010"
                     /product="50S ribosomal protein L22"
                     /protein_id="GFF01667.1"
                     /transl_table=11
                     /translation="MGKAKFPRQLKDNEAKAVARTIRVSPQKLNLVAAMIRGKKVGAA
                     LADLTFSRKRIAGTVKKTLESAVANAENNHDLDIDSLVVAEAYVGKSIVMKRFHVRGR
                     GRASRIERPFSHLTIIVREVIEKVEVA"
     CDS             complement(113566..113844)
                     /codon_start=1
                     /gene="rpsS"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A6U863"
                     /locus_tag="BH623125_01020"
                     /product="30S ribosomal protein S19"
                     /protein_id="GFF01668.1"
                     /transl_table=11
                     /translation="MVRSVWKGPFVDGYLLGKAEKVRASGRNEVIKIWSRRSTILPQF
                     VGLTFGVHNGNKHIPVSVSEEMVGHKFGEFAPTRTYYGHGADKKAKRK"
     CDS             complement(113860..114693)
                     /codon_start=1
                     /gene="rplB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A6U862"
                     /locus_tag="BH623125_01030"
                     /product="50S ribosomal protein L2"
                     /protein_id="GFF01669.1"
                     /transl_table=11
                     /translation="MALKQFNPTTPGQRQLVIVDRSCLYKGKSVKTLTEGLSSKGGRN
                     NRGRVTARFQGGGHKRSYRFVDFKRFKRDVPAKVERLEYDPNRTAFIALIRYEDGQLS
                     YILAPQRLDVGDSVIAGSNVDIKPGNAMPLGNMPVGTIIHNVEMKPGKGGQIARSAGA
                     YAQLVGRDQGMAILRLNSGEQRLVSSGCFATVGAVSNPDHANINDGKAGRSRWRGRRP
                     HVRGVAMNPVDHPHGGGEGRTSGGRHPVSPWGKPTKGKRTRSNKATDKFIMRTRHQRK
                     K"
     CDS             complement(114715..115008)
                     /codon_start=1
                     /gene="rplW"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TMC6"
                     /locus_tag="BH623125_01040"
                     /product="50S ribosomal protein L23"
                     /protein_id="GFF01670.1"
                     /transl_table=11
                     /translation="MKNLRHYDVIVSPIITEKSTMISEYNQVAFNVAPKATKPEIKAA
                     VEALFSVKVKAVNTIVRKGKVKRFKGIVGRQNDVKKAIVTLASGQSIDVSTGL"
     CDS             complement(115005..115625)
                     /codon_start=1
                     /gene="rplD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q92QG9"
                     /locus_tag="BH623125_01050"
                     /product="50S ribosomal protein L4"
                     /protein_id="GFF01671.1"
                     /transl_table=11
                     /translation="MDLLIKTLDGNEVGKLKVSESVFGLVPREDILQRVVRWQLARRQ
                     QGTHQSQGRSDVSRTGAKMFKQKGTGRARHSSARAPQFRGGGKAHGPVVRSHAHTLPK
                     KIRALGLRFALSAKLKADDLIVVDEFNVKDAKTRMLVSCFSKLGFDNALLIGGNEVDL
                     NFSRATSNIPNIDILPIQGINVYDILRRSKLVLSKAAVEVLEERFK"
     CDS             complement(115625..116365)
                     /codon_start=1
                     /gene="rplC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TMC4"
                     /locus_tag="BH623125_01060"
                     /product="50S ribosomal protein L3"
                     /protein_id="GFF01672.1"
                     /transl_table=11
                     /translation="MRSGVIAQKLGMTRIYNDAGEHVPVTVLRLENCQVVAQRTVEKN
                     GYTAVQLGVGFAKVKNTSQALRGHFAKASVEPKAKIAEFRVSPDNLLDIGTEITAEHF
                     VPGQRVDVTGTTIGKGFAGVMKRHNFGGHRASHGNSITHRAHGSTGQCQDPGKVFKGK
                     KMAGHMGQVRVTTQNIEVVSTDVERGLILVRGAVSGSKGAWILVRDAIKKPLPDNAPK
                     PAGIRQLAKEKTEMVAPVTETSEVEGAE"
     CDS             complement(116393..116701)
                     /codon_start=1
                     /gene="rpsJ"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TMC3"
                     /locus_tag="BH623125_01070"
                     /product="30S ribosomal protein S10"
                     /protein_id="GFF01673.1"
                     /transl_table=11
                     /translation="MNSQNIRIRLKAFDHRILDASTREIVSTAKRTGANVRGPIPLPT
                     RIEKFTVNRGPHIDKKSREQFEMRTHKRLLDIVDPTPQTVDALMKLDLSAGVDVEIKL
                     "
     CDS             complement(116767..117942)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:YP_001326657.1"
                     /locus_tag="BH623125_01080"
                     /product="elongation factor Tu"
                     /protein_id="GFF01674.1"
                     /transl_table=11
                     /translation="MAKSKFERTKPHVNIGTIGHVDHGKTSLTAAITKYFGEFKAYDQ
                     IDAAPEERARGITISTAHVEYETEKRHYAHVDCPGHADYVKNMITGAAQMDGAILVVS
                     AADGPMPQTREHILLARQVGVPAIVVFLNKVDQVDDAELLELVELEVRELLSKYDFPG
                     DDIPIVKGSALAALEDKDKSIGEDAVRLLMSEVDNYIPTPERPVDQPFLMPIEDVFSI
                     SGRGTVVTGRVERGVIKVGEEVEIIGIRPTSKTTVTGVEMFRKLLDQGQAGDNIGALL
                     RGIDREGIERGQVLAKPASVTPHTRFKAEAYILTKDEGGRHTPFFTNYRPQFYFRTTD
                     VTGIVTLPEGTEMVMPGDNVAMDVSLIVPIAMEEKLRFAIREGGRTVGAGIVSKIIE"
     CDS             complement(118007..120091)
                     /codon_start=1
                     /gene="fusA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q92QH2"
                     /locus_tag="BH623125_01090"
                     /product="elongation factor G"
                     /protein_id="GFF01675.1"
                     /transl_table=11
                     /translation="MAREYKIEDYRNFGIMAHIDAGKTTMTERILFYTGKNHKIGETH
                     DGASTMDWMEQEQERGITITSAATTTFWEGRDGRKRRFNIIDTPGHVDFTIEVERSLR
                     VLDGAIALLDANAGVEPQTETVWRQAEKYRVPRMVFVNKMDKIGADFYRSVEMVGSRL
                     GAKALVLQLPIGAENDFEGVVDLIEMQALRWDGSIGASATVGEIPSGLKEKAEEYREK
                     LVEMAVEVDEAATEAYLEGVMPTNEQLVALIRKGTVEVQFHPVLCGTAFKNKGVQPLL
                     DAVVSYLPSPVDVPAISGVDVKTEGETTRESSDDAPLSMLAFKIMNDPFVGSLTFCRI
                     YSGKVQKGISLENTVKRKKERLGRMLQMHSNSREDIEEAFAGDIVALAGLKETTTGDT
                     LCDPLKPVILERMEFPEPVIEIAIEPKTKADQEKMGIALNRLAAEDPSFRVKSDEESG
                     QTIIAGMGELHLDIIVDRMRREFKVEANVGQPQVAYRESITKIAEIDYTHKKQSGGAG
                     QFARVKIIFEPHDGDDFIFESKIVGGAVPKEYIPGVQKGIESVMGSGPLAGFPMLGVK
                     ATLVDGGYHDVDSSVLAFEIAARAAFRDGAKKAGAQLLEPIMKVEVVTPEDYVGDVIG
                     DLNSRRGQISGTEARGIATVVNAMVPLANMFGYVNSLRSMSQGRAQYTMQFDHYEPVP
                     SAVALEIQKKYA"
     CDS             complement(120121..120591)
                     /codon_start=1
                     /gene="rpsG"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TMC0"
                     /locus_tag="BH623125_01100"
                     /product="30S ribosomal protein S7"
                     /protein_id="GFF01676.1"
                     /transl_table=11
                     /translation="MSRRHKAEKREINPDPKFGDLVITKFMNAIMFDGKKSVAERIVY
                     GALDVVESKVKSDPVALFHRALENVAPHIEVRSRRVGGATYQVPIDVRPDRRQALAIR
                     WLISAARGRNEATMIDRLSGELMDAANNRGSAVKKREDVHRMAEANRAFSHYRW"
     CDS             complement(120610..121041)
                     /codon_start=1
                     /gene="rpsL"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TMB9"
                     /locus_tag="BH623125_01110"
                     /product="30S ribosomal protein S12"
                     /protein_id="GFF01677.1"
                     /transl_table=11
                     /translation="MKINEAQVGETNVDRKEEGYMPTVNQLIRKPRITPIKRNKVPAL
                     QSNPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTNGFEVIGYIPGEGHNLQEHSVVMI
                     RGGRVKDLPGVRYHIIRGLLDTQGVKNRKQRRSKYGAKRPK"
     CDS             121537..122319
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013531286.1"
                     /locus_tag="BH623125_01120"
                     /product="exodeoxyribonuclease III"
                     /protein_id="GFF01678.1"
                     /transl_table=11
                     /translation="MKIVTWNIAGIKARHETLYQWLQQNRPDIVCLQEIKSTDENFPR
                     DAIESLGYHIETHGQKSFNGVAILSKKTPDEVIRQLPGNDKDEQTRYIEAVYSTNKGV
                     IRVASLYLPNGNPINSEKYPYKMEWMERLYTHAKSLLKYEEPLVLAGDYNVIPTPLDA
                     KTPKEWSDDALFLPQTRQAFQRIIHLGFYDAIRNVTDTPSFSFWDFQAAAWRKNNGIR
                     IDHLLLSPEAVDQLICAYSQKEVRGYQKPSDHTPVWIDLNFN"
     CDS             122444..123355
                     /codon_start=1
                     /gene="glnH"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_002210339.1"
                     /locus_tag="BH623125_01130"
                     /product="glutamate/aspartate ABC transporter
                     substrate-binding protein"
                     /protein_id="GFF01679.1"
                     /transl_table=11
                     /translation="MRKSLLIFIAATTTIIGLIGIAKAENDTLEKIKKTGEVTLGVRE
                     SSGLGYALGNGKYVGFHTEMAEHIIDDISKKIGKPIKIHYLPITSQNRIPLLQNNTYD
                     FECGSTTNDIFRSKEAAFAYTTYVEEVRIAVKKNSNIKSLEDLNGKTIATTTGTTAVQ
                     LIRKNKRAKNINFKVVKGKDHGDSFLLLESGRADAFIMDASILAGHIAKSKNPSDYVI
                     LDTVLSVEPIACMLRLNDQNLEHAINESIVHQIKDHSLEKLYDKWFMKPIPPANTIVN
                     LALSELTKYAWEHPNNKPREDYSENNL"
     CDS             123499..124251
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011389841.1"
                     /locus_tag="BH623125_01140"
                     /product="glutamate ABC transporter permease"
                     /protein_id="GFF01680.1"
                     /transl_table=11
                     /translation="MDFSFLCKDDLTQTLVAGCLGIPGVSHTYLDTLLESLKNTFVLS
                     ISSLILAIFLGVIVGTMRTLPNTSMTNCSFRTIGYIWVEVMRNIPLLVQVFLWYFVVP
                     KIYPPAINYSPILLITCALGFFTSARIAEQVRSGIEAISSGQRYAAMAMGFTTYQIYR
                     YIILPRAMRTIMPPLTSEAMGIVKNSSIAFAVSINELMQFQYQTIEEMSHVYENYLIV
                     TILYIFIALFIFIIMTVIEQMLKIPNFQTKGH"
     CDS             124495..124971
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_01150"
                     /product="hypothetical protein"
                     /protein_id="GFF01681.1"
                     /transl_table=11
                     /translation="MRSIPLVMVILWFFVLLPFITGTSIGANKSALITFTAFETAYFA
                     EIIRAGINSVSQGQKHAGQALGMTYWQNMYIVILPQAFRDMLPVFLTQVIILFQDTTL
                     VYAISGNSLLNGFDIVANNFGVKQEAYILAAIFYFVICFTLSQIVLYLQKKISIIR"
     CDS             124983..125729
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011268728.1"
                     /locus_tag="BH623125_01160"
                     /product="arginine ABC transporter ATP-binding protein"
                     /protein_id="GFF01682.1"
                     /transl_table=11
                     /translation="MSTHMIEIKNVSNWYGEINVLKNCTTTIDKGEVVVICGPSGSGK
                     STLIKTINALVPFQKGEIWIDGTPVHSKKTNLSKLRSHVGMVFQHFELFPHLSVIENL
                     TIAQIKVLKRSKKEALERALLYLERVGLIEHKNKYPGQLSGGQQQRVAIARALTMDPL
                     VMLFDEPTSALDPEMVGEVLDVMISLAEEGMTMICVTHEMGFAQKVSERVIFMDQGRI
                     LEDCSSKEFFSSPQDRTPRAQEFLSKILNH"
     CDS             complement(125826..126620)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013531284.1"
                     /locus_tag="BH623125_01170"
                     /product="hypothetical protein"
                     /protein_id="GFF01683.1"
                     /transl_table=11
                     /translation="MLNRLKLWKKTAIIIILSGFFSNNVYGMDVNSAQKASYNSFYFF
                     KRGMSAYKNGQINQAIAALRCAANMGHIGANWKLGHIYADGDGVPEDNYKAYNFFAYI
                     VEKGADLDSENESYVSDALVELAGYIKKGIPQSPVKSNPSYAARLYMQAAMNYGNPKA
                     QYYLGEIFLKGEGREKNLVQAARWFQLSARKGNPPAQAMLGNMLFQAGKTVRGVAMLT
                     AAYEKANPKDRDWIGPLQERAFATCDEFERSRAMSLVADMLKNNSF"
     CDS             complement(127229..129952)
                     /codon_start=1
                     /gene="valS"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TKA2"
                     /locus_tag="BH623125_01180"
                     /product="valine--tRNA ligase"
                     /protein_id="GFF01684.1"
                     /transl_table=11
                     /translation="MLEKNYDAASIEQRIAKKWEARGAFKAGMGSKSAAQSFCVMLPP
                     PNVTGSLHMGHALNTTIQDIVVRFQRMRGKNVLWQPGMDHAGIATQMVVERQLAERQE
                     PTRQEMGREKFVERIWEWRYETGGVIANQLRRLGVSCDWSRERFTMDDGLSEAVREVF
                     VTLYKQGLIYRDKRLVNWDPKLLTAISDLEVEQKEVKGHLWHFRYPLEGKLFDPSDAT
                     TFITVATTRPETMLGDTGIAVNPEDDRYRNLIGQNAILPLVGRRLSIVADAYANPDEG
                     SGAVKITPAHDFNDFEVGRRNNLRLINIFTEKAEVFLHENEAFFEGVVLSDALKMLVK
                     DLDQKDRFIARDQIVSLMEEKGYLVTVDDHPHTVPYGDRSGVPIEPFLTDQWYVNAAE
                     LAKPAIEAVHQGKTQFIPDSWQKTYFNWMQNIQPWCVSRQLWWGHQIPAWYGPDGRVF
                     VEKSEEEALNSALSHYGEVVNLTRDPDVLDTWFSSALWPFSTLGWPNKTPELATFYPT
                     SLSVTGFDIIFFWVARMMMMGLHFMGEVPFPTVYVHALVRDQKGAKMSKSKGNIIDPL
                     ELIDQYSADSLRFTLAIMAAQGRDVKLDPSRIAGYRNFATKLWNATRFAQMNGVKHDP
                     DFKPEKAKLALNRWILTELSKTVVAVTTGIENYKFNESASALYRFIWNTLCDWYLELL
                     KPIFQGSNEDAKNEVQACTAWVLDEVYKLLHPFMPHMTEELWSLTETLGMKREDMLAL
                     IQWPEASFSDEEAASDINWLIDAVSAIRSVRFEMNIPAAALAPLVIVEGGELTLKRVE
                     LYESLLKKLARVETISFSDKAPALSAQMILGEAIFCLPLGQLIDLEAERARLMKDVSK
                     IEQDIEKLSAKLSNPKFIENAKPEIVEVERNRIVELRTAQKKISLALERLV"
     CDS             complement(130088..130648)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_01190"
                     /product="hypothetical protein"
                     /protein_id="GFF01685.1"
                     /transl_table=11
                     /translation="MVQSSSVLREPSMDEILTSIREIIEENAVHPDYFSNEGAAGNSS
                     RENLEIPSEGVYDTSLSVDDAMKALADRIGLSSENHDFSLTKDKESIEAENNTVGVDM
                     QKMKRSSEEQSSVHRTQEHNKPFSQSENVIAGHVELSAYCISSAEKIAKDVLRPAIAE
                     WLQHKLPVLLEDILREEIVRAIKKSS"
     CDS             complement(130901..132106)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013531279.1"
                     /locus_tag="BH623125_01200"
                     /product="transporter"
                     /protein_id="GFF01686.1"
                     /transl_table=11
                     /translation="MDAFSKAYIHNAKLKSERAAVRISDDDVVIARSGLLPQIEGIGS
                     YGRSKSIIGPYSTSGSFGVRLNQRLFDGFITQNIFFSAQVKLQAQREYLRNAEQNIFL
                     DTVTAYANVYQARRIADLRKENLAALEEQVRSNKAKFDVGEGGRVDLSQAQAARSVAV
                     SELSLARADVKSAEAVYRQVIGSDPENLKRPPVAKGLPVNLNAAYQMSVALHPAILYA
                     KYLVDASFYNVKAKEGTLLPKIDFSAAASYNRIYSGLGEDGVSKSIGLSVNIPIFEGG
                     RTTAQIRQSKERLGQAHLQLDLARNNIRQALTSAWFQLEGARASVVAYRESVRAAEIA
                     LKGRVQENRVGQATTLDVLNSRTQLINAQIALAMAERNAVVASYGVQSSVGKLTADYL
                     GLKTVKYNR"
     CDS             complement(132257..132931)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011975318.1"
                     /locus_tag="BH623125_01210"
                     /product="protein-L-isoaspartate O-methyltransferase"
                     /protein_id="GFF01687.1"
                     /transl_table=11
                     /translation="MVADFAELRRKMVDNQIRTVDVTDLSVLEAFLMVPREDFVPENM
                     KALSYLDTDILLYPAQEGVPACYLMGPAPLAKLLQLAAVKSSDIVLDIGANGGYCAAL
                     LSKLARSVIALEAHKALLERTASTLERNQCNNVVVVHGALEQGYAVEGPYDVIFIEGS
                     VDFIPKIIFDQMKDGGRLVVVEGHGNAGVALIYVKEDGIISARRAFNLAVKRISGFLK
                     TPDFIF"
     tRNA            complement(133134..133207)
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="BH623125_t00040"
                     /product="tRNA-Cys"
     tRNA            133395..133469
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="BH623125_t00050"
                     /product="tRNA-Asn"
     CDS             complement(134598..134825)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_01220"
                     /product="hypothetical protein"
                     /protein_id="GFF01688.1"
                     /transl_table=11
                     /translation="MIFWFKRHLFLVMMALAVFFMVLARAFQLGKKSEQYKKTEYALK
                     TATTRLEVENEINQKSDVDVRTDLFNWLRNK"
     CDS             complement(134878..135327)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_01230"
                     /note="frameshifted, deletion at around 135365"
                     /product="hypothetical protein"
                     /protein_id="GFF01689.1"
                     /transl_table=11
                     /translation="MRITQEQAEAIFCEDLKQFGKTVEQSVKVCLTDAQIAALVSFCY
                     NVETQAFCKSTLLKKLNNGAYESVPAELQKWNKVGGKAIQGFVNRRAAEAGLWAKGSY
                     VCFNTQRVETKNTIGLLKIETLAPMIGSCSGLGGLLVGNGPLPALWF"
     CDS             complement(135279..135470)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_01240"
                     /product="hypothetical protein"
                     /protein_id="GFF01690.1"
                     /transl_table=11
                     /translation="MRKVSQEGLALIKQWEGLRLEACKDTVCVWSIGYGHPVKRVLRL
                     SKKECVLRKNKRKQSFVKT"
     CDS             complement(135548..135697)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_01250"
                     /product="hypothetical protein"
                     /protein_id="GFF01691.1"
                     /transl_table=11
                     /translation="METDIPIGFNGNATDILEKRYQYELKENEHAHLDFSVAEVEQLI
                     KDNKE"
     CDS             complement(135999..137381)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013531456.1"
                     /locus_tag="BH623125_01260"
                     /product="DEAD/DEAH box helicase"
                     /protein_id="GFF01692.1"
                     /transl_table=11
                     /translation="MNVNRENIFTKLGLSALLVKNLTIAGMSKPKPIQEQAIPMMLKG
                     HDILGIAQTGSGKTLAFSLPILSQILALGDKRFPKTARALILAPTRELAVQIDETIRA
                     VAKGTHLSTCLIFGGVSRLKQIKRMEAGVDILIATPGRLRDLIREKYVDLSQSRFLIL
                     DEADRMLDMGFIHDIRHIVKLLHQVRQTALFSATMPKEITTLAKCLLNDPVKIEVSPQ
                     GTTAAEIAQKLYCVPTCEKKNVLGKLLTNPDFVSVIVFTRTKYCADAVTRNLASRGYS
                     VATIHGNKSQSARQSALKAFRERSVRILVATDIAARGIDIPGISHVINYDLPDEAESY
                     VHRIGRTGRNGASGEALTLFDEGVEQMRLRAVERLICMRLVRETIPEQFAAFPEKPLV
                     IEGIEKENIKGPHFRKSKRQKWFKSHKDNAAQSEGRKSSSQSERHRKAKAIAKRAKSF
                     HSRKSVNKVA"
     CDS             complement(138218..139495)
                     /codon_start=1
                     /gene="ilvA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TKE6"
                     /locus_tag="BH623125_01270"
                     /product="L-threonine dehydratase"
                     /protein_id="GFF01693.1"
                     /transl_table=11
                     /translation="MTAVMSKFIQDVNKAMVALHNVFAETPLQRNDFLSQKYDAEIYL
                     KREDLTPVRSYKIRGAFNFVSEMLSKISQNAAFVCASAGNHAQGVSFVCRYFKRKGVI
                     FMPVTTPQQKIDKTRVFGKEFVDIRLIGETFDQCYAAAQSFATESGGVMAPPFDDTRI
                     ITGQATVLCEAVLQWKKLNGESEPDLILVPVGGGGLASGVSKFLHEYGWKTELRFVEP
                     KRAASLFACLKSGKRVKLENIDTFVDGAAVAEIGALNYTMLKNFSPDSVITVPENRVC
                     STMVEMLNVEGVVLEPAGALSIDALNSLPPQELKGKKILLVISGGNFDFERLPDIKER
                     SLRFQGLRKYFIFSFPQHPGALRSFLAQLSPDDDIVRFEYLKKSSRSFGSVLIAIETK
                     KYDNFCLLEKKFQELGWRYRDITDDQTLFDFVI"
     tRNA            139643..139728
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="BH623125_t00060"
                     /product="tRNA-Leu"
     CDS             complement(140060..140674)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_01280"
                     /product="hypothetical protein"
                     /protein_id="GFF01694.1"
                     /transl_table=11
                     /translation="MPKLSGFIGGFYTGANLEFDNGLILGVDTDILFFGQKDTKTIVH
                     DETVESSAEEGGSEPKQVSFKLGHLSEVSKPVVRNQQEVEGNHLTFSHTLKQKWTGAT
                     RARIGFSVARMMPYISGGVAYGKFQDILSTSITGEDPFSATSDETKTMIGYTVGGGVD
                     FAMTNNFIVRAEYRYSDFGKKKFKDTIELDYKTNDFRVGIAYKF"
     CDS             complement(140696..140944)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_01290"
                     /product="hypothetical protein"
                     /protein_id="GFF01695.1"
                     /transl_table=11
                     /translation="MNTRFIIASVFAFIPVSVIQAADVIVPHQSEQVIPSVITSPPFS
                     WAGFYFGGQIGGFSSKISAMTRDVDIPLYPDESSKNKK"
     CDS             complement(141719..141991)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_01300"
                     /product="hypothetical protein"
                     /protein_id="GFF01696.1"
                     /transl_table=11
                     /translation="MLKYLHVFVAVTLLDIFIMTTFAATVKNTDLKIQSFILVEGNNL
                     SNITLNPHQTATVCMKGCFITFPNKDRFAVRAEDNIEISEGRAIFK"
     CDS             complement(141985..144348)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013531144.1"
                     /locus_tag="BH623125_01310"
                     /product="mechanosensitive ion channel protein"
                     /protein_id="GFF01697.1"
                     /transl_table=11
                     /translation="MCSFFKKKLCIFFFILGNVVGWSSCVWGHLGSQYTIIGQSVISH
                     SIDEIIQKQQQIIKILEQEIKNLQKDFANESANEYALAKVRLRARDINKRAIEAAFVL
                     RNPLNDINVLLDQLKELQDEPKNLKERSHLIKKKAQINNMVLQFEEIFLATNKIVELS
                     LSQSRELFKRTFKNRLEFSIPMLKYSVEKMKEASSDFLFLFSSWCKFVFHFKFLQLFL
                     SFLVPLFVALGLSYFSRKVLAHVNCYFTKGNEEISYLQRLLVAFISILLPLLVCVVCV
                     YLVFFLFHSFGMELGKLTTIFYTVGHQIILVFLINRLALVLLSLNMVHVRLFNITPFV
                     AHQLVILLTFLGGILAFDAVLDSIYQVVSASLSLTIAKSFIAVFLFAILLFIISFVPL
                     RFRRKSSQNEERETHFLPLYIRIPFIVLGLLLIVMDSLGYVGLAHFIMQQIVIGGAFL
                     VLMYLGIKSAQVIGTKGQFMKTSVGHALMQWFHLEEKTMNKLGIVISVVLNLIVVILC
                     AMPIAVQFGFSYSDLRRVLLQVMTGFQIGNISVSLISIVIGIIAFFACWFLNRRFICW
                     LDGMVLVHGEFDSGVRNSIKTVISYAGVVVSALIGLSMAGLDLKNFALIAGGLSLGIG
                     FGLQNIVQNFVSGLIILIGRPFKLGDYVEAGSVGGIVKRISVRATELETFQRKTIIIP
                     NSSLINNNVSNWTRGSKMGRVDIPIVVSPNVAPERVVEILLEIASTTEGVLKNPAPQV
                     SFTAFDSKKFSFSLAVYVPNITSSFKVTNALHFVLYKRFVQEGILEC"
     CDS             144972..147485
                     /codon_start=1
                     /gene="secD2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010968667.1"
                     /locus_tag="BH623125_01320"
                     /product="protein translocase subunit SecDF"
                     /protein_id="GFF01698.1"
                     /transl_table=11
                     /translation="MRTPGWLITLYCFILLSSIYVALPNLFSQEQVKNSKFLTDTRVT
                     LGLDLQGGSSLLLEVDTKTLKRDQLHMVLGNVRNILREKQIRTSSVRVLEDSVIALIS
                     DPTESEKAVSALKTLITPIHSSFGTTADDITISAQDKTIRVMLTEAGIKERISNAIEQ
                     SLEIIRRRIDQVGVTEPAIQKVGTDRIMVQLPGLQDPKQLRDLLGTTAKMTFHLVPSN
                     VDINNLPTGVSILPGYTDETQRYAIYDQIALDGNVLKDARAGFDPQMPGRSIISFTMN
                     STGSKIFADITRQNINRPFAIVLDNKVLTAPTINSVIPNGQGQITGNFDPKEASTLAA
                     LLRAGSLPAPLTVIEERTVGPNLGADAIQMGLYTGIIGFVFVTVFIFLLYGVWGIIAN
                     IALALHTILTFAALSLLGATLTLPGIAGIILGIGIAVDANILINERIREESRKGISAF
                     AALDRGFKQAFATIIDANVTAIIATILLFWFGTGPVRGFAVTMLLGIIISMFTNITIV
                     RIMMIWVVRKWKIKALHLHSVFNIIPRNTTFHFMKARFIGIGVSIVLSLASIFLFFKP
                     GLNFGIDFIGGSQMSITTKAPANLTTLRSQLSTLNIGEVTLQNMDNANTVLIRIQKQS
                     GGEIQQTTAIDKVKTTVHNIYPNATFDQIEVVGPKISGELATAAFTAVILAAIAMSLY
                     IWLRFEWFFAVGAIVTLILDTTKMIGFFALFQFDFNLTAIAALLTIVGYSINDKVVVY
                     DRMRENMRLYKKMSLRELIDLSINQVLIRCLFTSATTVLAMLPMALWGGSAVYNFAFP
                     MVFGIIIATSSSIFIAAPILLLLGNWWRKRNNHTNTTLQ"
     CDS             147590..149323
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013529559.1"
                     /locus_tag="BH623125_01330"
                     /product="sodium:proton antiporter"
                     /protein_id="GFF01699.1"
                     /transl_table=11
                     /translation="MLHDTPLITTIVAGLCLAFLLGMIASRLRISPLVGYLLAGVIVG
                     PNTGGFRIDSGIINQLAEIGVILLMFGVGLHFSLKDLLSVKAIAIPAAIAQMAFSTFL
                     GSCLGLIMGWGLSSSVVFGLALSTASTVILLRALQERHLIETEKGRIAVGWLIIEDLA
                     MVLILVLIPSLANILGNTKKEAIDPLIQWLDLSIWGIFGLTILKVILFIILMLVIGRR
                     VIPWLLKVSAHSGSRELFRLSVFATALGVAFGAAHLFGVSLSLGAFFAGMVMSESELS
                     HRAAEESLPLRDAFSVLFFVSVGMLFDPGKILSHFFPLLATLFIIIIGKSAVAFFILK
                     AFRYSNATACTISASLAQIGEFSFILAGLSLSLGLLNNDAHDFILGGAILSILVNPLI
                     FIAFDKIKKHLENLPKNSQDTQKIIDIDPKDPDQEFLPMTSKTNHIVIIGYSRIGKCV
                     ALSLINRGDPVVIVEESKRLTDKAIADGFEVICGNIIKQDVMNAANMSNAYKVVITMC
                     NTIEVGECIVNIRDMNKDIQIITHTLSDVDTAYLIDLGADIVVTDEEEIANGVIEHIT
                     GQRFIKNIAQS"
     CDS             149370..150323
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011388243.1"
                     /locus_tag="BH623125_01340"
                     /product="membrane protein"
                     /protein_id="GFF01700.1"
                     /transl_table=11
                     /translation="MKMKQLIWPFIGILAMLISIRILYIKLSAISFSDVLERLSNLSV
                     QHWLLACLCSLLAYAALAGYDRIALQHLGHKISWFFIALCSFTTYALSHNIGASVFSG
                     AVVRYRAYKMKGLSGTEIAILVGFCSFTFVIGTVLLFGIVLILQPEIITLIYNDLPEW
                     LGTAVGVILLGCTALYIFGSWLQLKPLRLGKKIQLSYPKLKIVIQQLLIGPLELLGAA
                     GIIYAVLPHNTDVHFISVLGVFLASFTITLLSNAPAGGVGVLEALFITGMSSINPTDV
                     VAALIVFRMLYLIIPLIISLFVVAIFETQQYCKKTRKTPPK"
     CDS             complement(151005..152573)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011390497.1"
                     /locus_tag="BH623125_01350"
                     /product="hypothetical protein"
                     /protein_id="GFF01701.1"
                     /transl_table=11
                     /translation="MMEWIADPHAWFGLVTLIFLEIVLGIDNLVFIAILAEKLPLHLR
                     DRARLIGLTLALVMRFFLLTVIGWVMNLDTMIFAFSSFVFSWHSLILIGGGAFLLAKG
                     TLELHERLEGAVHERKTDVAYVVFWQVIVQIVVLDALFSLDSIITATGMIAKEQAAVM
                     YIAVMVAMSVMMWGSGALMRFINRHPTIVILCLGFLMMIGFALIVEGFGFHIPKGYLY
                     AAIGFSVLIEVFNQIGRRNREKMITTNDLRGRTADAVLRLLGGGNKDGNLSETVDVIA
                     EQAAASELFRPEEKEMIRGVLDLADRPVRSIMSPRNEIEWLDLNGDESEMREELQKVK
                     HSRLILAREKVDEFVGVALTKDLLLNLAEGKKINWKKAMREPLVVHENTSVLRLMEQL
                     RHSSIQLAIIVDEHGSFEGIATPTDILEAIAGDFPDDDEELMIAEKLEDGSLLVEGYA
                     DIRRLSGYLERNFVDEADRYTTLAGFMLWRFGHLPNEGESFEADGLRFKVIEMDRRNI
                     SKILISPLVLQEKS"
     tRNA            153049..153124
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="BH623125_t00070"
                     /product="tRNA-Lys"
     CDS             complement(153657..153836)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_01360"
                     /product="hypothetical protein"
                     /protein_id="GFF01702.1"
                     /transl_table=11
                     /translation="MHKGSEKDYQFFNPKVVKKNLFQMIILFGRILRELRIDHREGLL
                     DRVEEKVVSVAFSFL"
     CDS             154515..155915
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_000228366.1"
                     /locus_tag="BH623125_01370"
                     /product="D-serine/D-alanine/glycine transporter"
                     /protein_id="GFF01703.1"
                     /transl_table=11
                     /translation="MDYKQNSENNPKKKLQRGLHNRHVQLIALGGAIGTGLFMGSGKT
                     ISVAGPSIILVYAIIGCALYFVMRAMGELLLSNSRYRSLIDFSTDMLGPGIAFFVGWS
                     YWLSWVVTGAADIIAIITYMHFWWPTLNSWIIVFSCVIFFLTLNLLAVKMFGELEFWF
                     GLIKVLAILALIVVGFYMICTGFTSPNGTVASLSHVWNDGNIFPRGIPGFFAGFQIAI
                     FSFVGIEIAGTTAAEVKEPKKVLPKAINAIPLRIVLFYIFSLVVIMSVTPWDQVVPEK
                     SPFVSMFWLAGIPIAAGLINFVVLTSAASSANSGIFSTSRMIYGLATQKGAPRFFGKL
                     SKYHVPANALFFSCLCILLGYTIASSSPSIISAFTIVSSISAIAFLFVWSVILVSYIV
                     YRHNHPHLHTESVYKMPGGVITCGIILAFFAFMLYLLTLESDTLTALKYSIFWFIFLG
                     ITYFMFIRKKTAQDNK"
     CDS             complement(156011..157030)
                     /codon_start=1
                     /gene="ilvC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q52955"
                     /locus_tag="BH623125_01380"
                     /product="ketol-acid reductoisomerase (NADP(+))"
                     /protein_id="GFF01704.1"
                     /transl_table=11
                     /translation="MRVYYDRDANVNLIKEKKVAIVGYGSQGRAHALNLRDFGVKNVK
                     IALRSESATVKKAVADGFEVVCVAEAAKWADLIMMATPDELQADIYKEHIHDHLRDGA
                     VIAFAHGLSIHFGLIEPKKTVDVVMIAPKGPGHTVRNEYQNGCGVPCLIAVAQDASGH
                     AHNVALSYACGLGGGRAGVIETTFKEECETDLFGEQAVLCGGLVELIRAGYETLTEAG
                     YAPEMAYFECLHEVKLIVDLMYEGGIANMNYSISNTAEWGEYMSGPRVITDETRAEMK
                     RILKDIQTGKFTSNWIQEYKAGAAHFKGMRRLNDSHPIEEVGKKLRSMMPWIKANALV
                     DKERN"
     CDS             complement(158647..159381)
                     /codon_start=1
                     /gene="pdxJ"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q92NT6"
                     /locus_tag="BH623125_01390"
                     /product="pyridoxine 5'-phosphate synthase"
                     /protein_id="GFF01705.1"
                     /transl_table=11
                     /translation="MAVKLSVNLNAVAVLRNRRNLPWPNIKSIGHIALTAGAAGLTVH
                     PRPDERHIRFADLPDIRCLINSAFPTAEFNIEGYPSDRFLDLAEKYADQITLVPDDPA
                     QSTSDHGWDFAHNAEFLAPIIQRLKEKKIRVSLFANPLVDGLDIAKTIGADRVEFYTG
                     PYGGAFKDKTKQDQELKKLILAARKAKELQLGVNAGHDLTITNLPALVNHISWLDEVS
                     IGHGLIADALEYGMYETVQRFIRLLS"
     CDS             complement(159466..160587)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013531055.1"
                     /locus_tag="BH623125_01400"
                     /product="ATP-binding protein"
                     /protein_id="GFF01706.1"
                     /transl_table=11
                     /translation="MQFSPEQDNALKAVSAWLKEGRSPLFRLFGYAGTGKTTLARYFA
                     ETVDGSVQFTAFTGKAAQVLRSKGASNACTIHSLIYCPRGEEEVSDEVTGKKSIAPTF
                     ALNRRSAAAQAKLIIVDECSMVDEQLARDLMSFRTPILVLGDPGQLPPISGGGFFSNG
                     VPDFLLSEIHRQARDNPIVRLAMDVREGRDIPYGNYGAARVVTRKEVHQQLVLDADQL
                     LVGINRTRYLYNKRLRVLKGFTAAYPQAGDKLVCLRNDPAKGLLNGSLWKVMTSQKET
                     VKPGVNLLVKPEESERGVVKIKLLKALFENPDSDISWQLKKRYDDFDYGYALTVHKAQ
                     GSQWNNVVLFDESFAFRDMSARWLYTGITRAAERLTIVR"
     CDS             complement(160997..162796)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A6UB11"
                     /locus_tag="BH623125_01410"
                     /product="acetolactate synthase"
                     /protein_id="GFF01707.1"
                     /transl_table=11
                     /translation="MTNHPRMQESANGKKMLGAEMVVQALIDQGVKHLFGYPGGAVLP
                     IFDVLYQQDSLQHILVRHEQAAGHAAEGYARSTGKVGVMLVTSGPGATNAVTPLQDAL
                     MDSIPLVCFSGQVSTTVIGTNGFQEADTVGITKSCTKQNWLVKDVNDLAAIIHEAFAV
                     AQSGRPGPVLVDIPKDIQLASGVYRAPQVLVSRHFSPQLKRNIEAIECAVSLLEEAKR
                     PVIYSGGGVISSGLQAVQLLRDLVQLGDFPITSTLMGLGAYPASGKNWLGMLGMHGTY
                     EANMAMHDCDVMLAVGARFDDRITGRLDAFAPHARIIHIDVDPSSINKIVKVEVPIIG
                     DVADVLGDMMQCLHRQQPIFKSEGRDAWWKQIDCWRARNSLAYPKKKDIIMPQYALER
                     LYALTKDVNAYITTDVGQHQMWAAQYYHFDEPNHWMTSGGLGTMGYGLPAAIGVQIAH
                     PDAFVVCISGDASIQMNIQELATAMQYNTPVKIFILNNQYMGMVRQWQQLLHGNRLSH
                     SYTESMPDFVKLAQAYGGIGIHCSKPDELDDKIQQMIDCDKPVLFDCRVDNLENCFPM
                     IPSGCAHNDMLLPDEAHDEAVANAISAEGQCLV"
     CDS             complement(163068..163940)
                     /codon_start=1
                     /gene="miaA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TG83"
                     /locus_tag="BH623125_01420"
                     /product="tRNA dimethylallyltransferase"
                     /protein_id="GFF01708.1"
                     /transl_table=11
                     /translation="MKGRTITLIAGPTASGKSALALQIAQEKNALIINTDSMQVYDVL
                     NILTARPTRTDTATVPHYLYGYVNPALHYSVGQWLCDVSKLLMTFTSKSLIFVGGTGL
                     YFRALLEGISKIPDIPDVVRQKWRLRLDKEGAENLYRQLWQVDAVLAEKISSQDGQRI
                     VRALEVYDATDKKLSWWQKKKTTPLIARNCSEKLLLIPPRQLLYERIHKRLDSMIEKG
                     ALEEVIAMKKLALSPLLPAMKAIGIPEFIAYLDGKQSFEEALEMVKTQTRRYAKRQIT
                     WFRNQFDEEWMLLS"
     CDS             complement(164581..166008)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013531033.1"
                     /locus_tag="BH623125_01430"
                     /product="serine protease"
                     /protein_id="GFF01709.1"
                     /transl_table=11
                     /translation="MNSSWAVETKNRSLSVPDLAAQLLETVVNISTAQTVDGTEQDEH
                     TSVPVIPEDSLLQEYFTDFFSPKDGQKESQFQKVRSLGSGFVIDAQKGLIVTNYHVIV
                     DADDIEVNFTDGTKLKAKLLGKDSKTDLALLQVDAGSKKLKAVRFGDSEKARIGDWVM
                     AIGNPYGFGGSVTVGIISARNRDLNAGPYDNFIQTDAAINRGNSGGPLFDRNGEVIGI
                     NTAIVSPSGGSIGIGFAIPSDMALSVINQLRDFGEIRRGWLAIRIQPVTEDIAKSLKL
                     ESPVGALVAGKMEQTDVDNSQLQIGDIILSFGNAKIKHARDLPRLVAESLEGKVVDIT
                     VLRNGQEKTVKVKLGRLIETDTNENMVEESDNERSGPISKSGTMQFMGMTLSELTADL
                     RQHYSITDKLQGLVVISVAKNSAADKKRIRTGEVIVDINQSTVTTIGEAKKRIHKLRE
                     AGRKNALFIIARPDGELRFVTIPMD"
     CDS             complement(166249..167199)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TG78"
                     /locus_tag="BH623125_01440"
                     /product="protein HflC"
                     /protein_id="GFF01710.1"
                     /transl_table=11
                     /translation="MMQQSRFLFMLSAIVLIFMVLWMSVFIVYPRQQVAIKRFGQIVK
                     VESDPGIYLKVPFVDKRIVVDNRLLRYDVPTQSVQVRGGAYYEVDAFFIYRITDPKLF
                     LQRIASGRPQIAARENLAPRFIDALRAVYGKREFKAALSDERGAMMAEVQRQFSVDAG
                     SLGITIVDVRIRKTDLTDAVSEDVYRQMAAEREAVAENIRARGQQERDRIVAEANREY
                     EEIVAAAKRDAEITRGEGQAESIRLLLKAREANPSFYDFWLAMEQYKNLEHTPMVISP
                     NEDFFFYFRNLLQAREKLSSTMNTNGNTGLNKTVSKFGGE"
     CDS             complement(167199..168344)
                     /codon_start=1
                     /gene="hflK"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_006311785.1"
                     /locus_tag="BH623125_01450"
                     /product="HflK protein"
                     /protein_id="GFF01711.1"
                     /transl_table=11
                     /translation="MPWTNQNGGGPWSGDKNKLSGDKKTPSKNLFGSGGNNGGDNSPN
                     IDDILRKGQDQFKQFGKNGLFVLLFLFAVLFWLYQSLYIVQQNEQAVELRFGVPKTET
                     IGDGLHFHFWPIETYMKVPLTEKTIAIGGQPGQRQQSEGLMLSSDQNIVNVNFSIYYR
                     ISHPGQFLFNVNDQEGTVRQVAESAMREVIGSRPVDDVLRDKKEEVASDVRKIIQLTV
                     DKYQLGVEISRVSISEAAPPTKVAAAFNSVQQAEQERGRMIEEGNRVRFNKIGLANGE
                     ASRTREIAKGEKARMVEEATGRAERFQAIARESAISPEAVRYRLYMETMGRIFSSPNK
                     LILDQTNSPAVPYLPLNELLRSNSSEKVKTRSAHSASLLDNHISGGR"
     CDS             complement(168462..168971)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TG76"
                     /locus_tag="BH623125_01460"
                     /product="dihydrofolate reductase"
                     /protein_id="GFF01712.1"
                     /transl_table=11
                     /translation="MTFPICLIAAVAKNGVIGREGAMPWHLSTDLQRFKALTFGSPVI
                     MGRKTWDSLRAPLPGRTNIVITRNCAFKAESAVITHSLSHACSIAKKVASQNGADAIF
                     IIGGGEIFQQCFDIADKIFLTEVLDSIEGDSFFPVFDKEKWTIVQTQYIPEGDKDSHP
                     TRFVVYERK"
     CDS             complement(168968..169762)
                     /codon_start=1
                     /gene="thyA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q92NQ5"
                     /locus_tag="BH623125_01470"
                     /product="thymidylate synthase"
                     /protein_id="GFF01713.1"
                     /transl_table=11
                     /translation="MKTYLDLLSHVLNKGIDRTDRTGVGTRSVFGYQMRFDLQAGFPL
                     LTTKKLHLRSIIYELLWFLRGDTNIAWLKEHGVSIWDEWADEKGNLGPIYGYQWRSWP
                     APDGRHIDQISNLLMMIKKTPDSRRLIVSAWNPASIKEMALPPCHCFFQFYVADGKLS
                     CQLYQRSADIFLGIPFNIASYALLTMMIAQVSGLKVGDFIHTLGDAHLYSNHFEQAQH
                     QLSRIPNALPFMRINPAVTDLFSFKFEDFELLNYDAQPHIKAPIAV"
     CDS             169988..171295
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004526907.1"
                     /locus_tag="BH623125_01480"
                     /product="ABC transporter permease"
                     /protein_id="GFF01714.1"
                     /transl_table=11
                     /translation="MENEKTLTPNDTRKRVLSIVSSASGNLVEWYDFYVYSFTSIYFA
                     SQFFPSDGDVVTELLKSSVVFFIGFLMRPIGGWLFGFIADRYGRKRSLLISVFMMCGG
                     SFLIALLPTYETIGATAAVLLILLRMLQGLSVGGEYGTTATYMSEVALKNRRGFFSSF
                     QYATLIGGQLLASLVMFTLALYLTEDQLKAWGWRIPFAIGGLGAIVAIYLRRSLHETT
                     TEESRSKKQAGSLKELLCNHRKAFFLVIGFTAGGSLIFYTCTTYMQKYLITTTGFEKH
                     TATTIMTAALFIFMLLQPIFGSLADKIGTKASLLIWSVLSIIFVIPALKIIGNTNDTW
                     VALFVMIGMFCIMSFYTSVSGIVKAEMFPASVRAMGVGLSYAIANAIFGGSAETVALE
                     FKKIGYESVFHFYITGMMIIAFIAIVFMPDARKKGYLQGDNIN"
     CDS             172285..173592
                     /codon_start=1
                     /gene="pcaT_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003101889.1"
                     /locus_tag="BH623125_01490"
                     /product="dicarboxylic acid transporter PcaT"
                     /protein_id="GFF01715.1"
                     /transl_table=11
                     /translation="MTNETSLAPHDTKKRILAIISSASGNLVEWYDFYVYSFASIYFA
                     SQFFPADEDVITQLLKTAGIFFIGFLMRPIGAWLFGFIADNYGRKRSMLISIFMMCSG
                     SFLIAILPTYETLGITAAFLLLVVRIFQGLSVGGEYGTVATYMSEVSLKKHQGLFASF
                     QYATLITGQLLASFIIFILALYLTEDQLKSWGWRIPFLIGGLGAMIAIYLRSLLHETT
                     TEESRSEQNTGSLKELFTKHRKAFFLVVGFTAGGSLTFYTYTTYMQKYLIMTTGFDKH
                     TATTIMTAALFIFMLLQPLFGILADKIGKKASLIIWSTLSIFCTIPGLKMIENANNVW
                     VALLIVIGMLCIMSFYTSIAGIIKAELFPTSIRAIGVGFSYAIGNALFGGSAEYVALG
                     LKNMGHETIFSFYIIGMMVIALISILLMPNIDKGGYLQDNEVY"
     CDS             174137..175444
                     /codon_start=1
                     /gene="pcaT_2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003101889.1"
                     /locus_tag="BH623125_01500"
                     /product="dicarboxylic acid transporter PcaT"
                     /protein_id="GFF01716.1"
                     /transl_table=11
                     /translation="MTSETTLATDDRKKRVFAIISSASGNLVEWYDFYIYSFTSIYFA
                     SQFFPSGGNVVTQLLKSAGVFFIGFLMRPIGAWLFGFIADRYGRKRSMLISIFMMCGG
                     SFLIAILPTYETIGITAAILLLLIRMMQGLSAGGEYGTAATYMSEVALKKHRGFFASF
                     QSGTLITGQLLASFIIFILALYLNEDQLKAWGWRIPFVIGGCGAVVAIYLRRSLHETT
                     TKESRSERSTGSLKELFTKHSKAFIVIALFASGGSLTFYTCTTYMQKYLITTTGFDKH
                     TATTIMTVALFIFILFQPLAGTLADKIGTKTLLIIWSVLSALFTFPGLSIIGNTNSPW
                     VALSVIIGMLCIMSMYTSISGVVKSAMFPASVRALGVSLSHAIGNALFGGSAEYVALG
                     LKNMGHESLFYFYITGVMIIAFIALLFVPNMNKGGYLQNDKTP"
     CDS             complement(175522..175827)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011976156.1"
                     /locus_tag="BH623125_01510"
                     /product="hypothetical protein"
                     /protein_id="GFF01717.1"
                     /transl_table=11
                     /translation="MTNDLADIKLYDQNPDEAAIERLHHRLALVMKNQDASLVATSDP
                     KELERVEKWVQDVLGADEQSAKRGVSKVADMMSGDRRKSRMTFYYLVAKQLNALHKI"
     tmRNA           175946..176283
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="BH623125_tm00010"
                     /product="transfer-messenger RNA"
     CDS             176449..176994
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013531016.1"
                     /locus_tag="BH623125_01520"
                     /product="hypothetical protein"
                     /protein_id="GFF01718.1"
                     /transl_table=11
                     /translation="MVQDQIRYDILVQDALRGVIRKVLSEVAKAGLPGSHHFFITFLT
                     NAPGVKISTRLKSRYPEQMTIVLQHQFRDLNVSETAFEVTLSFREVSEKLVIPFHSIQ
                     VFYDPVAAFEAAFDLPSNLNSKEGENLENIASTPVILSDTQKKEKKFPKEQISKTNKD
                     SSNNDTKQSADVVSLDSFRKK"
     CDS             177007..177195
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_01530"
                     /product="hypothetical protein"
                     /protein_id="GFF01719.1"
                     /transl_table=11
                     /translation="MTKPINLRQFRKQKKRAEQAIHAEENRYRFGRTKAEKIFEQKES
                     LKTQKFLDQNRLWPSKEK"
     CDS             177202..177453
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_01540"
                     /product="hypothetical protein"
                     /protein_id="GFF01720.1"
                     /transl_table=11
                     /translation="MDVSDSIDWSKMTLQKISVRIEGHATSVSLEQPFLDILKTIARK
                     KGQSLAFIITDIDSKRPQQVNLSSSLRIYALQSVLIQRL"
     CDS             177574..179910
                     /codon_start=1
                     /gene="pcrA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q7CXZ3"
                     /locus_tag="BH623125_01550"
                     /product="DNA helicase"
                     /protein_id="GFF01721.1"
                     /transl_table=11
                     /translation="MNNFSNHIPFFEDDSPPHKHENNSGLTNQNVTVKEKTQYSADYL
                     EKLNPEQQQAVMNTEGPLLVLAGAGTGKTRVLTTRISHILHSGLASPQQILAVTFTNK
                     AAREMKMRIGELIGEIVEGMPWLGTFHSIGAKILRRHAELVNLKSNFTILDSDDVTRL
                     LKQLIQAEGLDDKRWPARNLAIMIDSWKNQGLSPEHISESDAHSFGNGMGRELYHNYQ
                     HRLKSLNACDFGDLLLHSISIFQHNPDILRDYHSKFRYILVDEYQDTNTAQYLWLRLL
                     AQQPKGQHINLCCVGDDDQSIYGWRGAQVDNILRFEKDFPPAKIIRLERNYRSTSHIL
                     KTASHLISHNQGRLGKTLFSDQVNTEEEKVKIHAAWDSEEEARAIGEEIERAQQADHS
                     LNHIAILVRASFQMREFEDRFVTLGLNYRVIGGPRFYERMEIRDAMAYLRVVVQPADD
                     LAFERIINTPKRGLGDATLRILYESARTRAIPLFFAAAEIIETDELKPKARSALRSVV
                     ENFRRWQNMLQNTPHRELAEIILDDSGYTSMWLEDRSPEAPTRLENLKEMVRSMEQFE
                     SLPSFLEHVALVMDAENDENTDAVNIMTLHSAKGLEFETVFLPGWEEGLFPHQRSLDE
                     GGRSGLEEERRLAYVGLTRAKKHLHIWFVSNRRIHGFWQSTLPSRFLNELPEEHIEVV
                     EMETSYGGYGKSRFKHHNPFYHEYSTSKQKRVQKNIEGKVIARSISETPSDFSINDRI
                     FHIKFGYGHISAIDGHKLTIVFEKAGEKRVLDNFVSKA"
     CDS             complement(179972..180601)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013530975.1"
                     /locus_tag="BH623125_01560"
                     /product="antibiotic acetyltransferase"
                     /protein_id="GFF01722.1"
                     /transl_table=11
                     /translation="MNTKKDLRFRESQPRINTTARLHGCKLGRYVEINERVVLRDVTV
                     GDFSYFEHNSEAIYSDIGRFCSIASHVCVNALEHPMERLSTHKITYRPNEYFRYMSLD
                     RSFRERRCEKRVTVGHDVWIGHGAVIMPGVAIGHGAIIGTNAVITKDILPYTIVAGVP
                     AKPLRMRFPDNVIQTLLEMAWWNWPLDKIYNALSDMQNLPIEVFIHKWK"
     CDS             180739..181320
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013530973.1"
                     /locus_tag="BH623125_01570"
                     /product="electron transporter SCO1/SenC"
                     /protein_id="GFF01723.1"
                     /transl_table=11
                     /translation="MKNVIRILGLTIIFLAGIFIYDTFKNKPLGDNFTLTDSNGNTIT
                     EADIRSKPSIIFFGFTMCPESCPTTLTNLDRWLTSLGADADKLGVWFVTVDPERDTPE
                     VLHDYLSNFNHKIVGISGEPEKVHKMVDSFNIVAEKVPGTDGNYTYNHTAAIFLLKKG
                     GKLAGVIPYKIEKNNEELRDNIAIEKLKQLVLN"
     CDS             181353..182222
                     /codon_start=1
                     /gene="prmA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TF69"
                     /locus_tag="BH623125_01580"
                     /product="ribosomal protein L11 methyltransferase"
                     /protein_id="GFF01724.1"
                     /transl_table=11
                     /translation="MSQQIRLYCTASKNEAEEWYILMETAFEEEGYPLALVEIDEKNA
                     IYELSLYINKENQENASKRFAHILSIDPDKINNEILPNIDWVQKSLEELKPVHAGPFF
                     LHGSHHRNDIPPDVLPIEIEANQAFGTGHHETTAGCLKIIAKILQNENPQNALDLGTG
                     SGILAIGIAMLKPISVLASDIDPVAIQVAQHNIQLNGVKKYITTVTATGFNHDEIASR
                     APFDLIVANILANPLIELAQEMVKALQKGGSLILSGILKEQHDHVLEAYVKQGLKHIE
                     TYHCQGWVTIHLK"
     CDS             182240..184066
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012708616.1"
                     /locus_tag="BH623125_01590"
                     /product="Xaa-Pro aminopeptidase"
                     /protein_id="GFF01725.1"
                     /transl_table=11
                     /translation="MYQSFEAITNPAYAAERISSLRQELNRLELDGFLVPRSDEHQGE
                     YVPPHAQRLSWLTGFTGSSGIALILKNKAILFTDGRYKLQVRQQTDPHIFEYEDLVIC
                     PPSQWLEKNGQKLSIGFDPWLHTIAATDTLRKALELKSSGKLVAVQSNPIDFIWHDQP
                     HPPQSALSIHPLKYAGCKTDEKLTLIRKNIQQADADAFIFTDPSSIAWTFNIRGNDVS
                     NTPFSLCFAFIPIKESPILFINSKKLGIEQKQYLERYAKLYEPEQLIPMLKDYVKKGM
                     IFALDPRITCEKIHIIIEEQGGSFTTLTDPAALPRAIKNSTELNGTRQAHLRDGVALT
                     RFFSWLDKQTPGSIHEISAAQKLEEFRINTAKEMGEKLEDLSFDTISAAGANGAIVHY
                     RVTNETNKQLNAGELYLVDSGGQYRDGTTDVTRTVAIGNVGEEEKRCFTLVLKGMIAL
                     STAHFPKGTRGQDIDVLARIALWKAGFDYAHGTGHGVGSYLSVHEGPQNLSRNGCQEL
                     IPGMIVSNEPGYYREGAFGIRIENLLIVKPAQKINGGDREMLSFETLTNCPIDRRLIL
                     PELLTEQEQQWLNDYHTHVYQVNAPYLSEEDKRWAKEATLPL"
     CDS             complement(185999..188149)
                     /codon_start=1
                     /gene="ligA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:C3MEL9"
                     /locus_tag="BH623125_01600"
                     /product="DNA ligase"
                     /protein_id="GFF01726.1"
                     /transl_table=11
                     /translation="MHKDEIQNLTALEAASELEWLAKEITRHDVLYNRNDQPEISDAE
                     YDALRRRNAEIEALFPELIRPDSPSHKIGAPISEKFEKSVHSQPMLSLDNAFSSEDVS
                     EFMERVRRFLRLPETQMLEITAEPKIDGLSLSLRYEQGRLVCAATRGDGYVGENVTAN
                     ARTISDIPQVLQGKFPDIIEVRGEVYMRRADFQALNVNQQEKGKLAFANPRNAAAGSL
                     RQLDSRITASRKLQFFAYACGEVSEIFAESQMGMMEKLKEYGFVINPLIKKIKSLEEL
                     ISYYHDIEERRHALSYDIDGIVYKVNDLMLQMRLGFVSRSPRWAIAHKFPAEKAMTVL
                     EGIDIQVGRTGALTPVARLAPITVGGVVITNASLHNEDYIKGIGSKGEPIREGNDIRV
                     GDTVIVQRAGDVIPQIIDIVAEKRSKDASAFVFPYLCPACGSYAVREIGEAVRRCTGG
                     LICPAQAIERIRHFVSRNAFDIEGLGKKQVEFFFQIQDETLCIHTPADIFTLQRRQEK
                     SLVHLENMEGFGTVSVRKLYDAINARRKIPLSRFLFALGIRYVGEVNARRLARAYQNY
                     TAFETAAMAATMPDDKVGKEGNEAWMELTNIEGIGPQVGEAIIDFYKEVHNREVLSGL
                     LCEVTPLDEESVMTASSPIAGKIIVFTGTLTRMSRDEAKALAERLGAKTSGSLSKKTN
                     LLVAGVGGGSKLTKAQELGVEVIDEEAWLQLIEG"
     CDS             complement(188281..189942)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TF63"
                     /locus_tag="BH623125_01610"
                     /product="DNA repair protein RecN"
                     /protein_id="GFF01727.1"
                     /transl_table=11
                     /translation="MLIQLSIHNIVLIETLDIHFRAGLSVLTGETGAGKSILLDALSL
                     ALGGRGDASLVRHGVDRGQVTAVFDVPVSHSVRQLIRENGFDDEGDIILRRVQLSDGR
                     SRVFINDQVASVALMRHVGRQLVEIHGQHDNRALVDVDTHRQLLDAFGGLEDETENLR
                     QCYRIWREFEKRLQQQRLKVENALREADYLRACVQELEKLDFQVGEEDALSLRRADML
                     KLEKIATDIKEADDLLTGPKSPIPVLSNLVRRLERKIPEAQELIAPVVNSIDEALHAL
                     ATAQEGIEAAMRALDFEPGELEQIEERLFALRGFARKYQVSADELIQLRDKMDAELAD
                     FEQDQNTLVHLEDEVEQAQKNYDTLAQALSIKRREVAKHLSESVMAELPALKLEKAEF
                     IVEMQSDVERRSAEGIDRVEYWVRTNPGTRAGPMLSVASGGELSRFLLALKVVLSDRG
                     SAPTLIFDEIDTGVGGAVAAAIGQRLRRLSENIQVFAITHAPQVASKAHSHFLISKEE
                     SDDKGRFVTAVHKMEERERAEEIARMLAGEQITKEARAAAQKLLA"
     CDS             complement(189949..190842)
                     /codon_start=1
                     /gene="bamD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TF62"
                     /locus_tag="BH623125_01620"
                     /product="outer membrane protein assembly factor BamD"
                     /protein_id="GFF01728.1"
                     /transl_table=11
                     /translation="MIKSHVSIKNVAYRKSNILRKVLGMIFLGSTCILAGCLFKEKNT
                     LDPSAYVLKIDPPDVLYNQALASLESGRLADASKKFLIIEKQYAYTDWGRKSLVMGAF
                     TNYRLEKYDDSISMAQRYITLYPEADDAAYAYYIIGLSSFRRIPDVTRDQRDTKRAIA
                     AMQLLIERYPNSEYVKDAKAKIRFGREQLAGKEMQVGRYYEEGRRYLAASRRFRKVVE
                     EYSDTNQIEEALFRLTEVNLALGLTLEAQTAAAILGRNYPKSEWYKFSYNLLQKNSIS
                     PREHKSSWISQALGGDKSKAR"
     CDS             complement(191014..191889)
                     /codon_start=1
                     /gene="lpxC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:C3MEM2"
                     /locus_tag="BH623125_01630"
                     /product="UDP-3-O-acyl-N-acetylglucosamine deacetylase"
                     /protein_id="GFF01729.1"
                     /transl_table=11
                     /translation="MIKLVQKYQSTLKKVVTFKGIGVHSGCLSVVKVCPADVGCGIVF
                     KRFAVDGTEQIFQAHASQTGATELSTALGHGGFRVETIEHLMAAIAAYNLDNLIIEVS
                     SHEIPILDGSSWQYCQAFDEVGVIRQNVLRSYFVIKKPLRVESTNGVAEFLPFDGRRF
                     DITISFPSSAIGKQHLTFDLTPQSFRDDLSRARTFGFVKDVEKLWVSGKGIGASLENS
                     LIIGLNDKIINPDGPYWKNEYVRHKTLDAIGDTALLGAPFIGLFRSYCSGHRMNSQLV
                     KAVLADESCYEKSHL"
     CDS             complement(192095..193840)
                     /codon_start=1
                     /gene="ftsZ2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A9CIB1"
                     /locus_tag="BH623125_01640"
                     /product="cell division protein FtsZ"
                     /protein_id="GFF01730.1"
                     /transl_table=11
                     /translation="MTINLHRPDIAELKPRITVFGVGGGGGNAVNNMINAGLQGVDFV
                     VANTDAQALAMSKAERVIQLGAAVTEGLGAGALPEVGQAAAEECIDEIIDHLADSHMI
                     FITAGMGGGTGTGAAPVVARAAREKGILTVGVVTKPFQFEGARRMKTAEAGIEELQKS
                     VDTLIVIPNQNLFRIADEKTTFADAFAMADQVLYSGVASITDLMIKEGLINLDFADVR
                     SVMHEMGRAMMGTGEASGEGRALAAAEAAIANPLLDDTSMRGARGLLISITGGRDMTL
                     FEVDEAANRIREEVDADANVIFGAIDDESLEGVIRVSVVATGIDREVSDLVQPSHPQL
                     QRHATSIRKNDPGMPQSSFHVQSPPLRSESMVEVIEALEIEKGKTVGEQFRPKSQIFA
                     QPADTVAARNAAAAYGSSAHGQISNAPRVQVSRSSQSSMVAPVSMEATAHVLDEMTGV
                     VQQKENQVKQIQARSPMRMPELKDFPPVAHGQGERSSADQGPRNLWQRLKQSLTHREE
                     AEPEAKLEPAVRSSQQQEVRVHNKNSRALVQDASVYVPRRAGELHPHVSQDQRNFVSE
                     EDQLEIPAFLRRQAN"
     CDS             complement(193910..195211)
                     /codon_start=1
                     /gene="ftsA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TF59"
                     /locus_tag="BH623125_01650"
                     /product="cell division protein FtsA"
                     /protein_id="GFF01731.1"
                     /transl_table=11
                     /translation="MMLLKSHHSGGRKTRFLTVLDVGSSKIVCLIACLRPLKHAHYLH
                     GRTHSMEILGFGVQRSRGIKSGVVMDIFAAEQSIRLAVDAAEKMAGLVVDSVIVNFSS
                     SRLQSALINGVVSLNGREVTKRDIRVAFADVSRKAFNAERHVVHSVPVSYVLDGDKGI
                     SDPVGMIGDFFGVDVHVVTAETAALRNLETCINRAHLSVEAMVVTPFASGLAVLMNDE
                     AHLGAACIDFGGGTTTFSVFSEGKFVHANALAVGGHHVTLDVARGFSMSLPEAERLKV
                     VYGSALVTSADERHMVNVTEIGNEHREIQYPRAVLGRIIRARVEEILEMVRDCLNRSG
                     FGHIIGKRVILTGGASQLTGLPEMARTILGRNVRIGRPLGISRLPSLAKGAAFTSAVG
                     LLIYPQLVGFEEKTMQVAVNHLSTGTRGYFQRVGQWLRESF"
     CDS             complement(195208..196119)
                     /codon_start=1
                     /gene="ftsQ"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A9CIB0"
                     /locus_tag="BH623125_01660"
                     /product="cell division protein FtsQ"
                     /protein_id="GFF01732.1"
                     /transl_table=11
                     /translation="MYALNVDKTNIPMVVLSVPVLPRLYRRFLRFMFEFVFVRIHVPR
                     HFGSFAVLFFFSLTLLYGFSLSGRVEMIVKTALSDIGFVVTDVDMSGNKRVVKQEILK
                     ILGLDTAPSIFTFNVDRARSLLEQKAWIQSANVQKIYPNRVRISVVERKPYAIWQHDG
                     MMDIVDSTGRVIAPFQTGIVQNLPLVVGQGAQNAAKGFLQALSVYPKVYDHVRAYVRV
                     GDRRWDLILDNGVRVLLPENGAFERLDSLIESATVQNLFSRDVLRVDLRLPDRITVAL
                     SDEVLERHRAFVAEEQRVLKARKAGKL"
     CDS             complement(196107..197027)
                     /codon_start=1
                     /gene="ddl"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TF57"
                     /locus_tag="BH623125_01670"
                     /product="D-alanine--D-alanine ligase"
                     /protein_id="GFF01733.1"
                     /transl_table=11
                     /translation="MKDEHIAVLMGGFSSERSVSLSSGTACADVLEAQGYRVSRVDVD
                     GHIASVLEQLQPDIAFNALHGPFGEDGRIQGVLEYLKIPYTHSGVMASALAMDKGRAK
                     IVVASVGVSIAPSCVMSRFAVGKEHPMEPPYVIKPVCEGSSLGVIIVKENESVPSLNV
                     VGSEWVYADTVIVEKYIPGRELTCAVMGNKALDVCEILPEKHFQFYDYDSKYKSGGSL
                     HVCPAQLSSNIYQNVQRMSLAAHQAIGCRGVSRSDFRFDEETGELVWLEINTQPGMTP
                     TSLFPDIAKASGRTYGDIVQWMVEDASCMR"
     CDS             complement(197254..198231)
                     /codon_start=1
                     /gene="murB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TF56"
                     /locus_tag="BH623125_01680"
                     /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
                     /protein_id="GFF01734.1"
                     /transl_table=11
                     /translation="MINFQLIDGEALLARLQPTLGGIKGKLTPNMDMQKVTWFRTGGL
                     AELFYQPADEVDLAFFLQNLPESIPVTIVGIGSNLLVRDGGIPGVVIRLSAKGFGQVQ
                     QVSPTGFLVGAATADKHLAAAALEAEIAGFHFYHGIPGGLGGALKMNAGANGVETAAR
                     VVEVYALDRRGQCHTLSLADMHYSYRHCAVPEDFIFTAALLEGKPGNKGDIRAAMDEV
                     ALHRESVQPVREKTGGSTFRNPKDISAWRVIDEAGCRGLQIGGAQMSEMHCNFMINTG
                     QATAYDLEALGETVRARVFAYSSHLLQWEIQRIGQFEQGRIVSSFDPFN"
     CDS             complement(198209..199636)
                     /codon_start=1
                     /gene="murC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8UDM9"
                     /locus_tag="BH623125_01690"
                     /product="UDP-N-acetylmuramate--L-alanine ligase"
                     /protein_id="GFF01735.1"
                     /transl_table=11
                     /translation="MKMPLNIGLIHFVGIGGIGMSGIAEVFHNLGYKVQGSDQIDNAN
                     VKRLQDKGIQVHVGHHAENLGDAEFVVLSTAIKKTNPEYIAAKERHLPLVKRAEMLAE
                     LMRFRRAIAVGGTHGKTTTTSMIAALLDAGSFDPMVINGGIINAYGTNARMGEGDWMV
                     VEADESDGTFLKLPADIAVVTNIDREHLDHYGSFAAVRDAFRQFVENVPFYGFAVLCI
                     DHPEVQSLASRIDDRWVITYGANPQADIRFLNLSMDGQKTYFDVFMRSRKTGRETELK
                     NLVLPMSGQHNVSNATAAIAIAHELGISNESIKKGLAGFGGVKRRFTQIGSWRGVEIF
                     DDYGHHPVEIKAVLCAARESAKGRVIAIAQPHRYSRLYHLFDDFAACFNDADIVLIAP
                     VYAAGEEPITGFGARELVEHIQMAGHRDVRLIDCLEDVVSIVSTFSKSGDYVVFLGAG
                     NITQWACALPNQLAVFDNNDKFSAD"
     CDS             complement(199620..200756)
                     /codon_start=1
                     /gene="murG"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A6UB85"
                     /locus_tag="BH623125_01700"
                     /product="UDP-N-acetylglucosamine--N-acetylmuramyl-
                     (pentapeptide) pyrophosphoryl-undecaprenol
                     N-acetylglucosamine transferase"
                     /protein_id="GFF01736.1"
                     /transl_table=11
                     /translation="MTDKKVIVLAAGGTGGHLFPAEAVAVELRQRGYDVHLVTDERAQ
                     RFVRCFDEEHIHIISSATFTRRHPFSLIKTFWMLLKGMGQSLALFYKLCPVLVGGFGG
                     YPTFPPLIVAAFMRRVTFIHEQNAVMGRANRVLAVFVSAIAGGLLSQNNRYAHKTVLT
                     GNPVRDVVLNAAEIPYYPSEGEKPFHFLIFGGSQGASFFSRIVPEAIALLDDNIRQRL
                     RIVQQVRGDTEELIKIYRQMDVQAEVAPFFDDMAERMARSQFILSRAGASSVCEIAVI
                     GRPALLIPYPHALDHDQAANAALLARVGGAQIISEKDLNAQRLASLLTEAFCAPHLLE
                     KQALAAKKVGQPYATRRLADMAEALIVGRSLSDVKEEFFDENAA"
     CDS             complement(200749..201903)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013530956.1"
                     /locus_tag="BH623125_01710"
                     /product="cell division protein FtsW"
                     /protein_id="GFF01737.1"
                     /transl_table=11
                     /translation="MFTRADRDPIANWWWTIDRSIFAACLILMGVGIMLSFAASPAIA
                     KKIGIADSFYFVRWHIIFSIPAFFTMVTVSFFSLRNIRRLCALVLITTVVLMIATLFF
                     GPEVKGARRWIPLFGFSVQASEFMKPAFVVMSAWLFSEQIRRRGIPGYTLATLLYGFC
                     CVLLVLQPDIGQTFLISATWGGLFFVAGVSLSIIFLFIILGLVGIVLAYLFLHHVRER
                     INGFLTGEGDTFQVDVGREAILNGGWFGQGPGEGTVKRIIPDSHTDFVFSVAAEEYGI
                     ILCLFIMMLFGFIVMRSFYIASNTRDSFIRLGITGIAMMIGFQSAINMAVNLHLIPPK
                     GMTLPFISYGGSSMVAIALSMGILLSLTRRWPEARLSAFSSPVVLDTIYD"
     CDS             complement(202035..203435)
                     /codon_start=1
                     /gene="murD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A6UB87"
                     /locus_tag="BH623125_01720"
                     /product="UDP-N-acetylmuramoylalanine--D-glutamate ligase"
                     /protein_id="GFF01738.1"
                     /transl_table=11
                     /translation="MISIAFYKGKKVALFGLGKSGLATAQALISGGADVVAWDDNPSG
                     VQAAHRENIPARNLQYENWSEFVALILAPGVPLTYPQPHWVVDKARQANIEIIGDIEL
                     FVRARNHFLQQYGFCDEDVPFIAITGTNGKSTTTALLAHLLEQMGYDVQMGGNIGTAI
                     LTLKPFVKKRIYVIECSSFQIDLAPSLQPTIGLLLNLTPDHIDRHGSFAHYVNAKKNL
                     VTGASQAFISVDDAACQVLYRQLLHEGHHVEAVSKEHFVENGFYADGTQLFSVCQGRR
                     HMLADLASMAALRGSHNAQNALMALATLQALKITDPHMNKHLASYQGLAHRMQQVRKM
                     GSVLFINDSKATNAEASAPALAAFNNIFWIVGGQAKEAGIVSLRGFFHKIRKAYLIGA
                     AAEEFAGVIGSSFPFSMSLTLENAVHEAAVDAMRCKAKEVVVLFSPACASYDQFKNYE
                     VRGEAFISFVMQLKET"
     CDS             complement(203440..204525)
                     /codon_start=1
                     /gene="mraY"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TF51"
                     /locus_tag="BH623125_01730"
                     /product="phospho-N-acetylmuramoyl-pentapeptide-
                     transferase"
                     /protein_id="GFF01739.1"
                     /transl_table=11
                     /translation="MVFFIMMLFFSSLSDWLPGVSVFRYITFRTIAAMLTSGLIVFLF
                     GPSIIISLKLRQGKGQPIRADGPQTHFKKAGTPTMGGLMILSGIVVSAFLWCNLSNIY
                     FWVSLFVMLSFGMIGFYDDYLKVTKQTEKGFSGKARLSLEFLVAAIAAFVFLQVGSPG
                     LALPFVKDYFINLSWFFIPFSAFVIVATGNAVNLTDGLDGLAIVPVMVAALSFALIAY
                     LSGNINFADYLQIHYVSGTGELAVLLGAVVGAGLGFLWFNAPPAAIFMGDTGSLALGG
                     LLGSVAVATKHEIVLALIGGLFALEGFSVVIQVGYFKLTKKRAFLMAPIHHHFEKKGW
                     TESQVVIRFWIISIVLALIGLSTLKLR"
     CDS             complement(204531..205952)
                     /codon_start=1
                     /gene="murF"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TF50"
                     /locus_tag="BH623125_01740"
                     /product="UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-
                     alanine ligase"
                     /protein_id="GFF01740.1"
                     /transl_table=11
                     /translation="MKALWDKQALITAIDGYAIGEIPETFSGISIDSRTLIEGDIFFC
                     IKGHHLDGHDFAVQAYERGAAVLIVAENRLADMEKISAPLIVVSDVLQALEKLAQAAR
                     KRSKAKIIAVTGSVGKTTTKEVLKQVLATVGKVHANSASLNNHWGVPLTLARMPVESN
                     YGVFEIGMNHKDEIRPLVKLVHPHVVLITHISAAHMGFFKNLEEIADAKAEIFEGLDE
                     EGIAVLNADDDFFPYLVQKAKQCSVKRILSFGETKNSDYQAKDIRLLTDYSSMIVSIS
                     GQDRAMKIGAPGRHIIQNSLAVIAACDAIGVDLEPVLLSLSYFSPQKGRGVRYRLSLP
                     SGGEFYLIDESYNANPASMRAALDLLAIGPVGVEGRRIAILGDMLELGAYSEKLHRDL
                     VKPVYLSGANPVFLFGEAMKFLATDLAAYVKVHYAENIEKILPLILAEISNGDLLMIK
                     SSHSLYSSDIVSALLDRYKVVSL"
     CDS             complement(205949..207400)
                     /codon_start=1
                     /gene="murE"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TF49"
                     /locus_tag="BH623125_01750"
                     /product="UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-
                     diaminopimelate ligase"
                     /protein_id="GFF01741.1"
                     /transl_table=11
                     /translation="MLFGTIFTECLEDENLSSMEITGISADSRQILPGYIFVALQGHQ
                     DDGKHYINDALKRGAQAIVTDCNVVLENLSVPLLRVLDARHSLAVAAARFYGSQPETV
                     VAVTGTSGKTSVVSFLRQIWTKVGLCAASIGTLGVVSPKRNDYGSLTTPDPVFLQRLL
                     SEIANEGVTHAALEASSHGLDQCRLDGVRLTAAAFTNLGRDHMDYHTSVEDYLRAKMR
                     LFDTLLPRDASALIFADDIYSQKVIDTLTQARRHVLTIGRKGQFITINRIEHQRSKQC
                     VECRLENNIYTFNLPLAGDFQVNNALMAAGLAISTGISPDKVFRSLETLQGAPGRLEL
                     VGKTENNASVYIDYAHKPEALEQVLLSVRPFTQGRLILVFGCGGDRDQGKRPLMGKIA
                     ENKADIVIITDDNPRTEMPAKIRKDILQAAPKAIEIADRGEAITYAVGLLKAGDTLII
                     AGKGHENGQIIGQKTYPFSDRLKAIEALQERIR"
     CDS             complement(207424..209166)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013530951.1"
                     /locus_tag="BH623125_01760"
                     /product="peptidoglycan glycosyltransferase"
                     /protein_id="GFF01742.1"
                     /transl_table=11
                     /translation="MKSYFLFSQKRKRLKKQFNIDNFPVRRSYSSRRRLFFSSFCFLI
                     LYGVMGACLISYGFEGGQIEEAKGPRVLQLTARPDILDRNGRLLATDIKTYSLFAEPR
                     RIIDVDETIELLSTVLPDLNWQETYKRLKKKSSFSWIQRGLTPLQKAQIMALGIPGIG
                     FRTEIRRFYPSGPVLSHILGMVNVDNQGIAGMEKYIDDAGLSDLRAAGLATEDSLKPV
                     QLSIDVRVQTIVHDELMKAMKRYKAIAAGAVILNIHTSEVLALASLPDFDPGNPVDAL
                     KSDRLNRMTAGTFEMGSIIKSFTTAMALDSDIFHLNSIIDASKPLQASRGFTIHDFHG
                     KNRPLTLWEVFIYSSNIGSAKEAMAIGIDGHRAFLKRLGLLDRMTTELPEVAHPLVPN
                     HWKDIHSMTISFGHGMATTPLQTAVAAAALMNGGWLIAPTFLKRTRDQALQHAKQVLQ
                     AKTSQNMRYLYKLNSDIGSGRNAKVEGYRVGGKTGTAEKVENGKYSKTKNFNSFLAAF
                     PIEDPDYVVLTIIDEPQPEDGKYSATAAMNAGPILANIIRRSANFLGIKPDFQKEYEP
                     ILTTENSLSFVKKR"
     CDS             complement(209166..209570)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013530950.1"
                     /locus_tag="BH623125_01770"
                     /product="hypothetical protein"
                     /protein_id="GFF01743.1"
                     /transl_table=11
                     /translation="MTVFRTFDMILVMIMICMAGLTYKVKYDVQKRMSEVRRLEQKIA
                     AEKNTVSLLHAEWAVMIEPSRMQKLAKRYQKELGLESIQPRQVVEFESIPVRVHDQIE
                     EVIKQNLLEEGKDILANNRTSQANGVVRKGVR"
     CDS             complement(209567..210607)
                     /codon_start=1
                     /gene="rsmH"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A6UB93"
                     /locus_tag="BH623125_01780"
                     /product="ribosomal RNA small subunit methyltransferase H"
                     /protein_id="GFF01744.1"
                     /transl_table=11
                     /translation="MAIDLKKHKSRRIILTKQGKRTERHIPVLLQPVLAGLIPLVGAK
                     VIDGTFGAGGYTRALLNAGAQVIALDRDPHAIREGQSLVDEFFPRLRLVQGNFSQLDC
                     VVEEKVDAVILDIGVSSMQLDEAERGFSFQKDGPLDMRMAQTGFTAADVVNRLKSDEL
                     ARIFKILGEERYARRIARMIEKRRCVQPFLRTGDLAHAIEVLVGRKSGERIHPATRVF
                     QALRIYVNDEIGELARGLFAAERVLKPGGRLGVVSFHSLEDRMVKRFFSARSGESVRS
                     RYLPEIEMAPATFFPLFKGGITANKEELERNPRSRSARLRIGVRTEAECLFADMKLFG
                     LAKIASFEGGKK"
     CDS             complement(211331..211840)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_01790"
                     /product="hypothetical protein"
                     /protein_id="GFF01745.1"
                     /transl_table=11
                     /translation="MQFLKILLSAVFAISFVFDISLAHTVLNVAGSSEGSEIIASKIP
                     VRPYEFLIQKFANKYNVPVNLAHAVVRVESDYKAFIKGAAGEIGLMQIKPSTARGLGF
                     KGSVQDLYDPATNLEYGMRYLARAYKLSAGDTCGTILKYNAGHAAKKMNSISEKYCSK
                     VKTYLASLK"
     CDS             complement(212771..212998)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_01800"
                     /product="hypothetical protein"
                     /protein_id="GFF01746.1"
                     /transl_table=11
                     /translation="MLIERLEVFFPGLIRELSKLNPQQQKQFIERVRCDIVTAASANG
                     KSIEQACQLGEIVAMVLSRAISRGTVSDAYF"
     CDS             complement(214492..215430)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013530933.1"
                     /locus_tag="BH623125_01810"
                     /product="ArsR family transcriptional regulator"
                     /protein_id="GFF01747.1"
                     /transl_table=11
                     /translation="MKEIINLDEMIMLLKTIAESSRLRLLALLYHEDLTVSDFTLVLG
                     QSQSHVLQHLHLLYEAQLVERYQKGRSIYFKLYYGRLGKDIVMAVVSALLEHNRVIAH
                     DLARLKDIKKQYRKQEKKYFLQNVVQWDTLRLFSIADLGVENALREIVGDKPFETMLD
                     ISRDTGSVLKLFSGLYTYAVEVVLDSDILHLSVENTTFDLVILHWVLYFLESPEVALH
                     EIAGVLRPHGRLLIVDFVRHEVESSHSYLSHMPFGFSDLQIEQWLKNVGLILEKIICF
                     PPLQNENNERLMVKIWLARDPRLLVDDIKDKKVEFA"
     CDS             complement(215874..217523)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012708658.1"
                     /locus_tag="BH623125_01820"
                     /product="energy-dependent translational throttle protein
                     EttA"
                     /protein_id="GFF01748.1"
                     /transl_table=11
                     /translation="MARQFIYHMAGLSKTYGNKKILENIHLSFYPDAKIGILGPNGAG
                     KSTILRIMAGIDKEYTGEAWLSEGVRCGYLPQEPFLDASKDVRDNVMEGVADKQAIVE
                     RYNELMMNYSEETADESARLQDIIDGQNLWDLESQVEMAMAALGCPPANGDVTKLSGG
                     ERRRVALCKLLLSKPDLLLLDEPTNHLDAETTAWLERYLREYSGAVLLVTHDRYFLDN
                     VTGWILELDRGKGIPYEGNYSAYLAAKAKRLAQEGREEAARQRALSREQEWIASSPKG
                     RQAKSKARIKAYDELVQASRERRPGEAQIIIPIGERLGQVVIEVDNLSKAYGERVLID
                     DLSFKLPAGGIVGVIGANGMGKSTLFKMLTGQEQPDSGQIRIGETAHMSYVDQSRDSL
                     VGDKTVWEEISGGNDVIKLGKYEMNSRAYCGAFNFKGADQQQKVANLSGGQRNRVHLA
                     KLLKEGGNVLLLDEPTNDLDTETLGALEDALENFAGCAVIISHDRMFLDRLATHILAF
                     EGDGHVEWFEGNFAEYEADKVRRFGADSLNLKRVNYKPLTR"
     CDS             218258..218866
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012706796.1"
                     /locus_tag="BH623125_01830"
                     /product="nicotinamidase"
                     /protein_id="GFF01749.1"
                     /transl_table=11
                     /translation="MEKKALIVIDIQNDFLPGGALAVPQSDIILPAVNNLIEHFDHVI
                     LTQDWHPKNHCSFASSYPDKKPYDSVNLDYGPQILWPDHCVQGTKGADFHTSLKVDKA
                     QLILRKGYNQKIDSYSAFFENDQKTPTGLQVYLKEHGFTKLAMCGLATDFCVSFSALH
                     AIQCGFKVSVSLNACAGIDVNGSLNTMLKTMNEAGIELLMAS"
     CDS             complement(218914..219972)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010976113.1"
                     /locus_tag="BH623125_01840"
                     /product="hypothetical protein"
                     /protein_id="GFF01750.1"
                     /transl_table=11
                     /translation="MVLVGYLGWPFFFTIIGVFLGGAIGWFETGSVIGFLKYFFICCV
                     LGVLEISLSFDNSIINARVLERMDPLWRRRFLVWGILIAVFGMRLVFPLLVVAIAVGI
                     NPIAAVKLAIWEPHHYAAVLTDVHLAIAAFGGTFLMMVGLKYFFDPEKEVHWLVFIER
                     PAQKLGALVGIDIAIVLVLILFFSGQVVTEDKMVFLLASLYGLLIFIAVEAVSSLLDA
                     PKTALTTVAKGGAGAFFYLEILDASFSFDGVVGAFAFSHNLFIIAIGLSIGAFYVRSM
                     TIMLVESGILLHYRYLEHGAFYAILVLAVIMYLQTLLSIPEVLTGLVGVCIIGMAFYS
                     SLRFKRHHLNKQGVSKSE"
     CDS             220334..220873
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_01850"
                     /product="hypothetical protein"
                     /protein_id="GFF01751.1"
                     /transl_table=11
                     /translation="MARPETESKTIFGKRLRYVRLALGDPSREALAKSFSMTKNSIAF
                     YERGEREPNLSVLQTYRTLYGVNINWLLTGQGKMFDTEYTKGDFDWNYFIKKIEGLEE
                     ILSNSDRSEKLNQEKIESSYEKLQQYLSRQGSTNRYTPKAATSLIDMKAKMANSYALS
                     LFIDLLIRSISQKEVVANQ"
     CDS             221290..221469
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_01860"
                     /product="hypothetical protein"
                     /protein_id="GFF01752.1"
                     /transl_table=11
                     /translation="MYFEVFQGVHKQWYWRLISGDEQKIAFSSKGYPTKQDILINIEQ
                     IKEITHKALIRELQP"
     CDS             complement(224199..224513)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_01870"
                     /product="hypothetical protein"
                     /protein_id="GFF01753.1"
                     /transl_table=11
                     /translation="MNINEIVWVVVVVVLLFSGIILRFALYYRDQAKAFQEEARKIKH
                     EFLRDSMKITEERDRAIREQNMVIKRRDQVIAKLKQQLKQYEEAMQQHQEEIKSQDEA
                     KN"
     CDS             complement(224739..225407)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_01880"
                     /product="hypothetical protein"
                     /protein_id="GFF01754.1"
                     /transl_table=11
                     /translation="MVYRMRVLRDFVSFKKSDFDDFRDQGNCWLECDIRSRYFIEDRC
                     VFRDPKFYNDSYICDRIYIYDNGQIYCMSFVSSVTVGYGKAQAYGPIEICRSAYVSNK
                     IKIILHSKGSGNAYIYGDAKVYDYVCITNSFEVYCKARIYNIQVYDSAQFFANSQIYN
                     NALVCGYVKIRKKTKIYCNAEVGNCEDLRNDEETYIFFCILHGAKEANTNNGSKACVE
                     YLPP"
     CDS             225852..226184
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_01890"
                     /product="hypothetical protein"
                     /protein_id="GFF01755.1"
                     /transl_table=11
                     /translation="MCKGLKMTKTEKDWFQRLIKLIKSDGRTMIEISKAAGCGQNYVQ
                     QMIKGGKRPSVDKLMALLNTLGNASAIYVITGFNISDEDLKLIALISSGDKKKIEALS
                     LLLTEKKQ"
     CDS             complement(226108..226290)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_01900"
                     /product="hypothetical protein"
                     /protein_id="GFF01756.1"
                     /transl_table=11
                     /translation="MKNEENFEKVLPRIIVKWEALSKTQKQEILERVENVTASSQSTE
                     DLKLQSSFYLQTKSKL"
     CDS             227019..227180
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_01910"
                     /product="hypothetical protein"
                     /protein_id="GFF01757.1"
                     /transl_table=11
                     /translation="MYKEEAYDKDKELFTINIGKKFWLAAYSKRHLLPYKNKIKKTHR
                     LPFYDNSNH"
     tRNA            complement(229196..229272)
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="BH623125_t00080"
                     /product="tRNA-Met"
     CDS             229441..230178
                     /codon_start=1
                     /gene="pp26"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010972105.1"
                     /locus_tag="BH623125_01920"
                     /product="SIMPL domain-containing protein"
                     /protein_id="GFF01758.1"
                     /transl_table=11
                     /translation="MKKVIFKPLKSYPVKMAMIALTLLAASPITHAEESKMKNATITV
                     TATGENQATPDMAIINLAVVTQDKTAQKALADNNKSMNDIINAFKNNGIQANDLQTSG
                     LSIYQSNPNKDHEKKNNGIVYHVSNSLTVRIRDLSNAGKIFDQAMALGVNSVHGITFT
                     NANTKPFYQEARKKAIAEAIEKAKTIAEAADLKLGKIIKINENDDNYYSRPHLMSKAV
                     NANYTDTTFSSGELNYSVSVTIVFAID"
     CDS             complement(230218..230691)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TL64"
                     /locus_tag="BH623125_01930"
                     /product="UPF0260 protein"
                     /protein_id="GFF01759.1"
                     /transl_table=11
                     /translation="MANFMSKEAPFWKVKKLEEMSLSEWESLCDGCGLCCLHKVEDDD
                     TGDIYATSVACRLLDSETCRCRNYVHRKSIVPDCIFLNLATIKTVRWLPENCAYRLIY
                     EGKDLYWWHPLVSGNYQTVHQTQFSARGQIEIYEDELSSEEDYLQYITGILCEGR"
     CDS             complement(232716..234719)
                     /codon_start=1
                     /gene="rpoD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TK92"
                     /locus_tag="BH623125_01940"
                     /product="RNA polymerase sigma factor RpoD"
                     /protein_id="GFF01760.1"
                     /transl_table=11
                     /translation="MATKVKQKDNTEVTTQASVDSPLLDFSDDAIKKMVKIAKKNGYV
                     TMDELNAVLPPDEVTSEQIEDTLAMFSEMGINVVDDEGEAENYEEEVRVEGGDLVEAT
                     SNALVTTAKRELTDRTDDPVRMYLREMGAVELLSREGEIAIAKRIEAGRETMIAGLCE
                     SPLTFQALIIWREELKEQRILLREIIDLEMTYAGPEAKQAPVIERSEVQKVKEEKSSS
                     AMRDMENIARDIGVEEDDEEDDDVNLSLAAMENELCPQVMETLDFIAETYVKLRKLQD
                     QHVESSLAERKEGALSPSQRKKCIQLKSELVQAVKSLSLNQNRIESLVEQLYDINKRL
                     IHNEGKLKRIANNYGVGHEEFLKEYQGRELDADWINYIATLSGRGWKEFSKREAKEIK
                     TLRSEIQNLAQETAISIGEFRRIVTQVQKGERESTIAKKEMVEANLRLVISIAKKYTN
                     RGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPV
                     HMIETINKIVRTSRQILHEIGREPTPEELSSKLSMPLEKVRKVLKIAKEPISLETPVG
                     DEDDSHLGDFIEDRNALLPIDAAIQANLRDTTTRVLASLTPREERVLRMRFGIGMNTD
                     HTLEEVGQQFSVTRERIRQIEAKALRKLKHPSRSRKLRSFLDS"
     CDS             complement(235068..237005)
                     /codon_start=1
                     /gene="dnaG"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TK91"
                     /locus_tag="BH623125_01950"
                     /product="DNA primase"
                     /protein_id="GFF01761.1"
                     /transl_table=11
                     /translation="MRFSPDFLDELRTRLPISTVIGQRVTFDPQKSKPSRGDFWSCCP
                     FHGEKTPSFHCDDHKGRYYCFGCGVSGDIFTFLCELDGLHFSESVVRLADFAGMKLPL
                     FDPQSHKSQMGKADLYNVMKIATDFFQYSLRDKAGVQARRYLDARGVTPKLAERFRIG
                     FAPTRRTALKEALNARGISIKQMEECGLIKMGEDGTTSSDRFRNRIMFPIEDLRGRVV
                     AFGGRALEKDIRAKYLNSPETVLFHKGDMLYNAASARKNSRLVGDEKNHALLVVEGYM
                     DVITLTKAGFEGAVAPLGTALTEAQIALLWQIGTDPILCFDGDDAGLKAAFRVADRVL
                     PLLKAGVSVRFVLLPQGKDPDEIICAGGAELFTSFLQKSIPLIELLWWRATYGKNFEI
                     PEARAALEKQLKQQIFTIKDEDIRRYYLQDIKKRLFDFFRPSFSNKKFTGRSYQSSPN
                     RILKDQSFSVLANSNIVRNSSHSIPLREAVILLILAYYPELWYENFEVLAELELQNTQ
                     LVRFHQSMLEILGNQQLHDKETMIALLEERGLKVLLELMKNLVKKIGMRTIFYGAPIE
                     DARAILKQAIYLHLQEYHLHKRLQDIEEQLVENPKSEVFDLLCETKIELEQMQATEAL
                     IEGFGSWFDEEIDGNKQDKIK"
     CDS             237141..238358
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011103605.1"
                     /locus_tag="BH623125_01960"
                     /product="mechanosensitive ion channel protein MscS"
                     /protein_id="GFF01762.1"
                     /transl_table=11
                     /translation="MIKFLVQYPWLETISWLIILILIALFINFLARKSLIHGVKTLGS
                     FLPKKTTNDIRNAIQFMANIVSAFMLSIGVNFIPTLPKTFSTIISNVANALIIFFVVL
                     TISALLNVINTLYEQRPAARVKPIKGYIQIAKIALFTVAVVLMIATLIDRSPLILFSG
                     LGAMAAVLMLIFQDTLLSLVAGIQISSTDMIRVGDWIEVPNLGADGDVIEIALHTVKV
                     QNFDNTITSVPIRKLVTDPFKNWRGMQEAGGRRIKRSLFIDQSSIRFHTEKEQKYLSR
                     FNLLEDYFTQKIPEITEWNARLEKNHDVLANTRRLTNIGTFRAYIVAYLQKNQSIAQN
                     MTLMARQLPPTENGLPLEIYCFTNTTVWLEYEQIQCDIFDHLYSILPNFGLKIFQNPS
                     GYDFNHLLEKKAK"
     CDS             238428..240101
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013530146.1"
                     /locus_tag="BH623125_01970"
                     /product="Na+/cotransporter"
                     /protein_id="GFF01763.1"
                     /transl_table=11
                     /translation="MNSSLVLLHLAGAISLLLWATRMVRTGVERAYGDKLKYKMRHVI
                     SKPFFAVSFGLLTAMILQSSTAITLLVGSFVESGFVSGLAGLMAVRGGELGSALVVKI
                     LSYDLTIVVPLCLLIGTCIFMTTEKRDWRQIGRIIIGIGLLILSLQMISAATEPLRDS
                     AVLPSIISYLSTDPVSTFLLAAVLTYLLHSSIAGIILLVNFANYNLIHAQLCIIMVLG
                     VNFGSSLIAPLLTRNASPNTRLVPLGNLLMRGAGSILVLILFLFFQPPITWLGNEVST
                     QVINAHIVFNVFILLAGIPLSKWVLQLTTKIVHLSTKKVQTDKILNLSDQTALDDSVL
                     ERPTLALSNVMREVIHICDLVDIMLEKIMGLYEKPDPDIIRELNQLNTILEKKHIAIK
                     LYLARLAGQKLSDEEALQTQELLSTCIKLDQAGDIIIHNMLMLVKKKQQKGLQFSSDG
                     WNDLLRFHAIVLANAHIAFNVLVSRDTHAAHLLVQKKDQLRNLEKEMNLKHFKRLREG
                     ELKNVESSSLHLDTVRDLKQINSLLTSMIYPILEAKGLLKSSRLRNPTE"
     CDS             240718..240969
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_006313814.1"
                     /locus_tag="BH623125_01980"
                     /product="membrane protein"
                     /protein_id="GFF01764.1"
                     /transl_table=11
                     /translation="MEDAKIGWITAIIIGGLAGCAAQYLMKNQTGVFLNIILGIIGAA
                     LASFLFGLLGISFAGWVGYLISGFVGACILIWLGRKVRS"
     CDS             242864..243379
                     /codon_start=1
                     /gene="ubiC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8ZJ20"
                     /locus_tag="BH623125_01990"
                     /product="chorismate pyruvate-lyase"
                     /protein_id="GFF01765.1"
                     /transl_table=11
                     /translation="MSDPKDSILPPLKWLSDQDPPVPTHIKDWLMELGSMTRRFENHC
                     TYIHIKPQRECFITRDKLKEEAAHLPKSTRYWLREVILMGDNQPWLLGRTVIPQETLF
                     EHNEALINLGDVPLGRYLFSIDKLTRDYIHIGRKDTLWARRSRLRLTGKPLLLTELFL
                     AASPLYTTNPI"
     CDS             244574..245773
                     /codon_start=1
                     /gene="carA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8UDF7"
                     /locus_tag="BH623125_02000"
                     /product="carbamoyl-phosphate synthase small chain"
                     /protein_id="GFF01766.1"
                     /transl_table=11
                     /translation="MTQTIPSPKPWSINKPTALLVLANGTVIEGKGAGATGFAEAEIC
                     FNTAMTGYEEILTDPSYKKQIVNFTFPHIGNVGTNSEDIEDLIPLNCHGAVGAIFKAD
                     ITHPSNYRANENLNQWLKKRKIIALCGIDTRALTVLIREKGALNGIIAHDPNGNFDIN
                     TLKKRAQKWTGLVNLDLAQEVTSKQSMKWNEKPWVWNKGYKTNNDASNFHIVAIDYGI
                     KRNILRLIAAHSAHITIVPANTNIEEILAMNPDGVFLSNGPGDPAATANYAVPTIQAL
                     IDSNIPLFGICLGHQLLALAVGAKTIKMHQGHHGANHPVKDFITGKVEIVSMNHGFTV
                     DTTSLPQHVEETHISLFDNSNCGLRIIGKPVFSVQHHPEASPGPQDSHYLFQRFFNLI
                     MDYKKTA"
     CDS             247681..248520
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_005763843.1"
                     /locus_tag="BH623125_02010"
                     /product="hypothetical protein"
                     /protein_id="GFF01767.1"
                     /transl_table=11
                     /translation="MRKILQFILISVLAIGCDIKDSYANKDVSENNMETQQTARVNLD
                     PYTLNKLNILLEERSKANDHNIGEMIAFLSKAFLGTPYQPNMLHGSENTPEKLIIDFR
                     GLDCFTYLDYVEALRKSTSQTEFINNVIRTRYVEGDVNFLNRKHFFTDWAYRQYKIAN
                     DITAQISPNAVTTEKYLNKKADGANYLPGLPIVKRNITYIPSQFINEEVINRLQSGDF
                     IGIYTKLAGLDVTHVGFFIMTDNGPMLRNASSRKENEKVVDSPFMDYVSKTPGIIVLR
                     ALQ"
     CDS             249196..252681
                     /codon_start=1
                     /gene="carB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:C3MD22"
                     /locus_tag="BH623125_02020"
                     /product="carbamoyl-phosphate synthase large chain"
                     /protein_id="GFF01768.1"
                     /transl_table=11
                     /translation="MPKRTDIKSILIIGAGPIVIGQACEFDYSGTQACKALKEEGYRI
                     ILVNSNPATIMTDPELADATYIEPITPEIVAQIIAHERPDALLPTMGGQTALNTALSL
                     KRMGILDRYHVEMIGANADAIDKAEDRALFRKAMAKIGLETPRSMLANATELKEENRQ
                     KYAKKRNELKTQLFGDDLDKALEKLEHDWRHTEADRKQHYIAHATAKAVQALDIIGLP
                     AIIRPSFTLGGTGGGIAYNRSEFYEIIERGLEASPTTEVLIEESVLGWKEYEMEVVRD
                     KNDNCIIVCSIENIDPMGIHTGDSITVAPALTLTDKEYQCMRNASIAVLREIGVETGG
                     SNVQFAVNPENGRLIVIEMNPRVSRSSALASKATGFPIAKVAAKLAVGYTLDELKNDI
                     TGGATPASFEPSIDYIVTKIPRFAFEKFPGSSPVLTTAMKSVGEVMAIGRTFQESLQK
                     ALRGLETGLTGLDEIVIPEHAEGDEKSSIRSAIAIPSSDRLRYIAQAIRTGLPLNEIH
                     QISKIDPWFLEQIASIIEMEERIRTHGLPQDADNLRMLKAMGFSDARLATLTGQEPDD
                     IAALRKSLNVKHVFKRIDTCAAEFSSPTAYMYSTYEVPFAGVEHSEAQVSERKKIAIL
                     GGGPNRIGQGIEFDYCCCHAAFALRDAGFEAIMINCNPETVSTDYDTSDRLYFESLTT
                     EDVIAILETEQQKGELLGVIVQFGGQTPLKLAKALEQHNIPILGTSPDAIDLAEDRDR
                     FQKLLFKLNLTQPKNGIAHSVEQAHFIAHELGFPLVVRPSYVLGGRAMEIIRDERSLQ
                     NYLLESVPELVPENIKARYPNDKISQLNTLLGKNPLLFDTYLTEAIEVDIDCLCDGKE
                     TLVVGIMEHIEEAGIHSGDSACSLPVHTLSSEIVAELERQTKALAQALHVRGLMNVQY
                     AIKDGTIYVLEVNPRASRTVPFVAKTIGRPIAKMATRIMIGETLHDALKAYGGLPSPQ
                     YKQRIAVKEAVFPFARFPGVDTLLGPEMRSTGEVMGLDYEFALAFAKAQLGAGVELPK
                     EGTLFVSVKDEDKKHILDPVKRLIALGFSVLATSGTQKFLTNHNVEAKKINKVLEGHP
                     HIEDAIRNRQIQLIFNTTSTASAISDSKSLRQAALMQKVPYYTTIAGAKSVAEAIEAL
                     TKSNLEVRSLQNYFI"
     CDS             complement(252935..253120)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_02030"
                     /product="hypothetical protein"
                     /protein_id="GFF01769.1"
                     /transl_table=11
                     /translation="MNPKPLVVLNHLTVPVDIGNSLELYINYLCTEAISIHYGFRSKL
                     GGISFVKSADCTGKKVT"
     CDS             253068..253277
                     /codon_start=1
                     /gene="cspA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_006309931.1"
                     /locus_tag="BH623125_02040"
                     /product="cold-shock protein"
                     /protein_id="GFF01770.1"
                     /transl_table=11
                     /translation="MSTGTVKWFNTTKGFGFIQPSDGSADVFVHISAVERSGLSNLNE
                     GQKVSYDVLQDRRSGKFAAGNLATL"
     CDS             253575..254777
                     /codon_start=1
                     /gene="aatA3"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:C3MFH8"
                     /locus_tag="BH623125_02050"
                     /product="aminotransferase"
                     /protein_id="GFF01771.1"
                     /transl_table=11
                     /translation="MAFIADKLSHIKPSATIAVSQKARNLKVLGRDVITLGAGEPDFD
                     TPENIKNAAIEAIRRGETKYTPISGIPELRQAISAKFKRENNLTYQPEQIIVGTGGKQ
                     ILFNALMATLNKGDEVIIPSPYWVSYPEMVTLNGGIPVFLETKAEFSYKLQPQELEAA
                     ITHKTKWFIFNSPSNPSGAAYTHEELKKLTDVLIKYPHVYILTDDIYEHLTYEGFTFV
                     TPAQVEPNLYDRTLTMNGVSKAYAMTGWRIGYAGGPQELIKAMDTIQGQQTSGTSSIS
                     QWAAVEALNGPQDFIAKNKTVFQTRRDLVVSMLNQAPGIECPTPEGAFYVYPSCAKLI
                     GKKTPEGKVIAHDEDFVTALLEAESIAVVHGSAFGLGPAFRISYATSEKFLEEACSRI
                     KHFCESLL"
     CDS             complement(255557..256462)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010969307.1"
                     /locus_tag="BH623125_02060"
                     /product="transcriptional regulator"
                     /protein_id="GFF01772.1"
                     /transl_table=11
                     /translation="MSSPLDWDKLRVFHAAAEAGSFTHAAQMLHLSQSAISRQVSALE
                     QEVGVSLFQRHARGLILTEQGEILYRTTHDVLMKLESARSQLSESCEKPAGNLRVTST
                     FGMGAGWLVERMPEFLSLYPDMRIQLLFDDKELDLMMRYADCAVRLQQPQQPDLIQKK
                     LFTIHMHVYASKNYIANYGKPEKLSELDNHRIISFGEPVPTYLSGLNWLEKAGKSDGA
                     LRLSILRINNIISIKNALMRDLGIAVLPDYIVDNDEHLVRLFPDMVDIPSFDTFFCYP
                     YALKNLAKLKAFRDYIFSKARQWSF"
     CDS             complement(256519..257472)
                     /codon_start=1
                     /gene="trxB3"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:C3MD13"
                     /locus_tag="BH623125_02070"
                     /product="thioredoxin reductase"
                     /protein_id="GFF01773.1"
                     /transl_table=11
                     /translation="MVQSHVRLLIIGSGPAGYTAAIYAARGMLKPVLITGLQQGGQLM
                     ITTDVENYPGFADPIQGPWLMEQMAKQAENMGTKIVYDNITKADLSKRPFILYGDSGA
                     QYCCDALIIATGAQARWLGLESEQVFMGGGVSACATCDGFFYRDKDVIVVGGGNTAVE
                     EALYLSHLAKRVSVVHRRDYFRAEKILQDRLFARDNVCVLWDHVVEEIIGLPARASIG
                     AVVTGVRLKNVKTGQKVHVDTDGIFIAIGHDPAVSLFEGQLKQKSGGYLWTAPDSTAT
                     SIAGVFAAGDVVDDVFRQAITAAGRGCMAALEAERFLELQI"
     CDS             257785..259179
                     /codon_start=1
                     /gene="trkH"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q92PU8"
                     /locus_tag="BH623125_02080"
                     /product="Trk system potassium uptake protein"
                     /protein_id="GFF01774.1"
                     /transl_table=11
                     /translation="MLLPIFADLHNHNPDWVTFVYSCSITTILATLILLATRGATCHF
                     SARLGFMLTVCLWLTGSVVGALPLYLSPLQISLAGAIFESVSGITTTGSTVITGLDNL
                     SRSILLWRSIICWIGGIGFIGLALLLLPSLRVGGVQLFHMESSDKSEKILPRINQIAN
                     GIIIAYVGLTLACMLSYFASGMSLFDAINHAMSTVATAGFSTHDASFGYFSDKPAILI
                     ISTIFMLLSALPFVLYVKLVLPGRSKRFIDPQVIVFLYIVFLFSFSLAAWLKFHDHRA
                     FHVIFLDVIFHLTSVISTTGYTAEDYQLWGPFAFGIFFIISFMGGCAGSTSGGMKINR
                     LIILWRITQTNIAQLLSPNVVVKARYDHANISSDVAKAILFFVCLYMFCLIIGTALLL
                     TTDLDFTSAFTGVLTALSNIGPGFGDIIGPAGNFSTINDNALWILSFMMLAGRLEIIT
                     IFVLFIPAFWREQF"
     CDS             complement(259841..259996)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_02090"
                     /product="hypothetical protein"
                     /protein_id="GFF01775.1"
                     /transl_table=11
                     /translation="MLFINHLNYNILSWQENNGAGFHLHKYKDGGAQGILSISFTGVV
                     VKWAFVL"
     CDS             complement(260303..261361)
                     /codon_start=1
                     /gene="lpcC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010972124.1"
                     /locus_tag="BH623125_02100"
                     /product="glycosyl transferase family 1"
                     /protein_id="GFF01776.1"
                     /transl_table=11
                     /translation="MHVSLEETEIIAPHFKKRLSGITSTVVQLIPLQRKQGIRIATFG
                     FGLPNNLPALAFKDLFGLWKSPIGKPFRIWHARRNIEMLCGIFLRDVLRMKLKLLFTS
                     ASQRHHKSFTKWLIRRMDKVIATSIRTGTYLEVPHQVIMHGVDVRRFSPPKTFEDCFS
                     SSGFPGKYAVGCFGRVRYSKGTDLFVDAMIALLPRYPEWTALIAGRTIEQHYYFEKKL
                     RQKIAEAGLNDRIVFLGEVLNTPLWYRRLSLYVAPSRTEGFGLTPLEAMASQTAVVAS
                     DAGAYKELVVEGTGTIVQAGDGGALTAAIEPYFADLEKTMAAGEKALAHVRTHFPLEK
                     EAAAIRNVYETVFAQKTL"
     CDS             complement(261368..261841)
                     /codon_start=1
                     /gene="greA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TJ69"
                     /locus_tag="BH623125_02110"
                     /product="transcription elongation factor GreA"
                     /protein_id="GFF01777.1"
                     /transl_table=11
                     /translation="MEKVPMTTAGFESLKEELRWRQQEERPRIIEAISEARAHGDLSE
                     NAEYHAAKEAQSHNEGRINELEDYIARAEVINVSRLSGDKIKFGATIKLLDEDTEEKK
                     VYQIVGDQEADVKTGKISISSPIARALIGKQEGDVIEVNAPGGAHNYEIIEVQYI"
     CDS             262753..265065
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_02120"
                     /product="hypothetical protein"
                     /protein_id="GFF01778.1"
                     /transl_table=11
                     /translation="MKNGVTATVEALSALIASGNPLFKNGALWTPHRPVRPEKSEGGI
                     PFQLETSFEASGDQPQAIKTLVEGIEKNERTQVLLGVTGSGKTYTMAKIIEKTQRPAL
                     ILAPNKTLAAQLYGEFKSFFPHNAVEYFVSYYDYYQPEAYVARSDTYIEKESSINEQI
                     DRMRHAATRAVLERDDVIIVASVSCIYGIGSVETYTAMTLQIKKGDKLNQRQFLADLV
                     SQHYYRQDINFIRGSFRVRGDTIEIFPAHLEDRAWRISLFGDEVETITEFDPLTGQKT
                     GDLQSIKIYANSHYVIPRPTLNQAMKAIKTELVQRLDELNKAGRLLEAQRLEQRTMFD
                     LEMLETTGSCAGIENYSRYLTGRQPGEPPPTLFEYIPNNALVFIDESHVTIPQIGGMY
                     RGDFRRKATLAEYGFRLPSCMDNRPLRFEEWDAMRPQTIAVSATPGRWEIEQSHGIFA
                     EQIIRPTGLVDPPTEVRPASSQVDDVVNEIHKTIQKGYRTLVTVLTKRMAEDLTEYLH
                     EQGIRVRYMHSDIDTLERIEILRDLRLGAFDVLIGINLLREGLDIPECGFVAILDADK
                     EGFLRSETSLVQTIGRAARNVDGRVILYADIITGSIERALQETQRRREKQIAYNEKHH
                     IKPTSIKKNIDDILNSGGENGYTHTNIPDFITQNSKTGNNLAKHIQYLEKSMREAAAN
                     LHFEEAARLRDEIKKLQKIELTIADNPLNYSEQFIQEPQSRIFAKPDLDHMGPTIDTG
                     ILENRKEKRRPYKNTLNKTTKNKEKIPPNK"
     CDS             265797..266495
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_02130"
                     /product="hypothetical protein"
                     /protein_id="GFF01779.1"
                     /transl_table=11
                     /translation="MKKITKLAVLSAISTATIWVPLGTTLADTKLTYSEEITKKIEDM
                     KKEMKTNFPSHNFSAHSVLEKHHPYYPSSNHHHHHVDHKRREQSHHHTERKTHRHVER
                     KITTHRHIYEHHVTTRNNSGDALASGIIGLAAGTILGNVLKKPEQPKIIYQTVPQSRV
                     IYQEIPQVVYQQIPQNQVIYEVQPTGTYQPIQQPWTTDWLQYCKKKYRSFNPKTGTFR
                     GYDGLDHFCYAPLK"
     CDS             complement(266561..267211)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012708800.1"
                     /locus_tag="BH623125_02140"
                     /product="MBL fold metallo-hydrolase"
                     /protein_id="GFF01780.1"
                     /transl_table=11
                     /translation="MVSFRTHIIPVTSFQQNCTLLFDNERKVGVLVDPGGDWLQIQDV
                     IRKNGVIVEAIWITHGHFDHVGAAMQAKEALNVKIIGSHRDDKPVMDAVRESAESYGI
                     TDARICVPDQWLEDGDSVHFAGHVFRVYHTPGHSPGHVIYFNEKERFALLGDVLFRGS
                     IGRTDFPFCSHKDLMKSLREKVLPLGDDVRFICGHGPGSYLGYERQWNPFLQGFHE"
     CDS             267364..268068
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013530014.1"
                     /locus_tag="BH623125_02150"
                     /product="DNA-binding response regulator"
                     /protein_id="GFF01781.1"
                     /transl_table=11
                     /translation="MTDHVQVLCDDAPHLLVIDDDTRIRNLLFQFLIKNGFRVSVSAN
                     ADEARRQLSNLDFDLLIVDVMMPGENGIDLTHSLRQTKDVPILMLTALSEIDNRINGL
                     EAGADDYLAKPFDPRELLLRIHAILRRGFALNQSKIEQIVFGPYIFSISRRELKKGGE
                     VIKLTDKEQKMMVIFAENPGDIIPRHKFATEDSNIGERAIDVQINRLRRKIEKNPSLP
                     IWLQTVRGIGYKLSIE"
     CDS             268222..269415
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013530013.1"
                     /locus_tag="BH623125_02160"
                     /product="two-component sensor histidine kinase"
                     /protein_id="GFF01782.1"
                     /transl_table=11
                     /translation="MVTERLSTAVVHDISAIIDIIETYPQQDNYEDIKRIAQQRMGLN
                     ISILPPTPLPPPGPKPFFAILDYFLSEEITRQINRPFWIDTVGDSNLVEIRIHLGHNI
                     LRVFALRSQAYASNTGIFLSWMVGTALVLLLIAIYFLRNQIKPIQQLAEAAESFGRGR
                     PLPESFQPQGADEVRRAGIAFLRMRERIERQIEQRTMMLSGVSHDLRTILTRFKLQLA
                     LANTDFDTNPLEQDVSDMQNMLEGYLAFARGEGNENFKTFDLKALMQKFSADAHLHKR
                     HFSYTIEGPTEIQARPHAFTRLVSNLVSNAFYYANTVKLTAISQQESFIITIDDDGPG
                     IQKNMRTEVFKPFFRLDKARNQDASGTGLGLSIAQDIARSHGGNIQLEDSPLGGLRAI
                     IDIPL"
     CDS             complement(269468..269968)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013530009.1"
                     /locus_tag="BH623125_02170"
                     /product="hypothetical protein"
                     /protein_id="GFF01783.1"
                     /transl_table=11
                     /translation="MRLAFCATEREQHPVDFIEQIACKYDWSFERDAEDEISVCVEGK
                     RANYRLAFSWMEEQEALHLACAFDLSIENARTAEMHRLLLAINEKLLLGHFDYWQGNN
                     SVIYRQGLLLAGGVHPSHIQVETLLIHALKVCESHYVAFQMVAWSGESACKALQYTLF
                     ETIGNA"
     CDS             complement(270355..270612)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013530008.1"
                     /locus_tag="BH623125_02180"
                     /product="hypothetical protein"
                     /protein_id="GFF01784.1"
                     /transl_table=11
                     /translation="MRNGSNRILDELAKLATDAADVAQGIRREAGTAFRLQAEKIANK
                     LDLVPREEFETFKEMVLKVSVDNADLKKRLDDLEKNQTAKE"
     CDS             complement(270829..270948)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_02190"
                     /product="hypothetical protein"
                     /protein_id="GFF01785.1"
                     /transl_table=11
                     /translation="MGPKWTMTGLRKDGKAMAGQEKSFMSKHFTFMRLYDGQE"
     CDS             270980..271753
                     /codon_start=1
                     /gene="lgt"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8UDB4"
                     /locus_tag="BH623125_02200"
                     /product="prolipoprotein diacylglyceryl transferase"
                     /protein_id="GFF01786.1"
                     /transl_table=11
                     /translation="MGILFVWWYAQKLLKKQSLWYANHPPMDKEKIGDFVVWSAISIV
                     VGGRLGQVLVWDPIYYFSHPTAIITIWNGGMSFHGGLIGITIAMIWFARKNNIKIRAM
                     FDIIAIGAPIGIGIVRICNFINQELWGNVTTHPWAVCFPLDPYYLPRHPSQLYEALME
                     GFLLFVILFILTFAFKALKRPGTVSGIFIIGYAIARSISEIYRAPQEDPEWFSTLFHS
                     TGFTYGMALSLPMLFLGFYLLFQAFKDESTKNGHTQTKN"
     CDS             271728..272807
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013530006.1"
                     /locus_tag="BH623125_02210"
                     /product="ATP synthase subunit beta"
                     /protein_id="GFF01787.1"
                     /transl_table=11
                     /translation="MATLKQKIKEMIALNGPITVSQYMTLALTDPQFGYYKTQTPFGR
                     TGDFITAPEISQLFGEMIGIWALANWKAHGCPAPFILAEIGPGRGTLMDDILRTIQKL
                     SIKAFNAAEIFLIEISKKLAKEQKKRLAPYQKEIYSIENFDQLPLKPLLLIANEFLDT
                     LPINQYIKINGEWRERRITVNQNGDFVFIAAPGKFSFPFLQFCDSEIPDGKIFEHAPS
                     RHQFMQQISNRLIQVKGSALLIDYGASNLAFGDTLQALSKHRFRDIFDAPGEHDLTTH
                     VGFSFLKKIALEQGCFAKILEQGDFLVKMGLLERAKQLAADKNAALQDKIHQDIERLA
                     GPDQMGKLFKVLHVSNQNIPLPPEI"
     CDS             272885..273655
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A9CI60"
                     /locus_tag="BH623125_02220"
                     /product="laccase domain protein"
                     /protein_id="GFF01788.1"
                     /transl_table=11
                     /translation="MNSVHPILAKNLSALHTHGIKHGFFTRQDNVSKSLNVGQSPNNQ
                     PEYIAQNHIFIADYFGVKVQNLVTVNQIHSCEVVVVDQAFIDEPPKADALVTTTPGLV
                     IGILTADCGPVLFSDPQAGVIAATHAGWRGSLKGIIAKTIAAMEEQGAKRHSITAALG
                     PCIGPCHYEVTDEFYNQFIDCNNEFQKYFLKTEKINHFHFNLWAFIMNQLKEAGINAF
                     CVELCTYQDEQRFFSYRRAIHRNEPDYGRQFSAIALNK"
     CDS             274112..275044
                     /codon_start=1
                     /gene="prsA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:C3MFJ9"
                     /locus_tag="BH623125_02230"
                     /product="ribose-phosphate pyrophosphokinase"
                     /protein_id="GFF01789.1"
                     /transl_table=11
                     /translation="MKLFCGNSNPRLAKEVTNYLSIPLGKATVKRFADQEIFVELHEN
                     VRGQDVFVLQSTSYPANDHLMELLIMIDALRRSSARRITAVIPYFGYARQDRKPGPRT
                     PISAKLVANLITEAGAHRVLTLDLHAGQIQGFFDIPTDNLYAVPVIARDVKMHYSLEN
                     VIVVSPDVGGVVRARSLAKRLNSLLAIVDKRRERPGESEVMNIIGDVSGKNCLLLDDI
                     VDSGGTLCNAASTLLKHGANSVTAYITHGVLSGNAIERITNSEMKELVITNSIMPTEE
                     IEKAHNIRVLPITDLIGEAIARTAAEQSVSSLFG"
     CDS             complement(275041..276612)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010969467.1"
                     /locus_tag="BH623125_02240"
                     /product="ATP-binding protein"
                     /protein_id="GFF01790.1"
                     /transl_table=11
                     /translation="MLQAWSRWTINQYEPDSKSNSGDVMKVEIALGEMAEGNALRKSM
                     PAFVDLEELLATRLLVQGNSGSGKSHLLRRLLEQSSSWVQHCVIDPEGDFVTLADKFG
                     HVIVEAQRSEQELMRIAYRIRQHRVSVVLNLEGLDTEQQMRAVGTFLGALFDVERDYW
                     YPMLVVVDEAQLFAPAVAGEVSDEARKISLSAMTNLMCRGRKRGLAGVIATQRLAKLA
                     KNVAAEASNFLIGRTFLDIDMVRAADLLGMERRQAEMFRDLERGHFVALGPALSRRSL
                     RIIIGSVETLARSSSPKLMPLPKERVDVKELVFTASQEEILIPFKQSREPVKEKSIHA
                     ILEKAVNKKRELLAENSSLFPELSVVDRDLQAECIIREILEDPEAFYRSTAVLYQDFL
                     VRCRIHGLSGDFLNLSQFRRKLAIAQACVDKETAVSENWKRILYISESLEDDVQGVFL
                     NVAQAALGGKPCPSDAFLARLYGTHSLSRARRLLTYFEERGLIVIHTHFSGQRIIAFP
                     DLGVETAPGDPKEPI"
     CDS             276823..277443
                     /codon_start=1
                     /gene="rplY"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TI50"
                     /locus_tag="BH623125_02250"
                     /product="50S ribosomal protein L25"
                     /protein_id="GFF01791.1"
                     /transl_table=11
                     /translation="MSKSYTLKAEIRERVGKGSSRELRRNGLIPAVIYGDKQPPLAIA
                     VSYKDIFYKIHAGGFRTTVATLAIDKQKIMVLPKDYQLDPVRDFPLHVDFLRISAKSI
                     VEVNIPVHFLNEDSAPGLKKGGVLNIVRHEIECTAPANAIPEAIEIDLSSYSIGDSIH
                     ISAVQLPKDVNPVIQDRDFTIATIVAPADMDVSDEVSEQENNEESE"
     CDS             277523..278104
                     /codon_start=1
                     /gene="pth"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:C3MFM4"
                     /locus_tag="BH623125_02260"
                     /product="peptidyl-tRNA hydrolase"
                     /protein_id="GFF01792.1"
                     /transl_table=11
                     /translation="MWLIAGLGNPGLQYQNNRHNIGFMAIDAIYQSFSFSPWSKKFQA
                     EISTGLINGKKTFLLKPQTFMNLSGQAIGEALRFYKLDLKNFIVIYDELDLPPGRVRV
                     KIGGGNNGHNGIKSIDAHCGTDYCRIRLGIGRPNSKELVYQHVLGNFTKSDQEWLPSL
                     LEAIAKNIALLIKGNKCLFMNEISQAMKNKNLQ"
     CDS             complement(279207..279956)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_02270"
                     /product="hypothetical protein"
                     /protein_id="GFF01793.1"
                     /transl_table=11
                     /translation="MLSRRAFLIAAPLALVGCATRHSDMSFVSSQQVLYIPEEIRALY
                     GPVTNEPYFLPAVDLSTIDPKFWRQQVIYYTSYPPGTLVIDTQECFLYLIGENGRALR
                     YGIGVGKEGLAFEGEGVVQRKRRWPNWAPTAAMMAREPERYGHLGRGMPPGPDNPLGA
                     RALYLFKNGQDTLFRIHGSHESWSIGHAISSGCIRLLNQDIIDLYDRVPIGSRVVVLQ
                     NSESRPSILNQQSKTYDPLQSTINPSESELF"
     CDS             280223..281326
                     /codon_start=1
                     /gene="ychF"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TI48"
                     /locus_tag="BH623125_02280"
                     /product="ribosome-binding ATPase YchF"
                     /protein_id="GFF01794.1"
                     /transl_table=11
                     /translation="MGFKCGIVGLPNVGKSTLFNALTKTATAQAANYPFCTIEPNTGE
                     VAVPDLRMEKIASIAGSKEIIPTRINFVDIAGLVRGASKGEGLGNKFLANIREVDAII
                     HVLRCFQDDDITHVEGRIDPVSDATTVETELMLADLESLERRIVQIRKRATGKDKEAL
                     TILPVMESALNLLHKGSPVRLLLEEISSDERRILDSLNLLTSKPVLYVCNVSENDAAH
                     GNSFTQTIEKMATEQNAQSILISASIEAEITQLNDAEAIEYLNALELFEPSLNRLIRA
                     GYHLLNLITYFTCGPKETRAWTITRGTKAPQAAGVIHSDFERGFIRAQTISYEDYIAL
                     GGENGAKEAGKARDEGKEYIVQDGDIMLFKHNT"
     CDS             complement(282023..282463)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010967278.1"
                     /locus_tag="BH623125_02290"
                     /product="photosystem reaction center subunit H"
                     /protein_id="GFF01795.1"
                     /transl_table=11
                     /translation="MKKIIFTALMTVLMASSAYAQSFVEHSKTEMVSSMGIVHMGSDM
                     LARYVTPLETDFVASSLIGSSVYNIENENIGEVKDIILRENNITGFVIAIGGFLGIGE
                     SYVVVAPETVQMTNDYGKWKLIMNATKDSLKEAPTFKYEGHWPR"
     CDS             complement(282605..282796)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_02300"
                     /product="hypothetical protein"
                     /protein_id="GFF01796.1"
                     /transl_table=11
                     /translation="MSDGLVSCEDGTSETVEHYVRDVAAFLMWVADPHMEIYKKTSFR
                     VILFLIIFVELVCVLKVRG"
     CDS             284864..285340
                     /codon_start=1
                     /gene="trmL"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TI32"
                     /locus_tag="BH623125_02310"
                     /product="tRNA (cytidine(34)-2'-O)-methyltransferase"
                     /protein_id="GFF01797.1"
                     /transl_table=11
                     /translation="MTLHIALFQPDIAGNTGTILRLSACFGLHVHIIEPAGFNLSDRN
                     LKRAGMDYLEYASLERHIDWPHFIHTMKQFNRRLLLLSTKAETCYTQICYQENDVLLF
                     GRESAGVPNYVYEAVNETLKIPMQPYARSLNLAMSVAITTGEALRQIGYYKKRKTL"
     CDS             complement(285545..286798)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013529971.1"
                     /locus_tag="BH623125_02320"
                     /product="cytidine(C)-cytidine(C)-adenosine (A)]-adding
                     enzyme"
                     /protein_id="GFF01798.1"
                     /transl_table=11
                     /translation="MSIRQDFKQVDWLQHSHIQKLLHVLSLDGEEARIVGGAVRNQLL
                     EQPISDVDIATTCLPQQIIVRVEEAGFKAIPTGIAFGTVTVVSQSCSYEVTTLRSDIE
                     TDGRHAKVAFGRDWQKDAERRDFTMNALYCDAAGNLYDAVGGLDDIASRTVRFIGIAE
                     KRIREDYLRILRFFRFFAWYGAGRPDVQGLKACVCLKHGLQKLSSERIWGEMKKLLTA
                     PNPIRALLWMRQSGILTLIFPETEKWGIDAIHSLVKTEQDLGWKVDPLLRLESLLPPD
                     PVRLYEMAHRLPLSHKEKTRLKEWAELEIICQNCSDHFLQKLIYFHGRQPVLDQLSLS
                     LAAAHVDVLKGNEALQKVEDYMRLYQFAQKWQIPTFPISGKDLMKKGFSKGVLLGQKL
                     KELETLWIESGFLIDRNSLLEKINL"
     CDS             287055..288086
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012708852.1"
                     /locus_tag="BH623125_02330"
                     /product="ATPase AAA"
                     /protein_id="GFF01799.1"
                     /transl_table=11
                     /translation="MNQSDVLSNSMKQATINNEAHVIIDDIDTAHKELDILQQEVDKV
                     IFGQNHVIEYALTSILAGGHALLVGVPGLAKTRLVETLGIVLGLDEKRIQFTPDLMPS
                     DIIGSEIMDSDKSGKRSFRYLQGPIFTQLLMADEINRASPRTQSALLQAMQEYHVTVA
                     GTRYDLPQPFHVLATQNPLEQEGTYPLPEAQLDRFLMQIDIDYPDLTTERRIILDTTG
                     GKNQNAKPVLSAKTLQKIQKIVRKMPISENVVEAILKLVRSARPHKENSLANTYVAWG
                     PGPRASQALSLCARARALYHGRLSPSLDDIATLACPVLQHRMALNFSARAENITIKDI
                     IDNLVKDAL"
     CDS             288086..288997
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010972177.1"
                     /locus_tag="BH623125_02340"
                     /product="hypothetical protein"
                     /protein_id="GFF01800.1"
                     /transl_table=11
                     /translation="MAIGKKVSKKTPLLLAADSHKNAAKMPCFLLQAHRIANTVIAGW
                     HGQRKRGNGENFWQFRPYVEGESITRIDWRRSARDEHTYLREHEWEKTQTVWIWPDQS
                     ASMHYCSCFSQTSKDNYAIILALTLATLLARSGENIAIPTLMPPTMAPNVVERMALAL
                     VNRHTENPFPDFSTITRFSHVIIMSDFLDSPEKIIQNLTVLSAKQITVHLIEVADPAE
                     EHFPYAGHTEFFDPETKEKRILGKAENSREHYCKLYQARRQELTNFCTRQGWTYHVSK
                     TDRPLTEVILRLANKIGISPSHNRRSL"
     CDS             288994..291798
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013529966.1"
                     /locus_tag="BH623125_02350"
                     /product="RNA-binding protein"
                     /protein_id="GFF01801.1"
                     /transl_table=11
                     /translation="MSFAAPLLLLGLLSLPIIWWLLRITPPTPRKELFPPLRFLPKSN
                     NQQEAAHRTPWWLSLLRLTIAALIIIALAKPTWNQKPIVLSGSQPLALIIDNGWASTR
                     EWKKRITIAEDLLTQAEKQQKNVYFLATAESDIFNIGPLPAKVVKQHLMHLQPQPWPI
                     NRVRALKKLLETTKDKPLDIAYLSDGLKTNEDDQAFALIEQLKPKTLLWYLADISDLT
                     GITAIENNNGLLAARIIRATTHGKKVVVLNLYDLNNKLLGRFTTNFNAGETTAFVPFN
                     LPLELRNDIAWIKIENHAHAAATFLVDSHNRINRVALLSPSVNEMTQPLLSPFYYIIK
                     ALQGHAQIITAGGKELSVDIDHLLKQNPSVFIMGDIVNMSEEAEKKLSDFINKGGAFI
                     RFAGENLSATEHHDSLLPVPLRPGKRLLGSIMSWAKPQKLAPFTKNSFFFDLPFPKDV
                     TVSRQILAEPSSDLFEKTWLSLADGTPLITAASRGKGTVIFIHIAPDPTWSNLPLSGF
                     FAQMLQKLVTLSAYENKNSTQRKTTTVQNPWKTLTADGKLQSPPSDVVPLVIDAQNPI
                     LASSHNPPGFYGFKNNLYALNLLNSSSRLMKQSSLPSSLSKNPLSYDTKEKHLTGLLL
                     GLAILLFALDHFLILWMGGVFFLNQRRNMFLFLPLAISLIVLFSDSPMLYAQGTENHD
                     ETAVQAAGATHLAYIITNNSEIDATSKSGLEALSQFIAERTMLSPGSVTAINLEKDEL
                     AFYPLIYWPIDSHSSLPTQKSLEKINSFMKHGGTVLFDTRDQIQTDLSLEGAATPATQ
                     KLRAILKRLNIPAIEPASADHVIARSFYIMPDFPGLYRGSPLWIESSSINKKNNNPLG
                     FGDNVSSLLITANNFAGAWALDEKGMWKYPLIPNDPVQRLWAFRAGLNIVIYVLTGNY
                     KADQVHVPALLERFNKERRQ"
     CDS             291795..293891
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013529965.1"
                     /locus_tag="BH623125_02360"
                     /product="membrane protein"
                     /protein_id="GFF01802.1"
                     /transl_table=11
                     /translation="MIPFFTFQPFLPLSWIFLLGGISALFVVIGLMTKHQGSVLRLMT
                     LTSLIVVLLNPMMIKEQREPLKSTVGIVIDRSKSQTFGTRTNDSDEARAQLTNALAHY
                     PQFEPRFIDAGKLSDNQYAPSTNLFHALTQAISDIPPSRYAGTIFITDGQVHDIPDIS
                     DLHHNAPLNALITGKSDEFDRQIKFISLPRFVLINKPQKLSILVEDKGQPQKYLPKQA
                     NITVSVNGQEVGHYSVTPGIIFETEITLPHAEKNIIQVATDTHKGELSFENNRAIATI
                     EGIRENLRVLLISGAPYNGERTWRNLLKGDSNIDLVHFTILRPPNKADNTPLSQLSLV
                     VFPTRKLFVEEIDNFDLIILDGYQHSTVLPLIYYDYIAQYVQKGGALLMVTGPEFTQK
                     NSLAKTPLISILPALPNGVIIQKPFRPTLTKEGERHPVTRGLATSTHPASQWGQWLRQ
                     IAIENTHKGISLMKGADEQPLLLLSHEGKGRVGMLLSDESWLWARGFEGGGPYAALYR
                     RIAHWLMKEPELEEEKLSVTNDHHRLTIRRQTLKDHPEPAEITFPSGKKENIILTKEQ
                     EGVFIAAINTDETGIFTIQNGDLTVLSSVGMLDNLELFDLISTEEKLAPIIKHTGGHI
                     MRLHQGKTESINLPPLKLIRSQADPSSSFSRSIVLKEATETRLIKSFYFAIFSGFFAL
                     LACLLLLSSMWYRESR"
     CDS             complement(294901..295059)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_02370"
                     /product="hypothetical protein"
                     /protein_id="GFF01803.1"
                     /transl_table=11
                     /translation="MSFMNRLNARAFAILGVGKESNSAGLTFHKCKVKMCVHNSFYIF
                     VLYPLQLL"
     CDS             295550..296317
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003534453.1"
                     /locus_tag="BH623125_02380"
                     /product="metallophosphatase"
                     /protein_id="GFF01804.1"
                     /transl_table=11
                     /translation="MATNTLETLIEALKKKNPDHLVISGDLVNLALDKEFEQARNWLL
                     NQGQPQNISLTFGNHDAYVRGAFQKACTLFQPWITGDFPQKNAPPFPYIRIRKNVAII
                     GASSAIATPPFQASGYFGKMQAQALSQLLNEAARRNLFRVIMIHHPPFHHATSWHKKL
                     WGIERFLEVIKHHGCELILHGHTHLPTLNIIKGKMGKIPIVGVASAAQAFGDTPPPAG
                     FNFFSIEQFNQQWHCQLQRYSLINQNNEVACTETIDL"
     CDS             complement(296414..297328)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013529938.1"
                     /locus_tag="BH623125_02390"
                     /product="cadmium transporter"
                     /protein_id="GFF01805.1"
                     /transl_table=11
                     /translation="MVMDVKINIQRLTLYSIFVACIVFALKYWAYHITGSVALYSDAL
                     ESIVNILATLAAWWAVKISMKPADHDHPFGHHKAEYFSAVLEGVLIIVAAIIILREAW
                     IALSSVKLLQKPGMWLVVHLASSVINYLWGFVLIRQGKIHRSPALKADGMHFITDVFT
                     SLAILIGLVAGFVGGWGILDPILAIIVAINILLQGWKVINSAVQGLMDVGVELNETMR
                     IRELISANAHGALEVHDLLTRVAGRVTFIEFHLVVPAAMPVGEAHQICDKIEGVLQAE
                     FDNVRISIHIEPENEAKLPPGTIVVPFI"
     CDS             298093..298554
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_02400"
                     /note="frameshifted, insertion at around
                     298536,298621,298712"
                     /product="hypothetical protein"
                     /protein_id="GFF01806.1"
                     /transl_table=11
                     /translation="MHLNITTIYETDDLRLKDYRNIREKDFVGRQHKFIAEGKVILST
                     LLHSKEFPTLSLFMVRERLPGVMPLLEATQPTCPIYQVPQKIMDDIAGFHVHRGILGI
                     GERKTPPSLEKFLHDFPKEALILVLCSISNHDNMGAIFRNAAAFVSQWHYR"
     CDS             298672..298914
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_02410"
                     /note="frameshifted, insertion at around
                     298536,298621,298712"
                     /product="hypothetical protein"
                     /protein_id="GFF01807.1"
                     /transl_table=11
                     /translation="MMQIFIFMPFPLLPHSTLKQAKITKRIALILGTEGDGLSTDILE
                     KSDALRIPMVDGFDSLNVATASGIALTHFSDLDKLC"
     CDS             complement(298963..300192)
                     /codon_start=1
                     /gene="mnmA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TH16"
                     /locus_tag="BH623125_02420"
                     /product="tRNA-specific 2-thiouridylase MnmA"
                     /protein_id="GFF01808.1"
                     /transl_table=11
                     /translation="MFLNSLDLPGQPENSRIVVAMSGGVDSSVVAGLLKKEGYDVIGI
                     TLQLYDHGAATHRVGACCAGQDIEDARCVAETLGIPHYVLDYEERFREAVIDPFAASY
                     AHGETPVPCIACNQTVKFADLLATARELDADALATGHYIRSRSHGAHRALFRPLDSDR
                     DQSYFLFATTQEQIDYLRFPLGDLPKARVREMATEMGFVVANKHDSQDICFVPQGKYS
                     DIITKLRPEAVNPGVIVHVDGQVLGKHSGIVHYTVGQRRGIGVATGEALYVVYLDVEN
                     ARVIVGPREMLETHKLFLRDVNWLGDERLDNFPPDGIEMAVKVRSTRPPHLARLHYQE
                     GVFSVDFLECENSVAPGQACVFYDGNSDGARVLGGGFVTHSERAAETEMMLKRVLCNL
                     ETTSAVASEFKTKVSYT"
     CDS             300561..300836
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_004430042.1"
                     /locus_tag="BH623125_02430"
                     /product="hypothetical protein"
                     /protein_id="GFF01809.1"
                     /transl_table=11
                     /translation="MTNLIKTQMKYVIGPDGSPLTIADLPPKTTRRWVIRRKAEVVAA
                     VRGGLLSLDEACQRYTLTVEEFLSWQSLIDEHGLAGLRITRIQHYRH"
     CDS             complement(301025..301411)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003527555.1"
                     /locus_tag="BH623125_02440"
                     /product="hypothetical protein"
                     /protein_id="GFF01810.1"
                     /transl_table=11
                     /translation="MKPRESMVRLKMFQVRGKRREIAQLEMMIAEFERMVLELEAQIV
                     HEECKSGNSDVHHFAYSALARAARQRRDNLINSIRDLQLQKTNAEIALHEVTTELQRA
                     QLLEARENGGVAGEKDIFMQSRSMTG"
     CDS             301950..302684
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_006203583.1"
                     /locus_tag="BH623125_02450"
                     /product="DNA-binding response regulator"
                     /protein_id="GFF01811.1"
                     /transl_table=11
                     /translation="MIREEQSEGSKMRVLLIEDDKAMTQSIELMLKSANFNVYITDLG
                     EEGVDLGKLYDYDIILLDLNLPDMSGYDVLRTLRLAKIKTPVLILSGMNAIEDKVRGF
                     GFGADDYMTKPFHKDELIARIHAVVRRSKGHAQSVIVTGDLIVNLDAKTVEVAGHPVH
                     LTGKEYQMLELLSLRKGTTLTKEMFLNHLYGGMDEPELKIIDVFICKLRKKLEAVSSN
                     INYIDTVWGRGYVLRDPVEENVRKTA"
     CDS             complement(303317..303955)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013529909.1"
                     /locus_tag="BH623125_02460"
                     /product="histidine phosphotransferase"
                     /protein_id="GFF01812.1"
                     /transl_table=11
                     /translation="MTLAVSLESTDLAALLCSRICHDLISPVGAIQNAMELYDEGGAE
                     EDALQLVRWSVASASARLQFARLAFGFAGTSRGQIDTRSVEQVAQQYMKEEKATLKWQ
                     IPALLLPKNEVKLLLNLLLIANATVSRGGEIVVMIVQGENQHSFRFEICGKTLRIPSH
                     FIALYNGEIQEEFIDAHVIQFYYTMLLAQMTGMKININETDSCVILESTKRL"
     CDS             304173..304763
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013529910.1"
                     /locus_tag="BH623125_02470"
                     /product="hypothetical protein"
                     /protein_id="GFF01813.1"
                     /transl_table=11
                     /translation="MAFSLLTRCYKNIVSAMFLLFITINTVYAQSIEQKEPHYSLQEI
                     IDSGHIFFGKTTSGIAVAIQNIFSQYGYPNAYILGEEASGAFFAGLTYGEGKLFTKIY
                     GQHKVFWQGPSVGWDFGGQGSRLMILVYDLNNVNNLWGRYGGISGSAYLIAGVGFHVL
                     KRQNVLLVPIRTGIGARLGINIGYLKLTPKPTWNPF"
     CDS             304791..305471
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_02480"
                     /product="hypothetical protein"
                     /protein_id="GFF01814.1"
                     /transl_table=11
                     /translation="MFIQSLLFFILGVAATSWLLILLSPLIWRRALHFAHKVVSAQIP
                     LSLNEIQANYDFLCAQHAVELAQNEQKYESLQKKYAQQKIQLSQVIEQLYQLHFPTQD
                     TSYSSHEKETIAIKNENSALTKNTFLMEIKTMREKIAYYQQLLQEIQIDNDATCHHKL
                     LDKLREETKELAATLAAQIALQEREDSPINTLIQNSKSKDDLASRIRKKITSKKTHPL
                     HELSFKND"
     CDS             complement(305716..306834)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013532708.1"
                     /locus_tag="BH623125_02490"
                     /product="aminotransferase DegT"
                     /protein_id="GFF01815.1"
                     /transl_table=11
                     /translation="MQFIDLGAQRARIEDKVNAAIAHVVASGQYILGPKVTEFEEQLA
                     DYLGVKHVIACANGTDALKMPLMAKNIGPGDAVFCPSFTFSATAEVVALVGAEPVFVD
                     VVSDTFNIDVDKLCEAIEMIKKEGRLKPKAIIAVDLFGLPADYAQIAQVAAKENLFVI
                     EDAAQSMGGRSGSIMCGAFGDVAATSFYPAKPLGCYGDGGAMMTSDDDLAALLRSILF
                     HGKGETQYDNVRIGLNSRLDTIQAAILLEKFVIFEEEMEKRVAIAQYYANNLRDIVTV
                     PEVAEDARCAYAQYTLKVKNRDRLQDYLQKNSIPTMVYYKTPLHQQPAYKHFPYVNGS
                     LSVSESLRDCVLSLPMHPYLTKNDQDMIIQKIRDFYHS"
     CDS             complement(306884..307840)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013529902.1"
                     /locus_tag="BH623125_02500"
                     /product="oxidoreductase"
                     /protein_id="GFF01816.1"
                     /transl_table=11
                     /translation="MVPRIAVLGCGHWGGNHIRTLQSLRALAAVSDVDSDRAASFASL
                     YGVDAVAPDDLFTRRDIDALVLALPPQFHTENVLRAVKNGKDVLVEKPIALDVVDAEC
                     QVQAAREYGRILMVGHILRFHPAFEKISELVENGELGDVCYIYSHRLGFGKFHTQSDA
                     LWDLAPHDLSMILALTGCEPSEVRGEGAAVIDQCSDFAHIHMAFPNGIRSHLFASRLS
                     PYRERRLMVVGTKAMLVFDDMEPWSRKVAFHPFAVWKENQEWAFSTDELSYINIYEDL
                     PLTCELKHFLHCIETRQSPRTNGDDALAILRILTAAGVNYQK"
     tRNA            308006..308082
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="BH623125_t00090"
                     /product="tRNA-Met"
     CDS             308604..308864
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_02510"
                     /product="hypothetical protein"
                     /protein_id="GFF01817.1"
                     /transl_table=11
                     /translation="MRTTAVAIVFFGTHLNAHAKVLKVSDGNRKKISNKNYDNLLATK
                     GGKIIGKHLRLGSIAAPEGESYFATIIMTKKPTVLLNYWKIP"
     CDS             308861..309022
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_02520"
                     /product="hypothetical protein"
                     /protein_id="GFF01818.1"
                     /transl_table=11
                     /translation="MIGAPIGTEPFYGYGIMVSNGGTFKMTGGSINVYSNAVSLSGND
                     SDENKLKMS"
     CDS             309480..309704
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_02530"
                     /product="hypothetical protein"
                     /protein_id="GFF01819.1"
                     /transl_table=11
                     /translation="MLVKNGIGINTNQSIGKVNLKNSKILADTLFKNAMQKTEPDGTF
                     ILTTDHSILQGGVRNDENGRTSFDLKNNTI"
     CDS             309708..310223
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_02540"
                     /product="hypothetical protein"
                     /protein_id="GFF01820.1"
                     /transl_table=11
                     /translation="MKINKQEKDDDGNLLDIAQRAHSEVSVLNLNNSSIIFDSPTEDH
                     YQTLHIGSGKPNTTAVYNASGDAKIYFNTAWNDDKPIANQKTDCLLIHGDLKGSTTVY
                     IKSDFRDKNSVVNTSDPLNTRGISLIQVSGKAEEDSFKLVNDYTTINGSPDKYMATCL
                     WTRIKPWQSQY"
     CDS             310135..310623
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_02550"
                     /product="hypothetical protein"
                     /protein_id="GFF01821.1"
                     /transl_table=11
                     /translation="MIIPQSMDHLISIWLHAYGPESSHGKANIEQNLFDNNDENFWNF
                     SLQPEFLNSNPNSGSNPGPNPSPGLHVHAIALQMASYFVMPNALFYTGLTDMAKQNVL
                     LANRRISLLEKEQEKQSGFFLYTPMEVQETSPLKVLLVNMVIAVLIFTTLLSKEVLTS
                     QR"
     CDS             310695..311006
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_02560"
                     /product="hypothetical protein"
                     /protein_id="GFF01822.1"
                     /transl_table=11
                     /translation="MQDVSKNTVDKWSLTAYGSMQDDRGFYLDTLLFYGILKGDINNA
                     IIGKTAKVKNAKIWSISTTISKQFATGMEKVTFEPQAQLAYQHLICLTLLQMLMALKL
                     I"
     CDS             310961..311320
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_02570"
                     /product="hypothetical protein"
                     /protein_id="GFF01823.1"
                     /transl_table=11
                     /translation="MFDTFADADGFKVDMNNPHQWMIRVGGRLTKTVTTTENGRSFSF
                     YGKVNATKTFGEDQTIHIDKDYKLDPMGSFLEGELGISAQLSPDISLHGDVNYQQKLQ
                     KTGISGASFSGGIRYQF"
     CDS             complement(312193..312975)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013385768.1"
                     /locus_tag="BH623125_02580"
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="GFF01824.1"
                     /transl_table=11
                     /translation="MTNCDNILDISNLSVTFGHKHKAVTVVKNVNFHIKRGEAYGLIG
                     ESGCGKSTILNTLVGLIPDYSGRLIFDGKEVAKKRDKGFLRRIQMVFQDPYASLHPRK
                     MVHTVLSESLKIHGMDNPKERVCDALNSVGLNSSFLYRYPHELSGGQRQRIALARALI
                     IEPEVLLLDEPTSALDVSVQAEILNLLKSLREERKLTYLMVSHDLAVVAHICERVGIM
                     HKGIILEELSNDDLRNLHAENDYTKMFFEASIEPIAHREKRV"
     CDS             complement(312972..313847)
                     /codon_start=1
                     /gene="oppD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013385767.1"
                     /locus_tag="BH623125_02590"
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="GFF01825.1"
                     /transl_table=11
                     /translation="MDKKLLEIEDLRVSFPTTRGVLEAVRGVSFSVGKEKIGIVGESG
                     SGKSMTGRAILKLSPRAAIVKAKKMRFDDVDLLSASESRMQTIRGKRISMILQDPKYS
                     LNPLVRIGDQIMEAYCIHHRVSKVEAREKTISMLESVHIRDPEHVMRLFPHEISGGMG
                     QRVMIAMMLIPEPDLIIADEPTSALDVTVRCQVLSVLDELVTKSGTGLIFISHDLNMI
                     ADFCDRVLVMYAGRVLEELPARDLSCACHPYTKALLASLPRLDNPVDVLAVPERDPNW
                     LHNPTIVNGVEGVTS"
     CDS             complement(313840..314772)
                     /codon_start=1
                     /gene="dppC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013385766.1"
                     /locus_tag="BH623125_02600"
                     /product="cytochrome c550"
                     /protein_id="GFF01826.1"
                     /transl_table=11
                     /translation="MTTSMNHHKPQSSFSLSYWLYEAVPRSIVQANIQKIYHSVIKFF
                     HNFSAVFGLIIIFVIILCAVFAPWIATHDFMSNDLAHRLQPPSMLHYFGTDELGRDIF
                     SRLVFGARITLYIVFLTTIIVGPIGLIVGTLSGYIGGWVDTLLMRMVDIFLAFPALIL
                     ALAFAAALGPGIENASIAISIAAWPPIARLARAETLTIRSSDYISAIRLQGASPWRII
                     FFHVMPMCIPSVVVRLTLDMSGIILTAAGLGFLGLGAQLPSPEWGAMLSTGREFMMTS
                     WWLAAMPGCAILFASLAFNLLGDGLRDILDPRNG"
     CDS             complement(314775..315848)
                     /codon_start=1
                     /gene="dppB2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013385765.1"
                     /locus_tag="BH623125_02610"
                     /product="ABC transporter permease"
                     /protein_id="GFF01827.1"
                     /transl_table=11
                     /translation="MILSFPEASGEMSLRQKNLHVWAFFFKAFKLLASVFITLLGLVT
                     ITFFIGHLLPLDPVLAILGDNISQEAYDAMFYKLGLDKPLIVQYWNYLHNIALFDFGD
                     ALTSGRPVLTDIMRVFPATLELATVAIVIGTSFGIPFGVFAAMYRDSFIDYFVRVFTL
                     LSYSTPTFWLGLMALLVFYAKLGWIGGPGRLDFLYEYSFEQRTGFFLWDTAMQGQWEA
                     FGNVFSHIIMPALILAFGAMAYISRMTRGFMIEQLNQEYIITARVKGLSWMRTVWFHA
                     FRNAAVQIITVVGLSYAFLLEGAVLTETVFAWPGFGRYLTNALLAGDMNAVVGCTLLV
                     GGLFVAINLFSDLLYRIFDPRTR"
     CDS             complement(315943..317580)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_014538185.1"
                     /locus_tag="BH623125_02620"
                     /product="peptide ABC transporter substrate-binding
                     protein"
                     /protein_id="GFF01828.1"
                     /transl_table=11
                     /translation="MRKKGMLKNFCILLGAIGCLNIFIPIALGASSKDRLVMAWNIDS
                     ISSFDPAQSVEVVTSELLTNICSALVQYDRNDPTKVRPAMAQSWNVFDGGTRIVFHLR
                     HDLKFNDGRKATAQDLAWSMQRIVKLGLGYAQSLINYGFTKDNVETNIQALDDKTLQL
                     KLDKPYPIQLVLTVIGQSYASALLDRQTLEAKSVDGDMGNEYLATHSACVGPYKLERW
                     IPGEKVVLQASQYYWGDDVPKTKQIVVQHVAESASQRLLLEKGDVDIARDLSSEDILD
                     IEKKGGPVKISRVLRPQSIYLSLNNKNAIFANEKVRLALRYLVDYESLGKTVLKGVAI
                     PRASYMPLGIPGALDEKEGLPFKLDLEKAKQLISEAGYPNGFKANLLVGSLTYMSSVA
                     QSIQENARKVGIEFTIEKMAQTQLLSRVRGGNYDTAIMGWGSADPDGHPASLNHVFNP
                     DPTFTKKHNMYLAWRAGYYDENVNKMVMDTLFEQDQNKRITQYRALQRYMLEHGPMVY
                     LFQTYYTVGMGPAVKKWVWNSFRLYYNDAEKYAQSYK"
     CDS             complement(317981..319525)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_014538185.1"
                     /locus_tag="BH623125_02630"
                     /product="peptide ABC transporter substrate-binding
                     protein"
                     /protein_id="GFF01829.1"
                     /transl_table=11
                     /translation="MNLKKKILKSSSSFISALVAMGVFVQEVQAKTPANTLVMAWNID
                     AVDTFDPAKMIPSLATHWDVSGGDHNTMITFHLRDGLKFNDGRPADAHDLVWGMRRIV
                     KLKMANAAIFNEYGITEQNVDDALQAPDKKTVVMKFDKPYPVELILNNIVASRATALL
                     DRETIMKHEKNGDMGNQYLANHAACVGPYQLKSWRPGEAILLRASSHYWGKAPKLKQV
                     LIRHVAEPGTQRLLLQKHDIDVARNLTPEDLADLQAKTDVKIEKVLEPSMMYWGFNMT
                     NPIFSNEKVRLAMRYLIDYEELGKSLLKGVGVPRASFIPIGNLGALDEKEGQPFKLDL
                     QKAKQLLTEAGYPNGFEVNFLVGSSPYALSIAQSLQDNAEKVGVHLKIERLAGTQLFS
                     KLYARAFDTIFVGWNNDSADPHTMASRLIYNPDNRFEAKNTAYPSWQYGYFDQSMNQK
                     VESALFQKDSKKRAQIYADLQRELMQKGPYAFIFQKYNVVAMTSGIKKWVWNSSPRIF
                     YSEIEK"
     CDS             complement(320906..321532)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012706979.1"
                     /locus_tag="BH623125_02640"
                     /product="DNA-3-methyladenine glycosylase I"
                     /protein_id="GFF01830.1"
                     /transl_table=11
                     /translation="MIKERSFDTVNIPLAEGLLMGTDGKVRCSWAGTDPLYCAYHDNE
                     WGKPVFEDRRLFEKICLEGFQAGLSWFTILKKISSFRDAFDHFDFEKITRYDEVKVQI
                     LMQNKDIVRHQGKIRSVLNNALRAQELITEWGSLSQYFWSFQPPQSERYEAVDFQTFL
                     ANPITPASLRLSKDLKKRGWTFVGPTICYAFMQSVGIVNDHLEGCFCR"
     CDS             complement(321510..322949)
                     /codon_start=1
                     /gene="xseA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TN96"
                     /locus_tag="BH623125_02650"
                     /product="exodeoxyribonuclease 7 large subunit"
                     /protein_id="GFF01831.1"
                     /transl_table=11
                     /translation="MKKMMNLFFEKTGATNVAEFSVSEIAGALKRVVEEKFGYVRVRG
                     EISGYRGAHASGHAYFALKDDKARLEAVIWRGIMEKLKFPPEEGMEVIAVGKLTTYPG
                     SSKYQIVIEALEPTGVGALMTLLENRKKKFAEEGLFDEEKKKPLPYMPKIIGVVTSPT
                     GAVIRDIIHRISDRFPLHILVWPVRVQGETSGREVAAAVKGFNVLPLEGLIPKPDLLI
                     VARGGGSLEDLWGFNDEVVVRAVYESSLPVISAVGHETDWTLIDYVADWRAPTPTAAA
                     EKAVPVKIDLEVYVVSLGARLRTGLARYFDFHQQKLRAIIRALPTADQLFALPRRGFD
                     EISSRLERALCVSCDKKRLYFHTLAIRFTPRLLNTEKAQHSAKEYTARLHRAFVHIVE
                     KQRAQLEIAFRLLKSTSYQNILERGFVLALGQNNKPIKRLAQIPEKEQINLRFFDGEI
                     SVITQESFFNRSSKSKRIKSKQDDQGTLF"
     CDS             complement(323188..324819)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_014538185.1"
                     /locus_tag="BH623125_02660"
                     /product="peptide ABC transporter substrate-binding
                     protein"
                     /protein_id="GFF01832.1"
                     /transl_table=11
                     /translation="MNLKRKILKGRKSFVSAIIAMGMFVQQVSAKTPADTLVMALNLD
                     SIETFDPAQINERYGNEVITNICDNLIDSATDDPAKIVPSLAKSWDVSNDGQGTVITF
                     HLRDGLKFNDGRPADAHDLVWGMKRVVKLKLSAAAIFNEYGITEQNIDSTLQAPDEKT
                     VVMKFDKLYPAEIILGHIVTGRVAALLDRETIMKHEQDGDMGNRYLASHAACVGPYQL
                     SSWRSGEAIFLRASSNYWGAAPKLKKILIRHVAEPGTQRLLLQKHDIDVARNLMPEDI
                     ADLQATTDIKIEKRLTPSVIMWGFNTTNPIFANEKVRLAMRYLIDYEGLGKTLLKDVG
                     IPRASFIPIGNLGALDEKEGQPFKLDLQKAKQLLTEAGYPNGFEANIFAGKSPYPFAL
                     PMAQSIQDNAKKIGVHFKIENFVGTQLFSKLYARSFDTIFMGWNNDSADPYTMASRLI
                     YNPDNRFEAKNTGYPSWCHGYFDQNMNQKVEDALFEKDSQKRAQIYADLQREFMQKGP
                     YAFIYQTYNIIAMTTDVKKWVWNSAPRIFYSAIEK"
     CDS             325736..325858
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_02670"
                     /product="hypothetical protein"
                     /protein_id="GFF01833.1"
                     /transl_table=11
                     /translation="MKILRKMPTEHERVSETSTDVTPVLQGGKLERKVKKKENK"
     CDS             325948..326211
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_02680"
                     /product="hypothetical protein"
                     /protein_id="GFF01834.1"
                     /transl_table=11
                     /translation="MSNSFHSFLGGTLGYVFLKLLLLSLLVGIVLKLLGWTPLGLVQK
                     IIEFFKFLWATGFTTFSNFFHMVVMGAIVVVPTFLFLRIFRKK"
     CDS             complement(326234..327043)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010968644.1"
                     /locus_tag="BH623125_02690"
                     /product="membrane protein"
                     /protein_id="GFF01835.1"
                     /transl_table=11
                     /translation="MGRLFSLCIIASCFCVVSFSTWSHVGAKAAFIEQVDHETIQIIV
                     TTNKITVDAHFDGRDLYIAGVLENIDPLYSRQNRYDIVVSLEGQTRPMVMREKKRNAG
                     VWINADSLIFKNVPLFYSMVTTREIDDITNSEGYKRLGLGLSYLLLQTDEQDQKKVQI
                     FRDELIRLQKAKNLYHEEIGGVRFGSGALFTAHFRLPANTPVGHYRVRAYLFRDGQFI
                     DSTTTTLEIVKAHIAYTIFHAAHKYSFFYGIIAVIVAVSTGLLCRFVFRKD"
     CDS             complement(327046..327966)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q7D1C4"
                     /locus_tag="BH623125_02700"
                     /product="UPF0721 transmembrane protein"
                     /protein_id="GFF01836.1"
                     /transl_table=11
                     /translation="MSIYLPIAEMSLNMLILIGMGVVAGFFSGLFGIGGGFLITPLLI
                     FYNIPPAIAVGTGANQMIASSVTGAITHFRRRTLDIKLGILLAIGGGVGSLVGIQIFS
                     VLKKLGQLDLMISFLYVLLLGSVGSLMIIESWRDMLRQRKAQKVNTRLIGRHNWIHRL
                     PLKMRFRTSMIYISIIPVLGIGLIVGLLSSVMGIGGGFFMIPALIYLLRVPTSVVIGT
                     SLFQITFVSSFTTVLQSVTNQSVDIVLAFLLMLGGSIGAQYGTRAGRKLKAEQLRLAL
                     ACLVLIVCMRLAFQLFIRPDNLFSLDIVMR"
     CDS             complement(328138..328953)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_02710"
                     /product="hypothetical protein"
                     /protein_id="GFF01837.1"
                     /transl_table=11
                     /translation="MNKKSHITKQVRDDKLSSFVVEQKEKAYTPAEVTMSDIAKKLRS
                     VHTQMQMKHSPHNVISRSFMEESFKSYLDDISRAILAEHYIRRQKEKKLFESLEKIIM
                     LVQSLQNQKKSIEKTMGTRLIDRSKSLVSVVQKLADIEGEGKQECSLLQEISNCSKQN
                     SITASQTNFENALQHENKSSLQNDALKPFSKKTGELATHSTIKKRYSDVKESGHCIEY
                     DRSLSLNMKPQRTFFFLYSSLKKIFRCFLIIAFMATIALCFYSFLRGARFFDF"
     CDS             329555..330301
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012708569.1"
                     /locus_tag="BH623125_02720"
                     /product="electron transfer flavoprotein subunit beta"
                     /protein_id="GFF01838.1"
                     /transl_table=11
                     /translation="MKIIVAVKRVVDYNIKIRVKPDSTGVDLSHVKMSMNPFDEIAVE
                     EAVRQKESGKISEVVLVSIGPEAAQETLRTGLAMGADRALLVTTQETLEPLAIAKILK
                     VIVQEEKPDMVFLGKQAIDDESNQTGQMLAALLGWGQATFASNLDIENGHAIVVREVD
                     DGTQTLSLPLPIVMTADLRLNEPRYTSLPNIMKAKRKPIEQKALSDLGLETRKRLTVL
                     SVEEPKPRQCGVKVANVAELVSALKQTNCI"
     CDS             330353..331273
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012066754.1"
                     /locus_tag="BH623125_02730"
                     /product="electron transfer flavoprotein subunit alpha"
                     /protein_id="GFF01839.1"
                     /transl_table=11
                     /translation="MAILLLAEHNTEETAKTLNAAHAISNDIDILVCGTNVQEIAENS
                     AKLTGVRQVLVAEADYLTHQLAEPVADTIIKQANDYDVFIAASNCIGKNVMPRVAALL
                     DVMQISEIIAVVASDTFKRPIYAGNAIETIRSNDNKKVITVRTASFTPASSQNNAAPI
                     KTITPALNPNLSSFVKAQTNKSNRPDLTSARIIISGGRGLGSQEQFMALLLPLANKLE
                     AALGASRAAVDAGYAPNDWQIGQTGKVVSPKLYIAVGISGAIQHLAGIRDAQVIVAIN
                     KDAEAPIMQIADYALVGDLHQILPELEKAL"
     CDS             331277..332935
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010971317.1"
                     /locus_tag="BH623125_02740"
                     /product="electron transfer flavoprotein-ubiquinone
                     oxidoreductase"
                     /protein_id="GFF01840.1"
                     /transl_table=11
                     /translation="MNAPMHQRESMEFDIVIVGAGPAGLSAAIRLKQINPELSVTIVE
                     KGTEVGAHILSGAVVDPIGIDTLLPEWRKEQNHPFKTPVTSDQFFFLKPKHATLFPNV
                     FNPKILSNNGCYIVSLGSVCRWLSKKAEALGVEIYPGFSISETIENDNGAIIGVLTGD
                     VGLNKDGTPGKNYTPGMALLAKYTLIAEGACGSIAKQLIQKFDLSKNREPQKFGLGLK
                     ELWEVDPKKHKLGLVQHFAGWPLDNNTSGGGFLYHQENNLISVGFVVHLDYKNPYLSP
                     FEEFQRFKTHPKLYEIFKGAKRLSYGARVISEGGWQSVPKLTFPGGALIGCSAGLVNV
                     PRIKGSHNAILSGILAADKIVAALAQGRAHDEVKEIEEDWRKGPIGKDLYKARNVKPL
                     WAKYGTKYGIKLAGFDMWWQQLFGFSLFKTLSHGKADYACLEPAENFQPIAYPKPDGM
                     VTFDRLSSVALSHTHHEENQPCHLKIASLEKQKNSEYAIYGGPSTRYCPAAVYEWSEY
                     KDHKTYMINASNCIHCKTCDIKDPNQNINWTCPQGNEGPLYLNM"
     CDS             complement(333160..333549)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_02750"
                     /product="hypothetical protein"
                     /protein_id="GFF01841.1"
                     /transl_table=11
                     /translation="MKSNKLKMPQYINTLYCIKILKDFADVKARGLRGFIEKESNLSH
                     EGDCRVHEYGRVFGFVRVYENAKICGNIRICVQVYGHAEIFGKVFISKHLKFYDNAKV
                     YYDTRILGFVCVYRHVKFMIMLRFLAL"
     CDS             complement(334333..335124)
                     /codon_start=1
                     /gene="proC1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012709521.1"
                     /locus_tag="BH623125_02760"
                     /product="pyrroline-5-carboxylate reductase"
                     /protein_id="GFF01842.1"
                     /transl_table=11
                     /translation="MTIGFLGTGKISASMVDGLMRSVFDVPSIILSPRNAKRAEHLSR
                     NYDKVIIAENNQALLDVCDCVFLCLPNQIAEEVLRSLRFRPEQLVVSVLAMAKAAEVE
                     EWINHKVYRAVPLPFVAECKNLTPIYPDHPFLRSLFDALGGTLVLDAEEQFNLFMTAG
                     SLMGVYFNFIETAHKWFITQGLKKQQSADFLAMMFGNLTDEMRKIMDQDCSTSLDFAL
                     LEKEFSTKGGTNELLSHCFSHQGGRSALTTALETTLQKINAPFTY"
     CDS             complement(335179..335424)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_02770"
                     /product="hypothetical protein"
                     /protein_id="GFF01843.1"
                     /transl_table=11
                     /translation="MDDYEKFATGLLIVFGALIIGGLMAMHIVLMNKPGFLFALAAAI
                     VGWFSAFAVLFDKPKVYLTLIILAMLCVASSISIYVS"
     CDS             complement(335527..335919)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TFP9"
                     /locus_tag="BH623125_02780"
                     /product="UPF0102 protein"
                     /protein_id="GFF01844.1"
                     /transl_table=11
                     /translation="MHKTMGKTTQKGHRQKSFYRGVRAEKWAAWWLRCKGFHIAEIRF
                     KTKCGEIDLIARRGNLVLIVEVKARSTLAEAMAAVSRVNERRIEAAADIWLARQKDRA
                     LLCVRFDLIAILPWRWPQHIPAFFMSNK"
     CDS             complement(335912..336799)
                     /codon_start=1
                     /gene="rsmI"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q92SN5"
                     /locus_tag="BH623125_02790"
                     /product="ribosomal RNA small subunit methyltransferase I"
                     /protein_id="GFF01845.1"
                     /transl_table=11
                     /translation="MRERAYFIGAHAYSAPIIEPALYLVATPIGNLADITLRALQVLA
                     GVDILACEDTRVTRVLLERYGIQKKTFLYHEYNAQKAGPKLLTALEENKAIALVSDAG
                     TPLISDPGFRLVEEARKAGHKIVPIPGASALLAALVATGLPTDSFFFAGFLSARKAQR
                     QKRLEQLKTIPATLVFYESPHRLVETLQDMVALFSADRPAAICRELTKKFETVDVSNL
                     GNLSESYGKQAHIRGEIVVLVGQKLSSLNVMSDHEIDEMLLELARTYSAAKAASLASK
                     KTGLKKQELFQRLNFLKDA"
     CDS             complement(337749..338843)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8T733"
                     /locus_tag="BH623125_02800"
                     /product="iron-sulfur cluster carrier protein"
                     /protein_id="GFF01846.1"
                     /transl_table=11
                     /translation="MVSITSDAIRNALHKVKGPNFESDIVSLGLLSEILVVHGKVFFS
                     ITVPDGRVQEWESLRRSVEEVVSALDGVEAVFVTLTTERRPEMSSQLQRDEVFFAPKR
                     RANRLLEKMPIEGVRHVVAVASGKGGVGKSTMAINIALALQDSGFKTGLMDADIYGPS
                     LPRLTGLVNQKPQYIDGKKLHPLEKFGLKLMSMGFLVEEENPVVWRGPMVMAAVTQLL
                     RDVLWGPLDVLVVDMPPGTGDAQLTLAQQVQLTGALIVSTPQDLALVDARKAMEMFMK
                     VNVPILGLIENMSYFIAPDTGKRYDIFGYGGTRAEARRRGVPFLAEVPLDAALRSSSD
                     DGIPIFVAKPDEEHTKLYRSIVGQIKNKFF"
     CDS             339443..339577
                     /codon_start=1
                     /gene="rpmH"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q89BQ2"
                     /locus_tag="BH623125_02810"
                     /product="50S ribosomal protein L34"
                     /protein_id="GFF01847.1"
                     /transl_table=11
                     /translation="MKRTYQPSKLVRKRRHGFRARMATASGRKVIAARRARGRKRLSA
                     "
     CDS             339742..340089
                     /codon_start=1
                     /gene="rnpA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q92SF4"
                     /locus_tag="BH623125_02820"
                     /product="ribonuclease P protein component"
                     /protein_id="GFF01848.1"
                     /transl_table=11
                     /translation="MAVRTGEKRRGPLFLLEVKSREQTAERESSLVARVGFTVTRRNG
                     NAVKRNRIKRRLREAVRVGLTDDMEAGTDYVIVAHPDALHAPFTSLVNELSRRIKPKT
                     KHQKRQQGNTNGI"
     CDS             340079..341917
                     /codon_start=1
                     /gene="yidC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TDM9"
                     /locus_tag="BH623125_02830"
                     /product="membrane protein insertase YidC"
                     /protein_id="GFF01849.1"
                     /transl_table=11
                     /translation="MEYNRNFFIAIGLSFGVLIAWHFFYVAPKQTELQQKQLIAQQLL
                     KQQSAVSSPTANFSDSASTHESALIINHPMSPEIRDAELAKTNRVAIKTNELEGSINL
                     VGAQFDDLLLKKYRLTVDKKSSEIALLNPKGFKETYLAEFGFTSSSLSKDALPQSDTR
                     WHIEGNNTTLTPSTPVTLIYNNGQGQTFRRILSIDDHYMFTIEDSITNESDKPIYLSS
                     YARVARAAPPEHTNATYLLHEGMIGIAGDSLKTEKYKTLAELNPNPDNGQKSMTFSKV
                     IGGWVGITDKYWAVAVIPPQDKEYTSRFIYFDRLQTHYQSDLLGSLLTVAPNETKTIT
                     NRLFAGAKQVEIINHYQNDLKIKKFALLIDWGWFDFITKPMFSLIDILYKQTGNFGIA
                     ILLVTVLLKTLLFPLANKSYKSMARMKLIQPMLLEIKEKYPEDRTKQQQAIIELYKTQ
                     KINPLAGCWPMLVQFPIFFALYKVLYITIEMRHAPFFGWIQDLAAPDPTSLFNLFGLL
                     PYTVPAFLMLGAWPLIMGITMFLQMRMNPAPQDQTQAMIFAWMPIVFTFMLASFPVGL
                     VIYWAWNNILSMIQQGIMMKRQGVKIELFDNLKAMWRKSPKKEAHE"
     CDS             341914..342561
                     /codon_start=1
                     /gene="engB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8UIB4"
                     /locus_tag="BH623125_02840"
                     /product="putative GTP-binding protein EngB"
                     /protein_id="GFF01850.1"
                     /transl_table=11
                     /translation="MTEYSSLSGIFFHNWVFIRGVPTIRFLPPEGPPEIAFAGRSNVG
                     KSSLINALVRQKSLARTSNMPGRTQELNYFVPDGFSGRPEDLPPIALVDMPGYGFAKA
                     PKNLVDAWTDLIYSYLRGRTTLKRVYVLIDSRHGIKKNDAEILELLDKAAVSYQIVLT
                     KSDKIKSSVLEQRIITTKTKLLKRPAAYPEILATSSEKAFGLEELRAAILQTIAV"
     CDS             342701..343393
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013528622.1"
                     /locus_tag="BH623125_02850"
                     /product="glutathione S-transferase"
                     /protein_id="GFF01851.1"
                     /transl_table=11
                     /translation="MLTLFHSPLSSASRFIRLILGEYSINTQLIEEHEWARRHEFLAL
                     NPAGNVPVLLTEQEVPLSGAIVIYEYLDETHGSLRQEKKFFPENPLDRAEVRRLNDWF
                     LNKFENEATRHIVRERIYKREMPLAIGGGAPNSQILRNARANILPHMNYLNWLCASRD
                     CLVGSELSYADLAAAATISVLDFLGEIDWTQSPAAKDWYMRIKSRPSFRPLLTDRIRG
                     IVASPHYADLDF"
     CDS             343714..344517
                     /codon_start=1
                     /gene="dapB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TFP1"
                     /locus_tag="BH623125_02860"
                     /product="4-hydroxy-tetrahydrodipicolinate reductase"
                     /protein_id="GFF01852.1"
                     /transl_table=11
                     /translation="MRLTVVGANGRMGRELITAIQRRKDVELCAVLVRKGSSFVDKDA
                     SILIGSDFLGVRITDDPESAFSNTEGILDFSQPQASVLYANYAAQKSLIHIIGTTGFS
                     KTEEAQIADFAKYTTIVKSGNMSLGVNLLANLVKRAAKALDDDFDIEIYEMHHANKVD
                     SPSGTALLLGQAAAEGRNIMLKNVSVNGRSGHTGKREKGTIGFACSRGGTVIGDHSIT
                     FAGENERIVLSHIAQERSIFANGALKAALWAKNHENGLYSMLDVLGLNE"
     CDS             344553..345173
                     /codon_start=1
                     /gene="gpmA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TFP0"
                     /locus_tag="BH623125_02870"
                     /product="2,3-bisphosphoglycerate-dependent
                     phosphoglycerate mutase"
                     /protein_id="GFF01853.1"
                     /transl_table=11
                     /translation="MERTLVLIRHGQSEWNLKNLFTGWKDPGLTEKGRTEAIAAGKKL
                     KETGLKFDIAYTSALQRAQKTAQNILEQMEQSDLELIKTPALNERNYGDLSGLNKDEV
                     RQKWGEQQVQIWRRSYTIAPPNGESLRDTGARVWPYYLHHIQPHILRSQTVLIAAHGN
                     SLRALIMALEGLNSEEIISQELATGIPIVYTFNSDSTISSKTIITP"
     tRNA            345558..345642
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="BH623125_t00100"
                     /product="tRNA-Leu"
     CDS             346634..347698
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_02880"
                     /product="hypothetical protein"
                     /protein_id="GFF01854.1"
                     /transl_table=11
                     /translation="MEQQYILGKYTRVVVHKKNAIFGAGSKQFIINDRKHWENLVLLA
                     AQWIEKKTKEETYNSLSSIMSRENFNRAFNFLFSNHFLVLAETSDNIFHNRYSRSHLH
                     YQSYGMHPASVQHTLSQKVVVILGCGGIGNHVSAILASSGVGKLILVDNDVIEMTNLT
                     RQILFTEEDIGLPKTTVLQRELIRRNSQSEVHELQMFITEKEDINKLPKADLWIISAD
                     SPDMLRPWINEWCVKNKQAYINSGYVNDIAIFGPFYIPGQTGCYACSTSIENLPEKGD
                     SLIHEACTAINNNFKVATFPPVNALSAAMCANDALKFLGGYGNLLSIDRRVGIWSSQL
                     FTEERSLKKNPHCKVCGTPQ"
     tRNA            complement(350944..351034)
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="BH623125_t00110"
                     /product="tRNA-Ser"
     CDS             351354..352562
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013532601.1"
                     /locus_tag="BH623125_02890"
                     /product="porin"
                     /protein_id="GFF01855.1"
                     /transl_table=11
                     /translation="MNVKSILLSSTVAFVAISGAQAASTFIAEPEPVEFVRVCDAYGK
                     GYFYIPGTETCMRLSGNVRADFIGGDNIDANTNADLNTKNKTYSASSRLTLVFQAASE
                     TELGTLRSYARIFSNWNNGQNKDGAKLTAAYIELGGFRVGLDDTIFSSWTGGYGNVIN
                     DDSVAPAGNIRTNFISYTFSGDTGFSAIIGAELGNDSIPTLAEGKEYYYINKEDKVAV
                     VSNESFPSKRIKNYTPNLVFGIKFMQKWGGFSTVAAYDAYYKKWAGKVRLDFNVNDRL
                     NLWVMGGYKNNIDYYTKDENNALSRQSSTIYANWGGKWAAWAGATYKLTPQANLNAQV
                     SYSAVKTFATSVNVAYTLIPGFVITPELTYVSWNDDRTFKGVNNDTTYSHALNGKSAL
                     QGMIRFQRSF"
     CDS             complement(353496..354455)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_02900"
                     /product="hypothetical protein"
                     /protein_id="GFF01856.1"
                     /transl_table=11
                     /translation="MYQIDYNSYRSVKSFNRRIRFLVMHYTSLDFKASIMALTGERVS
                     AHYLVPDPSEQTYIEAGFKDMRIFNLVDENERAWHAGVSSWAGRSNLNDTSLGIEIVN
                     LATGHSDSLEEICAEAALKDMRVLNPVHEGGGSLQTDVGSLADGSHVSGFAFPLETVN
                     VVTYSDEVFTFPPYNPTQIDAVKELALNILQRYPDITPTDVVGHSDIALGRKSDPGAA
                     FPWKELYAAGIGAWYDDEVKDHYQEQFCKSFPLKADVLAKLRCYGYDISAACSEIGYK
                     DLIRAFQLHFRQENYDGILDVETAAIIYALVDKYFPSNAFNVT"
     CDS             complement(355809..356186)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_02910"
                     /product="hypothetical protein"
                     /protein_id="GFF01857.1"
                     /transl_table=11
                     /translation="MAQHLIEKFEDHFCLYLVGAEITTARQQLAMHAEVHWLANDLQL
                     LKYFQSIEKSAKTVPQLEVEVSLSASLEILENQKESLVHITITVKMKGYSDDHISFPY
                     TRLLLGVVLQEYAAWSVFKIYVK"
     CDS             complement(356171..356779)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_02920"
                     /note="possible pseudo due to internal stop codon"
                     /product="hypothetical protein"
                     /protein_id="GFF01858.1"
                     /transl_table=11
                     /translation="MEKRNIQVTRHFVCADQLQQISETVIACLGQEDLITISGGLGPI
                     SDDKTRDAVAKAVRQPLFHHEDVWQTIKGQLGWLGSTPDSNNARQALFPETAKVLDNP
                     TGTAPGFYLSCGESILVILTGSLTQAFALLENYLEHGEKKYSSVSRARYAWILIGIDE
                     SAIAHWVDCQLANELFERHFYGKALMFSYNWLASHQRFWLSI"
     CDS             complement(356816..357217)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_02930"
                     /note="frameshifted, insertion at around 357039, deletion
                     at around 357387,357123"
                     /note="possible pseudo due to internal stop codon"
                     /product="hypothetical protein"
                     /protein_id="GFF01859.1"
                     /transl_table=11
                     /translation="MIVAENMFGDTLSNLGAGVMGKLCFALSASVGSNVACFCLFIEV
                     YRTLLDRIKQIFLLCFITTALLLDHLGFKDVAWQLFESVDQVIRAGKTAPYDLAGSAS
                     THQMTEAVLNSLANSVCRAAVITVDDELLSG"
     CDS             complement(357828..357965)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_02940"
                     /product="hypothetical protein"
                     /protein_id="GFF01860.1"
                     /transl_table=11
                     /translation="MHYEKEDSCVTGDGVGSELCDAALMVLEKFQLPIELTYGDIGWE
                     C"
     CDS             complement(357955..358686)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011268191.1"
                     /locus_tag="BH623125_02950"
                     /product="hypothetical protein"
                     /protein_id="GFF01861.1"
                     /transl_table=11
                     /translation="MSLHIIILSPVMPIWDRGVFCSSFTKLCLARGFHITLLDTLSLF
                     PSHSAFCNNSTVEILPFITEKLKKYFKEPSVLVGFSMAGMLVQILAARLPNVQAVLAV
                     NAPGYPDKPLKRQIGCILTFLKNKDLSGALEILNSFMCPRGGREKRVLWEIPDEQKSV
                     AIERMTRGFTFLLGGDARDEIIKYTGKFLALIGEKSQLATLANQTKSQCLNHEYQVIS
                     GAGTRLWDDNPAMTNAIVHKWIDAL"
     CDS             complement(358966..360162)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_002857707.1"
                     /locus_tag="BH623125_02960"
                     /product="Bcr/CflA family drug resistance efflux
                     transporter"
                     /protein_id="GFF01862.1"
                     /transl_table=11
                     /translation="MQHKYTLPFIILIVFLSTGGLISTDIFLPALGEMRQYYQVTESQ
                     IQSAVAVFLFALAIGQLIYGPLSDNFGRKKTLLFGLFLWLFTTLSVIYTVHIQAFLAL
                     RFLQGLGACAGIVLSRAIINDLLDKKAAGKLYLIVFPFIGMSPAFAPLVGGMLLQAFS
                     WYATFIFLSLFIFLTILLCCFVLTETLPLQKRQHFSFVGFMKACLGVLRNKQFIFYAL
                     IPCFSYAAYFAYIVESPFLLTILGLPPIYIGYSYIGVSLPYILGNLMARWLFKRESME
                     KTVWRGYIIFVIGGVLFALQMYVSPWPLVTSFIAIAVLTFGNGFLLPLGTALAISSHP
                     QAAGAASGVMGALQLGSAALSASVIGKTSGHNPKTMAVLLAVCCLLGFMIYVRKAYDF
                     MRVEMD"
     CDS             360921..361061
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_02970"
                     /product="hypothetical protein"
                     /protein_id="GFF01863.1"
                     /transl_table=11
                     /translation="MKRTDFFNYQLLIPIEIAGKTHTKINLRHPKLKDLKAIEKGTAS
                     SK"
     CDS             361067..361414
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_02980"
                     /product="hypothetical protein"
                     /protein_id="GFF01864.1"
                     /transl_table=11
                     /translation="MIASLSGWSYSAMNELDPYDFLNIKEILEPLITKAFEVINKFQE
                     NIKAVLVLKSFSIKIPSLEYFKELTTKINNINMPLKMISAACIFTHNASENKNKFCTN
                     TFKKNTRRPSMKK"
     CDS             362678..363766
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011267900.1"
                     /locus_tag="BH623125_02990"
                     /product="hypothetical protein"
                     /protein_id="GFF01865.1"
                     /transl_table=11
                     /translation="METRIPEDTAFDTHFLGKTSVEEQYPLFHTPISWSAIFAGLVTA
                     LATSICLSFLVAALGFNQMDFTSSTPFEGSFLSFGIGSLIVTLISLALGGFVAGRFAE
                     SSGALHGFLTWALLTLLMTLQAIHVVSSTAKLGAQAAVENSSAIGQTIDNLKTNFSPL
                     LSKFDGESFEQFLRKTKDNGVDFDKLGNELRALLNKSDIPALNPDRLKTSYQAALKDI
                     GEAITAFKNDPSHYRTYLKDLGERLSDRIEAITAKIDKSDIIKSLMNNGMTRTDAQTA
                     ANNALHVYKTAEEKTEKALKALEEQAETLSDNLEKAMKGAKNTAEKATKTASHMGWWG
                     FLGSLIGAMISSVFGYYGYRIRKASFMF"
     CDS             366254..366658
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_03000"
                     /product="hypothetical protein"
                     /protein_id="GFF01866.1"
                     /transl_table=11
                     /translation="MPLIQPGMGTKNSIELLYTLIQMAKPRTVLEIGAGDSTCLIATA
                     LQKAKQAWQQDKKLLRSTTFEERTAFLDPSGVLENYQPRLITIDDFSAEGQSAEQAWQ
                     KPLQDNSIEKDMVTFIHISSLLMMKRSNLGDQ"
     CDS             366697..366864
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_03010"
                     /product="hypothetical protein"
                     /protein_id="GFF01867.1"
                     /transl_table=11
                     /translation="MQFVTTLWEHITAHGYLCLHEPTMTITVALDGAQRVRRVRTPFW
                     EETLYRLDGLL"
     CDS             366851..367048
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_03020"
                     /product="hypothetical protein"
                     /protein_id="GFF01868.1"
                     /transl_table=11
                     /translation="MGSYEALTLTENHKYRQSGLGIIRKHTPAEQIVRAQSLQAELIE
                     INELPIRNDLLPMGKEALHKR"
     tRNA            complement(368600..368676)
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="BH623125_t00120"
                     /product="tRNA-Met"
     rRNA            complement(368786..368895)
                     /inference="COORDINATES:profile:Barrnap:0.8"
                     /locus_tag="BH623125_r00010"
                     /product="5S ribosomal RNA"
     rRNA            complement(368983..371786)
                     /inference="COORDINATES:profile:Barrnap:0.8"
                     /locus_tag="BH623125_r00020"
                     /product="23S ribosomal RNA"
     tRNA            complement(372193..372268)
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="BH623125_t00130"
                     /product="tRNA-Ala"
     tRNA            complement(372604..372680)
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="BH623125_t00140"
                     /product="tRNA-Ile"
     rRNA            complement(373050..374533)
                     /inference="COORDINATES:profile:Barrnap:0.8"
                     /locus_tag="BH623125_r00030"
                     /product="16S ribosomal RNA"
     CDS             375226..375618
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013529546.1"
                     /locus_tag="BH623125_03030"
                     /product="transcriptional repressor"
                     /protein_id="GFF01869.1"
                     /transl_table=11
                     /translation="MPSKLTRNQTLVLNILKNEQGPLSAYAILDRLREEGLRAPLQVY
                     RALEGLLQLKCIHRLESANAFMACSYPENCQHELTTFIICDNCGKVNEIQSPLMIYGV
                     KQMTQEIGFHANKSTIEVRGICEKCMAK"
     CDS             375824..376885
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012067010.1"
                     /locus_tag="BH623125_03040"
                     /product="hemolysin D"
                     /protein_id="GFF01870.1"
                     /transl_table=11
                     /translation="MYLKKIKQIKIIRPILVILALFMLWFGYKWITHWRYILSTEDAY
                     VQGDIAAIAPKLNGYIKKIAIKANQVVKKDDVLFCLDNGDYQIALDQTEARLNTQQKT
                     LLRIDAQIVAAHSALDDAQAQKAAASAIATNAQLTLKRTTELKADRYAPQSDVDDAKS
                     AYEQAIANVNRADAQIAAARANIQVLEAQRSETESQTKSLELTRDKAKRDLDSTIIRA
                     PFDGIIGNLTAKTGDFVVNGQRLAALVPIQALYIEANYKETQLQNIHAGQTAYITFDA
                     FKKEVFTGRVLSIAPATGAVFSLLPPQNATGNFTKIVQRIPVRISIPEEALKDKRIRA
                     GMSVSVQIDTRTKLHNHPL"
     CDS             376909..378480
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013528494.1"
                     /locus_tag="BH623125_03050"
                     /product="MFS transporter"
                     /protein_id="GFF01871.1"
                     /transl_table=11
                     /translation="MTSPIPEVDHSQKHVGIREIVVFIAMAFGMFMAILDIQIVSSSL
                     AEIQAGLSASSEEISWVQTSYLIAEVIMLPLSGFLGRLLSTRIFFSISAIGFTVTSIL
                     CATATSIEEMILYRALQGFIGGGIIPSVFVASYTLFPPSKRPIVTPIVGLVATLAPTI
                     GPTVGGYLCNILSWHWLFLINVPCGIIISILAWKLIDFDKADFSLMAKFDWLGLISMA
                     TFLGTLEYILEEGARHDWLQDTLVFNFFIIMILSAGVFFWRVLTTKEPIVDLSAFSNF
                     NFSTAAIFSFMLGIGLYGLTYLYPVYLSQIRHYDALMIGETLFISGLAMFLAAPLAGF
                     LSARIDARLMIAIGFSGFALGTWLASSITDDWDFWELFWPQVLRGVSIMLCMVPINDI
                     AFGSLSQEHMKNASGLFNLTRNLGGAVGLAIISTLITKRADFHYERIAETIQQGSTQA
                     TEMLSKLTMYFKFATFDPQALALFQFLNMVRTQAMVMAFSDIFFIITIIFCILTFLTI
                     FLKKIPPSTDIPPSH"
     CDS             379571..379741
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_03060"
                     /product="hypothetical protein"
                     /protein_id="GFF01872.1"
                     /transl_table=11
                     /translation="MIKEDKVYRKEKTILRNKIVSNIALEKNNRPPPTHSTLKLPKED
                     IAEKRKLNEQLL"
     CDS             complement(379738..380340)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013529755.1"
                     /locus_tag="BH623125_03070"
                     /product="N-acetyltransferase"
                     /protein_id="GFF01873.1"
                     /transl_table=11
                     /translation="MGVVTNMNMIYFQTKDDAFFTLASEQEADKPHREHLLDLTLGKG
                     RKRKSSEVLRRGRLAACGLSFVVKNTLGELVGSVRLWHVQFNKGHNEIQHALLLGPLA
                     VAAECSGIGIGSALMRHAIATAKKMGYGAIFLVGDCAFYQRFGFSSSLTKNLAMPGPY
                     EKHRFQALELIPHYLTSCHGILTPSGELEDWNSFQHHKVA"
     CDS             complement(380376..381509)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013529754.1"
                     /locus_tag="BH623125_03080"
                     /product="ornithine decarboxylase"
                     /protein_id="GFF01874.1"
                     /transl_table=11
                     /translation="MATQRIRDFLAKHRSEGPCLIVDLDIIRENYLNFEKALPQSRIF
                     YAIKANPAPEILNLLASLGSSFDAASVAEIEMALKAGATSDRISFGNTIKKERDIAQA
                     YALGISLYAVDCVEEVEKIARAAPGVRVFCRVLTDGKGAEWPLSRKFGCVPAMAVDVL
                     RRAHQLGLQAYGVSFHVGSQQTDLSAWDRALSDAATVFRHLEHEGISLKLVNMGGGFP
                     TRYLKDVPTTQAYGTVVFDSLKKYFGNRIPETIIEPGRGMVGNAGVIRTEVVLISKKA
                     DNDNIRWVYLDVGKFNGLTETMDEAIRYPIETPHDDKAMEPCILAGPTCDSADVLYEK
                     TPYLLPLSLTVGDELLIHGTGAYTATYASVAFNGFEPLPSYVI"
     CDS             complement(383371..384285)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8U7F8"
                     /locus_tag="BH623125_03090"
                     /product="UPF0176 protein"
                     /protein_id="GFF01875.1"
                     /transl_table=11
                     /translation="MEKNFKVAALYCFADLKHYRQLQKPLLDLCQAKDIKGTLLLAQE
                     GINGTVAGSCAAIETLVDFITAEPAFQMPEIKYSWASKMPFHRMKVRLKKEIVTMGVD
                     GVNPLKAVGTYVDPKDWNALIQDEETLLIDTRNDYEYAIGSFQGAVDPRIKTFREFPA
                     WVLKHEADLKKKKKIAMFCTGGIRCEKSTAYVRELGYEQVYHLKGGILKYLETIPKED
                     SLWWGECFVFDERVSVKHGLEECGRELCRACRSPLNTESKLSPHYEEGVSCDACYNTR
                     SEDDRERFRERHRQFQLSKLRAMHSHQE"
     CDS             384398..385063
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013529740.1"
                     /locus_tag="BH623125_03100"
                     /product="2-dehydro-3-deoxy-phosphogluconate aldolase"
                     /protein_id="GFF01876.1"
                     /transl_table=11
                     /translation="MCQKIEKLLSLLQEQTIIPVLHIDTLQNAVPLARALVKGGLRTI
                     EVTLRTANALDAIKAITQEVPESIVGAGTILSTIHYKQAEHAGAKFIVSPGFSNKLID
                     YAKNSEIPLLPSALTPSEVMKALDKGYSYLKFFPAEAAGGITFVKALAAPFSEIRFCP
                     TGGIKQKNAAQWLQLSNVFCIGGSWIAPRNLITAKNWHAISALAQTAAQLSSYPTKVC
                     STI"
     CDS             complement(385033..385239)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_03110"
                     /product="hypothetical protein"
                     /protein_id="GFF01877.1"
                     /transl_table=11
                     /translation="MHYDCYGEWYFFEMTGLLKIHADEDLVMICNSMAMLKDCARMCE
                     AFGLVEGANDDALESYIVEHTFVG"
     CDS             complement(385555..386385)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013528564.1"
                     /locus_tag="BH623125_03120"
                     /product="ferredoxin--NADP(+) reductase"
                     /protein_id="GFF01878.1"
                     /transl_table=11
                     /translation="MNTSASNVQSNISSVASDFPIPENVFALTVQEVYHYTDRLFKFR
                     LNRPESFRFRSGEFVMIGLPNAEKPIYRAYSIASPFWDEQLEFFSIKVPGGPLTEHLQ
                     KIKIGDTVLMRKKSTGTLVLDALIPGKRLYLLSTGTGVAPFASLIRDPETYEKFSEVV
                     LIQTTRECDELNYAKDLVVSLQQDPLIGEYAPQLKFYPMTTRESSEHMGRITTVMESG
                     AFFEMTGLPKIHADEDRVMICGSMAMLKDCARMCEVFGLVEGANNAPATYVVERAFVG
                     "
     CDS             386688..386870
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_03130"
                     /product="hypothetical protein"
                     /protein_id="GFF01879.1"
                     /transl_table=11
                     /translation="MALRMYTSDILSIFYIKVTYERDRDGQRILYSSDRFKGMKFVSN
                     LINADSGEIVAEAGKK"
     CDS             complement(387306..387536)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_03140"
                     /product="hypothetical protein"
                     /protein_id="GFF01880.1"
                     /transl_table=11
                     /translation="MLVLHFHIFANNENAVGCSVAVFFFGFCLDYEGPSFFIYDTDIV
                     KRDIFIVFDYKNSWGKRYSVYGDRLTVKTVTL"
     CDS             complement(388160..388492)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_03150"
                     /product="hypothetical protein"
                     /protein_id="GFF01881.1"
                     /transl_table=11
                     /translation="MQCRIKIPWKTGHQYEFDVSKKENLVTGTITDLMDGTKTTVGVI
                     EVPKTFGKFYASLGFVEEYSQGDGQLLSFFVMGMQSSIFRAPIGDNTVKAKQSTYTYG
                     NCNDPYVV"
     CDS             complement(388523..388729)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_03160"
                     /product="hypothetical protein"
                     /protein_id="GFF01882.1"
                     /transl_table=11
                     /translation="MHGLLIQRLDQLTFFQKISNDGGMNSHYYWANQFFFKNGDVGYI
                     GLQNSGGDHFVNYSIWNAVGWKSD"
     CDS             complement(388674..388892)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_03170"
                     /product="hypothetical protein"
                     /protein_id="GFF01883.1"
                     /transl_table=11
                     /translation="MILSIECNSDKINLICSELMGDELQNPKNIIHFFWFLVSSASYA
                     VVAGGIIFIQHAWSAHSEVRSINVFPED"
     CDS             389910..391028
                     /codon_start=1
                     /gene="dadB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:P58737"
                     /locus_tag="BH623125_03180"
                     /product="alanine racemase, catabolic"
                     /protein_id="GFF01884.1"
                     /transl_table=11
                     /translation="MNKSAKDTANPLFPATAIATIDVRAIVANYRTLAQHVAPTECSA
                     VVKANAYGLGAHKIAPALYQAGCRTFFVAQIEEALQLKAVLPENVMIALLNGFPHKAE
                     EFVAQSGIIPLLNSWSTIEDWQTLCQKKNKKFPAIIQVDTNMSRLGLDKKELQKLIKN
                     PTIFEKAEIKYILSHLANGEDASHSSNNKQLAAFKRVLAQLPTCKVSFANSGGIFLGS
                     DFYFDLVRPGIALYGVDPHGKHPTPLKAVVKVEAQVLQSRFIDAGIPVGYRESFMTRR
                     PSTLATISIGYADGWPRILSNKGTVYFNGHKLPIVGHISMDSIIVDATDLDKKPQRGD
                     WVELIGPHQPLEKVSTDTNTIPHEILTSLGKRYKRIYI"
     CDS             complement(391362..394166)
                     /codon_start=1
                     /gene="gcvP"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TD43"
                     /locus_tag="BH623125_03190"
                     /product="glycine dehydrogenase (decarboxylating)"
                     /protein_id="GFF01885.1"
                     /transl_table=11
                     /translation="MSPMLERPFFSRHIGLRPDEKQKMLDIVAVDSIDTLVSQALPHS
                     IHLGRPLNLPKAVSEGQALEELSKMMERNYLHKSFIGQGYHGTYVPPVILRNLFENPA
                     WYTAYTPYQAEISQGRLELLFYFQTLISELTGLPVAAASLLDEATALAEAITVAFRFT
                     REKKMKISLQSLLHPQILSVVQTRAETQGLQVSKNSEICSDTAAIVLSWPDTKGSFND
                     YSEVIKEAKAKGALVIVVADPLALTLMEAPAKWGADIVVGSMQRYGVPMGFGGPHAGY
                     LAVSDALTRLIPGRIVGQSVDTKGRVGFRLALQTREQHIRRDKATSNICTAQALLANM
                     ATAYAVWHGPQGLQEIAQRVHHLTCRFVGGLEAVGISCEGEYFFDCVSIVVKGKAREI
                     ACQAKAGGRLIRVLDDDRVVINFDELSTQEDAHALAQLFGAGLVDQASPRLMGKGRDT
                     TFLSQPFFHAVHSETDMMRFLRRLSDKDLALDRAMIPLGSCTMKLNAAAELMPVSWPT
                     VANIHPFASREDAVGYQEMIHQLNAWLCEITGFAQVSFQPNSGAQGEYAGLLAIRRYH
                     QSRGEHQRTLCLIPASAHGTNPASAHMAGMEVVVVKCLNDGDVDLDDLKMKAQLYKER
                     LAALMITYPSTHGVYEESIKDICSLIHENGGQVYFDGANLNALVGLARPADIGADVCH
                     MNLHKTFAIPHGGGGPGVGPIGVVEHLKPFLPGHEQEGTTHAVSAAPYGSASILVITW
                     MYIRMMGAEGLKYATQTAILNANYIAARLSQVYSILYRGKHGRVAHECIVDTRVLKEQ
                     YGVSVDDIAKRLIDYGFHAPTMSFPVPGTLMIEPTESEPKAEIDRFCDALLSIAEEAK
                     KIGSGVWPKDDNPLVHAPHTLVDTLDDTWARPYSRQEAAFPNCSLDPANKYWPPVSRI
                     DNVAGDRMLICSCPPLGNTY"
     CDS             complement(394163..394531)
                     /codon_start=1
                     /gene="gcvH"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TD42"
                     /locus_tag="BH623125_03200"
                     /product="glycine cleavage system H protein"
                     /protein_id="GFF01886.1"
                     /transl_table=11
                     /translation="MSKTYFTQDHEWLSVEGQVVTVGITDYAQEQLGDLVFIDLPQNG
                     TKLSKGDAAAVVESVKAASDVYAPLDGEVVEINAALAESPELVNQKAETEGWLWKMTV
                     QDETQLERLLDEAAYKELIG"
     CDS             complement(394539..395657)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TD41"
                     /locus_tag="BH623125_03210"
                     /product="aminomethyltransferase"
                     /protein_id="GFF01887.1"
                     /transl_table=11
                     /translation="MGTSQEFETSSLKTLPLYELHEKAGAKFGAFAGWRMPLTYPLGV
                     LKEHLHTRAHAGLFDISHMKLIAVEGPKAVEFLSYALPVDAALLKIGQSRYSYLLNER
                     AGILDDLILTRLAECRFMLVANAGNAQADFAELEKRAFGFECQVIALERVLLALQGPQ
                     AAAVLADAGLPGNELLFMQGFEPQQDWFITRSGYTGEDGFEIALPIGCARALAEKLLG
                     DSRVEWVGLAARDSLRLEAGLCLHGNDITPDTTPIDAALTWAVPKNVREKAQFYGAKA
                     FLESLQKGPSRCRVGLKPQTRQPIRAGAVLFDNEGNRIGVVTSGGFGPSFDGPVAMGY
                     VPVAWKVEGTEVFTELRGKKIALSVHSLPFVEQRYFKG"
     CDS             396398..397060
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013528774.1"
                     /locus_tag="BH623125_03220"
                     /product="ATP-dependent protease"
                     /protein_id="GFF01888.1"
                     /transl_table=11
                     /translation="MKAGNIHYNCENDLPKKIALFPLEGALLLPGGFLSLNIFEPEAL
                     EMVEDAMVSNRLLGIIQPLSSGTDYLPIQLYKMGCIGRITHYNETGNGQLFIILQGVC
                     RFTLEQELVNTKSYRIALIRSNIKDLQEVEFSESINRENLLNIVEQYLTIHEIEYNWS
                     NIIQTPTPILVNAFSSLIPFTPAEKQALLEAPDIGSRAQTLLALTERSLMKQTGAYHY
                     LN"
     CDS             397074..397280
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8U9N0"
                     /locus_tag="BH623125_03230"
                     /product="UPF0434 protein"
                     /protein_id="GFF01889.1"
                     /transl_table=11
                     /translation="MKKMITDPKMLELLVCPITGGTLSLNRKTQELISLEAKLAYPIR
                     DGVPIMLASEARPLQNNGKELHKK"
     CDS             399258..399545
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_03240"
                     /product="hypothetical protein"
                     /protein_id="GFF01890.1"
                     /transl_table=11
                     /translation="MGLSQKQLGSHLGITFQQIQKYEKGINRVSAGRLQEIADRLDVP
                     VSFFYADISKKEDTLYPDNDRISNKAEHLLLKNFRGLNPKKQRAILRLISD"
     CDS             400824..401840
                     /codon_start=1
                     /gene="asd"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q92KY2"
                     /locus_tag="BH623125_03250"
                     /product="aspartate-semialdehyde dehydrogenase"
                     /protein_id="GFF01891.1"
                     /transl_table=11
                     /translation="MSFKVAVVGATGNVGREMLTILEERGFPTHEIVPLASRRSLGQS
                     VSYGDKTLKVKALDTYDFSDTDLCLMSAGGSISKEYAPKIAAAGCVVIDNSSTWRYDS
                     NIPLIVPEVNAQAIDQFSKRNIIANPNCSTIQLVLALKPLHEAACIKRVVVSTYQSVS
                     GAGKEGMDELFEQSRAVFVADPITSKKFTKRIAFNIIPHIDVFMEDGYTKEEWKMAVE
                     TKKILDPKIKLTATAVRVPVFIGHAEAVHVEFEKPLSAHEAQTLLRDAPGCQLIDKHK
                     DGGYITPYESTGEDATFISRVREDITVENGLAFWVVADNLRKGAALNAVQIAELLISR
                     NLIK"
     CDS             complement(402219..402845)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_03260"
                     /product="hypothetical protein"
                     /protein_id="GFF01892.1"
                     /transl_table=11
                     /translation="MLKKDFLSITMILLALGGSGLGMTVSHAAVTKIARVASGQVVLR
                     IGPATAYRAIAIAPTGAKVQINGCLSNKAWCSLSYNGKVGWASARYLNINNVPTISFT
                     HMRVKPNSTIKVQKQKVKQVVSSFKNLTVPQKIRKNLQKLYRKDVVIDSTTVKKRDER
                     TVLNPSPKAQNISVKRVNAYNPFFPYDVNYRNFERNETRYRVVTYPAP"
     CDS             403372..404190
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TEN3"
                     /locus_tag="BH623125_03270"
                     /product="lipoprotein"
                     /protein_id="GFF01893.1"
                     /transl_table=11
                     /translation="MKLKQLSRNATIGLLLSLFALFLSPIFSMAADKSNIKLGVMEGQ
                     EATIWKVAVEQAKKVGLNIELVYFSDYTLPNDAVHAGEIDANAFQHTPYLNNQIKQRG
                     YKLSIAGYTFLTPIGIYSHKIKELKELRDGAHIGIPNDPSNGGRALLLLSSLDLIKLK
                     DSHDILASPLDIIENPKNLQIRELDAGMLGRAIDDFDIAIINTNWALISGLNLQTDAI
                     AWEKAENNPYNNIIVVRTIDKDEPWVKKLVSAYNSEAVRAKIKEVFGMAAQTSW"
     CDS             404218..405252
                     /codon_start=1
                     /gene="metN"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TEN4"
                     /locus_tag="BH623125_03280"
                     /product="methionine import ATP-binding protein MetN"
                     /protein_id="GFF01894.1"
                     /transl_table=11
                     /translation="MENPSLISLKKISRCFNTTTDICALDNLSLNIHAGEILGIIGRS
                     GAGKSTLIRCLNGLERIDAGSIFFEGVNVSNLSETEWAPYRQRIGMIFQHFNLLSSQN
                     ILNNIALPLKLTGINKKQRHKRALELIELVGLCGKEYCYPAELSGGQKQRVGIARSLA
                     ANPKILLSDEATSALDPETTQSILELLADINKRLNLTIVLITHEMEVVRAIAHRVVVL
                     NQGRIVEEGRVKDIFTSPQDDTTIAMLKLVTPQLPEKFAKNLKPRGQEAIIEINIAGE
                     ITQQPFLNLLEDEIGLRARILHGGIDTVQGETIGRLFLGLPAQNQEALKKAVQWLTEK
                     GRYCEVLGYV"
     CDS             405245..405904
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013528559.1"
                     /locus_tag="BH623125_03290"
                     /product="metal ABC transporter permease"
                     /protein_id="GFF01895.1"
                     /transl_table=11
                     /translation="MFNVLSYELPQAVFDTVLMTISASLMALIIGLPLGLLLYTTARG
                     GILASYLINRPLSIMIDSIRAIPFIILAFYLLPLTRIVVGRGVGMSSVIFVLTISAIP
                     FYARMAELSFKTVENGLIEAARSMGASRLQIIRHVLVPEALPSLINGFTVMVISLIGA
                     TSLAGYLGGGGLGDMAIRYGYQRYNTSIMTIVIILLIILNVITQWSSDKIVQKLDKKK
                     H"
     CDS             complement(407835..408314)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013529668.1"
                     /locus_tag="BH623125_03300"
                     /product="nodulation protein NodN"
                     /protein_id="GFF01896.1"
                     /transl_table=11
                     /translation="MQQKIAVQDVANFIGKEIGLSRWRLVTQDMINQFACATDDHQWI
                     HVDEEKAKKTHFGGTIAHGFLTLSLLSTLAYEALPELEGTTMGINYGFDKVRFMSPVK
                     TGTRVRARFVLNDAEIRPSGRVVFHYGATMEIEQLKKPALTAQWLVVAMVGEKYINS"
     CDS             408482..409819
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013529313.1"
                     /locus_tag="BH623125_03310"
                     /product="homoserine dehydrogenase"
                     /protein_id="GFF01897.1"
                     /transl_table=11
                     /translation="MASNVSLTGLAHDLKQRAENHPPIRIGLIGCGEMGTDLLSSIAH
                     MDGITVAAVATRTPSRIFDAARLAYGEEGHVREVENASALTRTIEKGLIAATNDIDLV
                     LRHEQIDIIVDATGYPEAGAEIGFKALENNKNLVMMNVEADVTIGAYLKHEAEKQGLI
                     YTLGAGDEPTSCMELIEFVSALGHKIVAAGKGKNNPLIFDATPDTYEEEALRRNMNVR
                     MLVEFIDGSKTMVEMAAIANATGLLPDCPGMHGPQAALKDLNKILIPKQDGGILEQCG
                     VVDYSIGPGVSPGVFVIAEIAHPRLRERMEDLKMGQGPYFTFHRPYHLTAMEVPLTCA
                     RIMLYGKKDMAPLNHPVVEVCAVAKKDLYPGDQLDFIGLYSYRAWIMNIAEARMHQAI
                     PCGLLENATVTAEIKKNELITVHNTAIREDQWIARLRTKQDLLLNASSLPSHA"
     CDS             complement(410135..410368)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_03320"
                     /product="hypothetical protein"
                     /protein_id="GFF01898.1"
                     /transl_table=11
                     /translation="MRAPNIVRFSHFKFFYSESIKIIRLHVTSGVWCVDGYKGLKKEV
                     KMLLMNRLNAMVVVIFGIGKENDGAGLDFYDFS"
     CDS             410529..410744
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_03330"
                     /product="hypothetical protein"
                     /protein_id="GFF01899.1"
                     /transl_table=11
                     /translation="MLLQAIKLNFKRNREKRRIFAPFTIFQLRKNSKKLFKELKALKE
                     GTGTYLLGKVLLEFTETYQENVSYCFQ"
     CDS             complement(411042..411200)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_03340"
                     /product="hypothetical protein"
                     /protein_id="GFF01900.1"
                     /transl_table=11
                     /translation="MFGIFKNCICSCFYTVFILFAQTVGSNAHIQERGVFVALEKNTG
                     MRTLDVPV"
     CDS             414659..415399
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010973909.1"
                     /locus_tag="BH623125_03350"
                     /product="creatinine amidohydrolase"
                     /protein_id="GFF01901.1"
                     /transl_table=11
                     /translation="MISDIPFLALLPLGAHEYHGDHLPFETDWIIAEAFAKALTVKTK
                     KQFHIALLPVEKIGYSIEHMDVSGTQTLTFSEAIERWINIGEDCYRKGIKRFLLLNAH
                     GGNSPLMSIVITELRKRFSMLAVATSWTRFGLPHGLMHPSQHHLDIHGGFIETSLMLY
                     LAPEKVHMEKAKNFYNKQADMIANYQYLRAYGPHAFGWTMRDLNLQGAAGKAREATSQ
                     AGKAIFSHVLGGLRGLLDDINRFKIDAL"
     CDS             415415..416443
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012066982.1"
                     /locus_tag="BH623125_03360"
                     /product="cobalamin biosynthesis protein CobW"
                     /protein_id="GFF01902.1"
                     /transl_table=11
                     /translation="MEKTQNTPNKLPVTVLTGYLGSGKTTLLNRILSENHGKRYAVIV
                     NEFGEIGIDNDLIVESDEEIYEMNNGCVCCTVRGDLIRILESLMRRSHRFDAIIIETT
                     GLADPVPVAQTFFMDDTVNTKTALDSVIAVVDAKHLSLQLKKSREAEEQIAFADIILL
                     NKIDLVSVKERAQAESLILAINPRAVIYATERTNIPLDKLLDRGSFDLQRVLENDHHF
                     LDHQHFDHVCGPDCNHDHTHHHTSVLHDITITSVSLKTGALQPEKFFPWIQQITQQKG
                     PDILRLKGIIAFQGDDDRYVIQGIHMILEGQHQRPWREDEKRESRLVFIGRTLDAKQL
                     KTGFENCA"
     CDS             416454..417425
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012709421.1"
                     /locus_tag="BH623125_03370"
                     /product="hypothetical protein"
                     /protein_id="GFF01903.1"
                     /transl_table=11
                     /translation="MPSITNYDLQSYCLSCGFMDNKPVFVSVEGFIVFFNSPPQTIEI
                     HRGIISSHFSYDNTALITGGEDGKVCQTTADGHTQVLSKQERKWISNVAFGPQKVCAF
                     ASSRIAWANTNQGFQELVHERSVEGLAFARKGLRLAVAHYNGVTLHWLSTQTSPTTLV
                     WKGAHCGVTFSPDNRYVISTMQENALHGWRLTDHQHLRMSGYPSKVKSWSWSQKGKWL
                     ATSGASAAIVWPFHTKDGPMGKAPLELGTRSNVLVSSVACHPSEEIVAIGFNDGMILC
                     AHFRDGKEALLKGYGKSAISALNWDQKGHNLAFGSENGECGIINITA"
     CDS             complement(419204..422305)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_03380"
                     /product="hypothetical protein"
                     /protein_id="GFF01904.1"
                     /transl_table=11
                     /translation="MFLPVLLFSNERGRKVLRQLMIKMFRNHVCLCTVTTAILSFLQI
                     GTGGGASAGEGRNDPYTITVTPLFSGISPNNSGVLGMRIGSLNGLSGDNFGGIGVVGG
                     SGRRDGRHLGGSNAGHSLKGESGDRDGRESSGSRVKVSYGSYYSCNNCVKSTIHDQSY
                     KITRENVGGILSSHVAITVKKLAEVEGKNVTVHSEISDKPYTRGVSVSEGGKVTLNNF
                     TLKNAKVALHASDGMIEVDGGTIIESTRAVQAIGTPTHVVLKNVKIQTSGGDKIIYSN
                     GSAEIKMKSGSIEFTDSHGVSSTLGGKINLDSVKITGNGKEKNSNNYAVLHTDLGGPI
                     NLDGVTINAMNVHGVLSENTVRTSNSIPLPGNLSDNIDVTEVNIKSSSVTVEGERSYG
                     IYFRGEKSGEEFENRGKLEEVKKLPRLEAINIRRTTFSVPDSVALYSTDSTYGVVNLM
                     QSTLSGRSLLRAERGALVKILASASTLEGGAHVDDRSTAELYLGAGSTWTLKQNQERD
                     SRESAGTNDSSISFLLLMNDSSIKFHKLKTDKDYNYQTLHIGNGTGTVYKAQDGAYIY
                     LNTYLNEGGDYEKQKTDRVLIHGDVSGTTTVYVRSMPGSPGGYTGIGGNNQGISLIQV
                     SGTAGKDSFQLDGGYVTVGHSPYQYTLYAYGPESDLGEAHPSQRLVKGEEAFWDFRLE
                     NRYTKPSPEPEPEPEPRPEPTPPPRPDPGVKAVVPQVPTYLLLPNALFHSGLMHVGNQ
                     AKRLEALRTVSGGFLQSEEKPAFFVRGYGSDYRYTSNLSVLEYGYGGELSYNAVEAGV
                     LLKTIEGEYSNTSFGVIGTYERLSLQPLEVEQSQKSAFDKWSVTAYGGLQCDTDFYLD
                     GLLSYGLFKGDVVTLARGKTTTLKGKPLSASVTAGKAFMVGEEGFVLDPQVQAIYQHI
                     QFDKARDIDDFEIELGKLDQWTMRVGGRLTKTFSATDEPRVVSLYGKLHLAHSFGKKQ
                     SVHFKDAFQLGAFGSFVETGLGFNARLSSNFTLHGDLSYQQKLTKAGFSGTSFSGGMR
                     YQF"
     CDS             422578..422778
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_03390"
                     /product="hypothetical protein"
                     /protein_id="GFF01905.1"
                     /transl_table=11
                     /translation="MKKIAQISKKTNSRKPSFTNYRTETSNPYKAGYCTLTREFPHSK
                     APGIKSGAYRIMITKILRKFTH"
     CDS             complement(422967..424868)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_03400"
                     /product="hypothetical protein"
                     /protein_id="GFF01906.1"
                     /transl_table=11
                     /translation="MIKIFKNYLSLCVFTTAIFFFVHNTDARVETSRNDGGHEISDKI
                     YHKAIKSFAEKPANDSKSEGTVTGNTMAIEVSSPDIISGFVGEKTFAYNILSGSRKIR
                     KRESGEKESRNLGSAALGKSESKVLLVLPMKLYDRGNKGFDYFAYHNSKNYVFKDSAG
                     KYFRPCPPVVPGDTVSYLNLSSATDNKQCPNMITSNKANSVPNNSSVVVVEIMPEELY
                     DSKKDINEELVIRKSDGSFKQHCPGGNFFDLSSATDKRECGSSVTDNVSDNSISVVDD
                     QSTSRGRSESSGEAATGSISTPVKPTDGFVLPERVVRSVVPQVPTYLLLPNSLFHVGL
                     MDIGDQNKQLETLRMSAGGMLEVHENPALFLRGYGGHYRYASDLSALEYGYGGHLRYN
                     AVKAGILLKTIESADNVVSFGVMGSYGKLSLQPKNVEHSEESTFDKWSITAYSTLQHD
                     AGFYVDGLLSYGLFKGDVVTLARGKTATLKSKPLSVSLTGGQSFATGYEGFVVDPQVQ
                     VVYQNLQFDKARDIDNFDVEMGKLDQWVARVGGRLSKSPTGSEGISATSFYGKLYLVH
                     GFRKKQSVHFKDAFQLGAFGSSLEAGLGFNTWLSPKFALHGDVVYQQKLTKAGFSGAS
                     FSGGLRYQF"
     CDS             complement(425294..428353)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_03410"
                     /product="hypothetical protein"
                     /protein_id="GFF01907.1"
                     /transl_table=11
                     /translation="MIKVFRNHVCLCTVTTAILSFLQIGGVVIANAEERSGGMSYTIT
                     VTPVSPGISPNTSTILGMRIGSLNGLSGDNLSGIGGDGGSGGRDASRHLSGSNAGRIL
                     SGSGGDRDDGQYVYKYDRAKGKLVMYNGLYYLCDGCGESTIDNKSYEITNDNASRYPS
                     NTAITVKGKGAKVKGEKVNVFSKNSEKSFTRGVSVSEGGKVTLNNLTLKNAKVALHAS
                     DGMIEVDGGTIIESQMAVQTIGGKTHVVLNNTKIETNSGKASLYSYGSAEIKMNGGSV
                     DFKDSHGVSSTLNGKIAFDNVTITGKSSKDKSHAVFLMDFGGSVDFKGGTINVIDIHG
                     ILSENTVSIVNSIPLYENLSERDRMTEVNLTSSSVTVEGERSYGIYFRGEKPGEEFEN
                     RGKLEEEKTLPRLEAINLRQTMFSAPDSVALYSTDSTYGVVNLMQSTLSGRSLLRAER
                     GALVKVLASASTLEGSTHVDDRSTAELYLGAGSTWILKQKQERDSRESARINDSFVSF
                     VSLINDSSIKFHKLKSAPTYDYQTLHIGNGTGTVYKAHDGAHIYLNTYLNEGGDLNKQ
                     KTDRVLIYGDVSGTTTVHVRSMPESPGEPTGSGGNNQGISLIQVSGKAEKDSFQLDGG
                     YVTVGHSPYQYTLYAYGPESDLGKAHPNQRLVKGEEAFWDFRLENRYTKPSPEPEPEP
                     GPRPEPTPPPRPDPGVKAVVPQVPTYLLLPNALFHSGLMHVGNQAKRLEALRTVSGGF
                     LQSEEKPAFFVRGYGSDYRYTSNLSVLEYGYGGELSYNAVEAGVLLKTIEGEYSNTSF
                     GVIGTYERLSLQPLEVEQSQKSAFDKWSVTAYGGLQCDTDFYLDGLLSYGLFKGDVVT
                     LARGKTTTLKGKPLSASVTAGKAFMVGEEGFVLDPQVQAIYQHIQFDKARDIDDFEIE
                     LGKLDQWTMRVGGRLTKTFSATDEPRVVSLYGKLHLAHSFGKKQSVHFKDAFQLGAFG
                     SFVETGLGFNARLSSNFTLHGDLSYQQKLTKAGFSGTSFSGGMRYQF"
     CDS             428682..428882
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_03420"
                     /product="hypothetical protein"
                     /protein_id="GFF01908.1"
                     /transl_table=11
                     /translation="MKKSAKISKKTNFRKPSFTNYRAETSKPYKEGYCKSTREFPHSK
                     APGIKSGAYRIMITKILRKFTH"
     CDS             complement(429071..435097)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_03430"
                     /product="hypothetical protein"
                     /protein_id="GFF01909.1"
                     /transl_table=11
                     /translation="MINVLKNRTRLCALTTSVFFFLQGMDVSMGASAGVGDSLISNPF
                     VVSAGEGFPSYRCEVGTFGQIDRGPIYCDDGEFHKMKRGSITVPVYGSAAVTAIGKIE
                     SLPASADLQDDDIDNTFHKIKETTVELDAVLLKSKGLSYSDELVTFENGIFTHKFSDS
                     DELVGFGSAVYSVLDAKVDLKRSNIRGFIVGLNAESEGIIVMRGGEVRRSFLGAEASD
                     ASFVVLDKVAINVDGIGLYSDGSGINMVSGSLVFPEEGIGGISTNYGSITLKNVNIQI
                     KKAGNVEVDSVQDSDNDGPKSVGFLLHEGFVSFDDVTFNDSDAAVLYILGGLDNVVRQ
                     SVEYASVLSVEDVSSVEVADVSLEDLLRPEYVVRNNNFITPYRKGQPADNNAFASAVS
                     TMSAVLNEIYDDKGAFQATRAFKVSASIKSSNITLNGKESYGIYFKGRERDEEKLLSS
                     SGANEAARVVLLEDTKLNVPDGLAIYGDEGSKSYIILGKKSRLSGNLSLKAEPNSIMS
                     VFAHDSTILGGVVTDEHANTELFLSGNSSWHLIKSKDKGWKCSEADNYIDSCISAISL
                     VDSSIKFVSSQSDQAHAGGYQTLRIGDESTLSYGVYNSLGGSAIYLNAHVISDDSGHT
                     QMVSDKLLIYGFVSGETTVHVNDVVRRGGNSNTVRLEETQNKSHSVSMIQVYGLARED
                     SFQLSSPYVTMQGSPYQYTLRAYKMENSEKTFEGDLESDDTAEWWDFRLESKVQDGDT
                     STYLLYIPGSPINGVEEVAYTVVDGDDDLSKPSVLGRSEIAEDLIGDLSLVVVPSTLP
                     ERSASVASAELERSETEDEVSVILNPSSVETSIPPTVSGNSAGPVRGGQSAPVARSES
                     DGGVTVVLSPSSVETSTPPAVSDNSAGPVGGEQSASVARSESDGGVTVVLSPSSVETS
                     TPPAVSDNSAGPVGGEQSASVARSESDGGVTVVLSPSSVETSTPPAVSDNSAGPVGGE
                     QSASVARSEESAATPYTVFTALQGTTESRPVGRILLSTPVKSTVVSTESRDPAPIISA
                     AASPQPSVMQSIVTSKPSASVDSAGKESVSSQCNDRGRNGAETLQNSYLCNDGQTHTV
                     TDLTLKASGALQHPMHAKSQNTIIKLEGATIMGAADSENNVDLTKLQLVSTVLAEDGA
                     EVVLDKKSTVKNSSIGLEAQKGGKVKMTDGTVNARYVGVLAGSGSSVNLSNTKINVTG
                     DLAIAGLASNAGEATMNTGVITLTSGVAVRSESGGNVKLDNVKITAKKGQQDQPDSAE
                     TFGRAAFLVSDRGSVEFTNGYVSTDANGLWMRDSNDSVENSTSDTGTSRRKRSSDVRP
                     SLNRAHIELSDVKVEGDKSYGIYFDGTGRKEGSQQNRNRVLEEAVTELSGTGSTIEKV
                     SVVKRSTVSQKEKTPIDITGAVSLKKTRFEVINGIAIYGNNSGGQISLEENTILSGDL
                     LLSAENNSHISVSVDDSIIEGWARIDKSSYAKLDLINKSEWILKRSVKRNFATPDSGC
                     IDSCVSSIRLVNSTIDFVPSESEDLYQTLHIGTGNAKVYEAHGDVAIFLNARLNPRDP
                     SDQQVTDRLVIHGDVEGKTRLHIRGVSDIVGEGKDNNQIAHSVSIIQVYGQAEKDSFQ
                     LDGNYVALANSPYKYVLRSYGPQLTAKQEHIEQKFIKDGGAFWNFRLENQYVKPSVPT
                     DGLVLDERADGFVLPERVVRSVVPQVPTYLLLPNNLFHVGLMDIGDQNKQLETLRMSA
                     GGMLEVHENPALFLRGYGGHYRYASDLSALEYGYGGHLRYNAVKAGILLKTIESADNV
                     VSFGVMGSYGKLSLQPKNVEHSEESTFDKWSITAYSTLQHDAGFYVDGLLSYGLFKGD
                     VVTLARGKTATLKSKPLSVSLTGGQSFATGYEGFVVDPQVQVVYQNLQFDKARDIDNF
                     DVEMGKLDQWVARVGGRLSKSPTGSEGISATSFYGKLYLVHGFRKKQSVHFKDAFQLG
                     AFGSSLEAGLGFNTWLSPKFALHGDVVYQQKLTKAGFSGASFSGGLRYQF"
     CDS             435340..435828
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_03440"
                     /note="possible pseudo due to internal stop codon"
                     /product="hypothetical protein"
                     /protein_id="GFF01910.1"
                     /transl_table=11
                     /translation="MTSTLLIAISFAICSWVGVNANVTINHVSGTTTVSTSPQKVIIF
                     DLASLDNMNRLGIKAIVGVPGGKKSIYLQQFDDAEYEKIGTLFESNYEKIATLQPDLI
                     TISLCTQARYKGLSKVAPTIDLTIGNQNSLEYIKWNASILRKFFGKGKENEQEIVKLN
                     EN"
     CDS             435877..436035
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_03450"
                     /product="hypothetical protein"
                     /protein_id="GFF01911.1"
                     /transl_table=11
                     /translation="MTFGGKISALGLKSRFDILYSEFGTALATNKITVQKHGQLISLE
                     FILETNPD"
     CDS             436310..436618
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_03460"
                     /note="frameshifted, insertion at around 436816, deletion
                     at around 436690,436615"
                     /product="hypothetical protein"
                     /protein_id="GFF01912.1"
                     /transl_table=11
                     /translation="MLFCWKIIQRENYWITIIILALLSILSIFIGYSDVTPSDLLSGD
                     PHAWLIFWQTRLSRTIAVLLVGAALALPGMIMQLLACNHFVEPSTAETVEAASLGIFL
                     "
     CDS             436995..437294
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_03470"
                     /note="frameshifted, insertion at around 436787, deletion
                     at around 436959"
                     /product="hypothetical protein"
                     /protein_id="GFF01913.1"
                     /transl_table=11
                     /translation="MLFGLFIIASITAVVVFCTVGRIPFVGLIIPNLVSNFMGDNMRH
                     TAPWIAMSGAGMVLICDFLRRIIHPSLEIPINTIMGVIGSFIFMILLLCWRKRLG"
     CDS             437287..437766
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_03480"
                     /note="frameshifted, deletion at around 437721"
                     /note="possible pseudo due to internal stop codon"
                     /product="hypothetical protein"
                     /protein_id="GFF01914.1"
                     /transl_table=11
                     /translation="MDKKKTATLILTTLIIMACIVISLYMTWNINIYTWLFRLIKLIS
                     LLLISYTITVSIILFQTVVNNRLLTPSLMGFDQLYILIKTLTIYFLRSLALPFLNEEE
                     QLILEALILTLFSISLFRWFFSGDLKGLHLTLLVDVILGGFFLVYACSCNCNSIQTK"
     CDS             437928..438230
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_03490"
                     /note="frameshifted, deletion at around 437709"
                     /note="possible pseudo due to internal stop codon"
                     /product="hypothetical protein"
                     /protein_id="GFF01915.1"
                     /transl_table=11
                     /translation="MDYHKSATAILIFVSILVSISTTLVGPVTFFGLLVANLAYELSP
                     QAKHGIVVPIAILLAIIYLVGGQFILEQIFHMAGRLSFIIEFCGGIVFLTLLIKGK"
     CDS             438292..438777
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_03500"
                     /note="frameshifted, deletion at around 438316"
                     /note="possible pseudo due to internal stop codon"
                     /product="hypothetical protein"
                     /protein_id="GFF01916.1"
                     /transl_table=11
                     /translation="MPSSSKGGIIALIGPNDSGKSILLMLIRRLLPRHKGTIHINNFD
                     IDKTPHDLLVQKISILRQNNPLSFHLIVYDLVSFERYLYSKGWYNKEDKQFIDSVIRY
                     LGLQDLKDYFLNELSGGQRQRAFIAMIICQDTDYLLLDEPLNNLDMKHAVSMMKPPHS
                     R"
     tRNA            439072..439145
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="BH623125_t00150"
                     /product="tRNA-Gln"
     CDS             complement(440508..441638)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_03510"
                     /product="hypothetical protein"
                     /protein_id="GFF01917.1"
                     /transl_table=11
                     /translation="MGYKIEYMAVIMAAVALSGCFNFDSERTKREERLHSAFMDWAMR
                     EKSLAKNYTAIIMADPQPWRLNSGDANGLSNRKPWLKINEQVASVIKAHKAAFHIVNG
                     DLTEFGQQKNYDDYKSVYKNLGSPVYEGLGNHDYANNVGNCTEPETFNFYKDACAISA
                     VSRMVSEIKKYRSQLSHFNADIAESSIPMPSGDMHVIEGSLSYSWDYGDIHYVQLHNY
                     PSYRVRLKGQSMEVHINASLDWLREDLAAADARGKITIINFHDGRAASIDGESFFIRK
                     KNAKDLSLFKSIITSHNVKAIFVGHTHYQSYCRAKNDKVFGNIPVYTAGALFNGDYYF
                     IDVKGKSIHVKAYNGEIGKPLLIKDLGIIGKDTEFSVNCSHL"
     CDS             442751..443839
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_03520"
                     /product="hypothetical protein"
                     /protein_id="GFF01918.1"
                     /transl_table=11
                     /translation="MSLGIVTKESNLTLKNIVLHAFSILEADDHSQITISGGSFDRGI
                     EGIYVLNGSTITIKDNAKITTYIDIGLLADGSQSEITMTGGTVSGAFSALSAENGDHI
                     DIKDVAITTIDENDNGYSVYSNGTGSIITLHGNTTIKNVSTGLVVNKDGIIKMTGGSI
                     MAYINGTNFSGNKKDENKLKDVIISSYNDDTLLHERMYVAYNSKLSLENVTITQAEDG
                     IFAKSNSQVTVSKRLVSTKTTRVYTESGSVITVKDKAEIISSNGSGLHANGRQSKIKM
                     IEGTVNAKKGALYTDNGEDIDITNVSATAKIGGLQFMSLLYIIPDELNDPQNYQNSEI
                     NLTNTKIHVDNGTGFSLKLLLIIPLEIL"
     CDS             444141..444584
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_03530"
                     /product="hypothetical protein"
                     /protein_id="GFF01919.1"
                     /transl_table=11
                     /translation="MSVLNLNNSSIIFDSPTEDHYQTLHIGSGKPNTTAVYNASGDAK
                     IYFNTAWNDDKPIANQKTDCLLIHGDLKGSTTVYIKSDFRDKNSVVNTSDPLNTRGIS
                     LIQVSGKAEEDSFKLVNDYTTINGSPDKYMATCLWTRIKPWQSQY"
     CDS             444496..444984
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_03540"
                     /product="hypothetical protein"
                     /protein_id="GFF01920.1"
                     /transl_table=11
                     /translation="MIIPQSMDHLISIWLHAYGPESSHGKANIEQNLFDNNDENFWNF
                     SLQPEFLNSNPNSGSNPGPNPSPGLHVHAIALQMASYFVMPNALFYTGLTDMAKQNVL
                     LANRRISLLEKEQEKQSGFFLYTPMEVQETSPLKVLLVNMVIAVLIFTTLLSKEVLTS
                     QR"
     CDS             445056..445367
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_03550"
                     /product="hypothetical protein"
                     /protein_id="GFF01921.1"
                     /transl_table=11
                     /translation="MQDVSKNTVDKWSLTAYGSMQDDRGFYLDTLLFYGILKGDINNA
                     IIGKTAKVKNAKIWSISTTISKQFATGMEKVTFEPQAQLAYQHLICLTLLQMLMALKL
                     I"
     CDS             445322..445681
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_03560"
                     /product="hypothetical protein"
                     /protein_id="GFF01922.1"
                     /transl_table=11
                     /translation="MFDTFADADGFKVDMNNPHQWMIRVGGRLTKTVTTTENGRSFSF
                     YGKVNATKTFGEDQTIHIDKDYKLDPMGSFLEGELGISAQLSPDISLHGDVNYQQKLQ
                     KTGISGASFSGGIRYQF"
     CDS             446671..450996
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_03570"
                     /product="hypothetical protein"
                     /protein_id="GFF01923.1"
                     /transl_table=11
                     /translation="MSKKILLSYTTTAAIILFNIHSNAYAISLFSGEGENKTAPTQES
                     YENIYALDGGKIHGKDLKIIGPSTQEESIITDISGVEARKFGSMIELEGDTTIKNVSI
                     GLLAKESGTIKMNDGSIQVKKVHIQTPIGIAAVSNGAIILNNVEIDASNQEQSIKTID
                     ETGIGDGTGASLKSGGTLSMTGGSIKSNYLGITLEESSSDKNKLENVKINITNLANAT
                     KESIGIRVIKTSKVTLNQVTIRHARTSIHASDSSEITISGGLIQGNHTGINVEKESVI
                     TLKNDVEVLSNDHGLSANGLHSKITMQGGKLITAGLQPAVLAGSGGEINLINVVVHID
                     DLTDIVMHIDDNETQTQKLELERKEAPLTTQGLQAQYAQSKITMIRGSITTTGLNPAV
                     LAGSGGQIDLTNVPMKVHNVGLQAQAEQSKIVMTRGSITTTGMNPAVLAGSGGEIDLN
                     DVVIKTKDIALQAQDKQSKITMRGGKLIKTGPRAAIFVTCGGQIDLLDAQLHTDSNGL
                     AVRGRESKITLKDSEVRANILLVGKPNDEDDNGEANVIADHSILEGGARNSERKPTQI
                     IFSLINGTTWYLKANMQSHKIQKLDLIKKLHSEVFKLNLNNSTIVFRTPREDQYQTLH
                     IGNKSPHLTNNNTTHKTVYNATGDAKIYFNTEWNNEVPKEQQKTDRLLIHGDVSGITT
                     IHFRNLLKGKKTKEKNTGPVNTRGLSLVQVSGKAEENSFKLANGYTTIKGLPYKYTLN
                     AYGPTSSRGKASIEQSFVGEEEDFWDFRLQNAILDAEETISPDTQETNFFNSEEITPL
                     NTEETASLNDGETTPLYSKKAASPDAEETISSDTQETNFFNSEEITPLNTEETASLND
                     GETTPLYSKKAASPDAEETISSDTQETNFFNSEEITPLNTEETASLNDGETTPLYSKK
                     AASPDAEETISPDTQETNFFDSEEITPLNTEETASLNDGETTPLYSKKAASPDAEETI
                     SSDTQETNFFNSEEITPLNTEETASLNDGETTPLYSKKAASPDAEETISPDTQETNFF
                     DSEEITPLNTEETASLNDGETTPLYSKKAASPDAEETISSDTQETNFFDSEEITPLNT
                     EETASLNDGETTPLYSKKAACLNAKGKVRALVPQVASYLVMPNALFSAGLAELNNQNI
                     LLENMRTTLFEAKDKKEDNKKSGIFLSSYGHKITLSSNRSPLHYGYGADVHYTAIQAG
                     MTLAALEGQNSTTHFGLLGTYGQLSFTPKGMEGADKSTLDKWSLAAYGNIQHNDGIYV
                     NALFSYGAFKGNITTALIGNTAKLDGSHTVSASATIGHKLETDAKGLVFEPQAQLLYQ
                     RLMLGTLSDIDGFNVNMGKPHQWLLRIGGRLTQTIPSDEKGYATSFYGKLNLMKAFSN
                     KSTVQIGDTFYLDAMGDSVEGGLGVNAQLSQNFALHADINYQHKLQKAGVSGINFSAG
                     MRYQF"
     CDS             452281..454902
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_03580"
                     /product="hypothetical protein"
                     /protein_id="GFF01924.1"
                     /transl_table=11
                     /translation="MCKKSNKKNFLLCTIAGTLIFSHFGSTHAKTLLHHEIPTVRTTN
                     GEEKKLNNVFIHTGSSGVHATKKAVATVTKETIHEIPEIQVTDGKEKAFDNVFIRTGS
                     SGVYATKKAVATVTKATIHANSFALAVSTGGRVNAKEIEANVLQGGLSITNGIINVQD
                     SIIEAKKESGIIFHKILDFFVKEGEEVVNKAILNNTKLLVRDGVGIVGPLSSKSVAEV
                     QLRNSEIRSDVLLKNHLKKATDSDPHPVTLILTADNSIMEGRARTLQVNTTVFNLSNN
                     SKWYLNVSQYDVDRDSSVFNYALHDIQQRALSTVSVLNLHNSSIVFNAPHALANGHYQ
                     TLSVGKIQTAEDSRLQENRDSSLATVYNATGNAKIYFNTEWSDGLPKEKQKADRLLIH
                     GNVSGTTTIHINNLSKGEITRSKDSIPLNTRGLSIVQVSGKAEENSFKLANGYTTIGG
                     LPYKYTLNAYGPTSNRGKANAEQSRLGEVSQESKENAPVTNTNHLVLGGVVVEIEQDI
                     KGEPTSNRGKANAEQSLGGENKNFWDFRLQSATLDDEGEIRALVPQVASYLVMPNALF
                     SAGLAELNNQNILLENMRTTLFEAKDKKEDNKKSGIFLSSYGHKITLSSNRSPLHYGY
                     GADVHYTAIQAGMTLAALEGQNSTTHFGLLGTYGQLSFTPKGMEGADKSTLDKWSLAA
                     YGNIQHNDGIYVNALFSYGAFKGNITTALIGNTAKLDGSHTVSASATIGHKLETDAKG
                     LVFEPQAQLLYQRLMLGTLSDIDGFNVNMGKPHQWLLRIGGRLTQTIPSDEKGYATSF
                     YGKLNLMKAFSNKSTVQIGDTFYLDAMGDSVEGGLGVNAQLSQNFALHADINYQHKLQ
                     KAGVSGINFSAGMRYQF"
     CDS             456187..458529
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_03590"
                     /product="hypothetical protein"
                     /protein_id="GFF01925.1"
                     /transl_table=11
                     /translation="MCKKSNKKNFLLCTIAGTLIFSHFGSTHAKTLLHHEIPTVRTTN
                     GEEKKLNNVFVRGEYNAAIANTGRIIITNSIMHSDGTLLAGVAGGRLNAKGIIGKTKE
                     RGLSLTNGIINVEDSIINVTEHGKGYGIIFDYILSSKIKEGEEVVNKAILNNTKLLVR
                     DGVGIVGPYYSKAVSNEVHLKNSEIRSDMLLKNKTAPGNTEPATFTLNADNSIIEGRV
                     KTFPQNKTVFNLNNNSKWYLKISLFEMEDDFSLFDYKLLDIKQRAQSIVSVLNLHNSS
                     IVFSAPHKLVNGHYQTLHVGKIQTAEDSRLQENRTSNLATVYNAIGDAKIYFNTEWSD
                     GLEKEQQKTDRLFVHGNVSGTTTLYFKNLSKNEETKEESAVPLNTRGVSLVQVFGKAE
                     ENSFKLANGYTTMGGLPYKYMLNAYGPTSNRGKANAEQSLGGENKNFWDFRLQSATLD
                     DEGEIRALVPQVASYLVMPNALFSAGLAELNNQNILLENMRTTLFEAKDKKEDNKKSG
                     IFLSSYGHKITLSSNRSPLHYGYGADVHYTAIQAGMTLAALEGQNSTTHFGLLGTYGQ
                     LSFTPKGMEGADKSTLDKWSLAAYGNIQHNDGIYVNALFSYGAFKGNITTALIGNTAK
                     LDGSHTVSASATIGHKLETDAKGLVFEPQAQLLYQRLMLGTLSDIDGFNVNMGKPHQW
                     LLRIGGRLTQTIPSDEKGYATSFYGKLNLMKAFSNKSTVQIGDTFYLDAMGDSVEGGL
                     GVNAQLSQNFALHADINYQHKLQKAGVSGINFSAGIRYQF"
     CDS             459716..459910
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_03600"
                     /product="hypothetical protein"
                     /protein_id="GFF01926.1"
                     /transl_table=11
                     /translation="MTLNTSPKVQLNLPLKINIAEQTTVDTRKPSKFADDKKTPILSH
                     ATLECEAKSSSYTTSGKTTW"
     CDS             complement(461075..461272)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_03610"
                     /product="hypothetical protein"
                     /protein_id="GFF01927.1"
                     /transl_table=11
                     /translation="MGFVGEDSKIGRFLDFADFTGIEREAPAEDSSAPERFLFLDTNV
                     RDAGSPSCSAFKLLFLFFFSE"
     CDS             461376..463586
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_03620"
                     /product="hypothetical protein"
                     /protein_id="GFF01928.1"
                     /transl_table=11
                     /translation="MTKQNVKIHDNYVAVHAQEANSKVKIIGGSVSSNFIGLSTLAGG
                     TIDATNITTTVTSVGLLNTNGTIILKDSTVNVTGNDKTHGIVLRGMQNPSGNQQAQNA
                     GREGNVHHEKDMRNKVMLTNTKILVQNGIGIGVYGAHASGEVTLKDSEIRADMLSKNE
                     KNIEAPAHILTLNADHSILEGGVKTLADNKTFLNLNNNSTWLLTAPRKRESNNDPSHG
                     HDIDEKLHSNLSGISLTESSIVFGTSTDGHYQTLFVGSQSQEADQTPNNPIVYKATGA
                     AEIHLNSEWSNNSPMHKQKTDRVIINGDVSGSTIVHINFLESGNKGTKSTAVWKEEMV
                     STSSTAHGISLIQVSGNADKNSFKLEKGYLTMGGTPYKYVLTAYAPGTSDASQNLFGK
                     NDQNFWDFRLQSAYVDSDKKVRALLPQVANYLVIPNAVFSAGFSEVNNQNMLLNNMRT
                     TMFGAENHNKNGIFLSYYNEKVTLSSNRDPLHYGYGADINYDAVQLGIIMNALEGKNI
                     NTQFGLLGTYGKLSFTPKDMQDSEKTKLDKWSLTAYSGIQHSMGLYMNALLSYGVLKG
                     NVTTALIGTAAKLDGTKTLTLSATLGQKLTTGLQGLMFEPQAQFIYQNLMLDVLSDAD
                     GLKVDMDNPHQWLVRIGGRLTKNLTTTEEDNDHAVSFYGKLNVLRTFGDGGAIQIGES
                     FYLDPTGSSIEGGVGVNAHIAQKVVLHGDISYRHKLQKAGVSGTNFSGGIRYHF"
     CDS             complement(464779..464964)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_03630"
                     /product="hypothetical protein"
                     /protein_id="GFF01929.1"
                     /transl_table=11
                     /translation="MLFVFVYDRENLRVNDREIRWMDDIFIIEGGYFLLSLESYLKVL
                     AVLSYLLKVFLYRDRCV"
     CDS             complement(465328..465771)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_03640"
                     /product="hypothetical protein"
                     /protein_id="GFF01930.1"
                     /transl_table=11
                     /translation="MSVVQYGDDSFASKAKVFNNDLIDRDWAMTKFVAAVKNLAQVID
                     YESNMLENSGVPDYEEINVCKTRGLSDLNKSIGDIKRYMNEDIENEVESLLSDLQEKL
                     RRNSELLKIHLDAVNDLSYAMQTASCTKEMDEISDPILLNIGRSK"
     CDS             complement(469626..469856)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_03650"
                     /product="hypothetical protein"
                     /protein_id="GFF01931.1"
                     /transl_table=11
                     /translation="MNKKIKIGTKPTNKSIPLTADAWVGNHKGCRDGGMKRLTIDVPE
                     NLHRLIKMSCASRGTKIADEVRELLSQKYGKV"
     CDS             complement(469853..470482)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011082882.1"
                     /locus_tag="BH623125_03660"
                     /product="cobyrinic acid a,c-diamide synthase"
                     /protein_id="GFF01932.1"
                     /transl_table=11
                     /translation="MIIGLLNQKGGVGKTTLSVNLAASFARTGARVLLIDVDPQGSAL
                     DWAAAREGAPLFPVVGLPRATVHKEITQIGHNYDHIIIDGPPRVTDLARSALMASDFV
                     LIPVQPSPYDIWAADGIVKLIDEARVYKENLKSAFVINRKIVNTAIGRDVGEALGVYP
                     VHVLSANVAQRVIFAEAATQGKTVYEVDKQGLAAAEIEAVAAEIKELAQ"
     CDS             471596..471925
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_03670"
                     /product="hypothetical protein"
                     /protein_id="GFF01933.1"
                     /transl_table=11
                     /translation="MNLQQIDSDIFISTQISVENIETLAQTGFKTIICNRPDQEDPHQ
                     PDFSIIQGEACKYGIKAYHIPIVPPTIKKSDIEIMKTILKTASLPLLAYCHQGTRSMH
                     LYRLARL"
     CDS             complement(472174..473175)
                     /codon_start=1
                     /gene="ribF"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A9CK17"
                     /locus_tag="BH623125_03680"
                     /product="riboflavin biosynthesis protein"
                     /protein_id="GFF01934.1"
                     /transl_table=11
                     /translation="MSDFLRLQGIDMLPLVWKGAVLALGNFDGVHCGHQVVLQKALDL
                     ARMRNKPALVLTFEPHPRSFFQHSAPIDRLTEAPEKAEIFKILGFNGVIEQPFDAHFA
                     ALSADEFINVILKKAFEVSVVVTGENFQFGRQKSGNSRLLCQKGEEWGFEVVQIPCVS
                     SAPNSQSVIISSSVIRKLLSQGQVEKAARLLGYHYRVRSNIIQGEQLGRLLGFPTANQ
                     ILPPQASLAYGVYAVRLRRANGVLYDGVASFGCRPTVVKNAAPFLETYLFDFNGDLYG
                     ENCTVSFFQFLRKQEKFDGLEPLIAQMHHDKKKAKAILAAVQPLSQLDQLLTFKNRT"
     CDS             complement(473175..474020)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013532364.1"
                     /locus_tag="BH623125_03690"
                     /product="haloacid dehalogenase"
                     /protein_id="GFF01935.1"
                     /transl_table=11
                     /translation="MNELTHIDTVIEDYDAVFCDVWGVVHNGVHAFEPALKVLHKIRK
                     MGKNVIFLTNSPRPRENIVDQLQSMNVHSDCYDAIITSGDVTRDLIRAAPRRVFFIGQ
                     QRDLVLFEGLDCELVEEWEASVVVCSGFLEGFEEKPSAYEDMFHRMRARNLPFICANP
                     DVIVHYGNQQFWCAGALARLYQQLGGEVRIAGKPHAPIYECAFEKLQKIRGAVEKSQI
                     LAIGDGLLTDVKGAVHFGLDVLYIMGGIHRYDYLQNGMVDKQALHSFLEHHGYKPQAV
                     MWALQ"
     CDS             475472..475714
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_03700"
                     /product="hypothetical protein"
                     /protein_id="GFF01936.1"
                     /transl_table=11
                     /translation="MKKIILLCRAALLALTVAGCEKIHSVEEFKKNEKLRDAWGKKCL
                     IENAIKSSKNCQNLLQADNEIFFSQKPVSTKREHSF"
     CDS             complement(477674..478417)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_03710"
                     /product="hypothetical protein"
                     /protein_id="GFF01937.1"
                     /transl_table=11
                     /translation="MKFLSKYVKRMRFKLIVILYIVGSMLWGVSQYKDKIDFSFLTPL
                     RMQDIQDIVEMPLEEKKTTESITKQQFTKNEPVFNLQKSISPNSVVIFHGRASVTSGV
                     TFKLVTPVAQSWRKHITRNIHLYGVDTCAPRQKAKLDDQEWPCGAVTTAWLVTKTLGQ
                     DLSCKQALMRNGIYYAQCFVQGVDLAEAGLAEGMLVLSQGDKNPAPAHYRSVEEVARN
                     KKVGLWSSDFIEPLQWRKDHGAYNPFANL"
     CDS             478785..479108
                     /codon_start=1
                     /gene="virB2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015887125.1"
                     /locus_tag="BH623125_03720"
                     /product="VirB2 type IV secretion protein"
                     /protein_id="GFF01938.1"
                     /transl_table=11
                     /translation="MTDTISRNIIFIIIMLLLTALVVSDPSYAAAATGSASGLGNVDN
                     VLQSIVTMMTGTTAKLIATICVAAVGIGWMYGFIDLRKAAYCLIGIGIVFGASALVSK
                     LTSAS"
     CDS             479109..479420
                     /codon_start=1
                     /gene="virB3"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015887126.1"
                     /locus_tag="BH623125_03730"
                     /product="type IV secretion protein VirB3"
                     /protein_id="GFF01939.1"
                     /transl_table=11
                     /translation="MNEDPLFLACTRPAMFAGVTMEAMAFNVMATSILFILTSGFTMI
                     GLGIGLHFVLREITKHDHNQFRVLFAWLNTRGKQKNLNRWGGGSTSPLRLIRTYEELN
                     R"
     CDS             479432..481780
                     /codon_start=1
                     /gene="virB4"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015887127.1"
                     /locus_tag="BH623125_03740"
                     /product="transporter"
                     /protein_id="GFF01940.1"
                     /transl_table=11
                     /translation="MMKRESLPEDYIPYIRHINQHVIALNSRCLMTVMVVEGVNFDTA
                     DIDQLNSLHNQLNTLLKNIADERVALYSHIIRRRETIYPESQFFSSFAATLDEKYKKK
                     MVSQELYRNDLFVSLLWNPASDKTEQLASFFQRLAKAKKTQSEPDQEAIRKIEELSQD
                     LIEGLESYGARLLSVYAHGGILFSEQSEFLHQLVGGRRERIPLTFGTIASTIYSDRVI
                     FGKETIEIRHESNERFAGMFGWKEYPSKTRPGMTDGLLTAPFEFILTQSFVFKSKAAA
                     SVIMGRKQNQMINAADRASSQIEALDEALDDLESNRFVLGEHHLSLAVFANHPKALAE
                     YLSKARAHLTNGGAVIAREDLGLEAAWWAQLPGNFSYRARSGAITSRNFAALSPFHSF
                     PIGKLEGNVWGTAVALLKTQAGSPYYFNFHYGDLGNTFVCGPSGSGKTVIVNFLLAQL
                     QKHNPTMVFFDKDQGAEIFVRAGGGKYKPLKNGQPTGIAPLKGMEYTEKNKVFLRNWV
                     LKLVTAEGQTVTEEERQDIAKAIDALGNLPHAQRSLSALQLFFDNTSKEGIAIRLQRW
                     LKGNDLGWVFDNDQDDLNLDSQFIGYDMTDFLDNEEIRRPLMMYLFNRILDLIDGRRI
                     IIVIDEFWKALEDDSFKAFAQDRLKTIRKQNGMMLFATQSPKDALNSTIAHTIIEQCP
                     TQIFFPNQKANYKDYVEDFKLTEREFELIQSELSRESRRFLIKQGQSSVVAELNLRGM
                     NDEIAVLSGTTKNIELVNQIISEYGADPDIWLPIFHQRRENQ"
     CDS             481777..482223
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_03750"
                     /product="hypothetical protein"
                     /protein_id="GFF01941.1"
                     /transl_table=11
                     /translation="MKKYSLVTLLSLFCISHAKAQTATLTDEYYKKALENTQKLDVAK
                     SQTAESIYESATQTANKIKDINNQLANLKADTKTKPEQLQALQIELTLLQAQLQADTL
                     KIQSLAMIQAKDTKTKEELREEQTQKKHEDLQKQLKEKLEKSDVRL"
     CDS             482210..483175
                     /codon_start=1
                     /gene="avhB6"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010974426.1"
                     /locus_tag="BH623125_03760"
                     /product="type IV secretion protein AvhB6"
                     /protein_id="GFF01942.1"
                     /transl_table=11
                     /translation="MSDFSFSPFESISGYILQPLNNVMNTTVSGLSSAISAPLNLASI
                     IFIFLYGYNVMTGRVALSMNSLLNNVVKIVIVTTMATNADTFNTYVKNIFFGDLANAI
                     GNALNSNPSSANVFDYILLKTSARYQEVLAAAWFLEKIMVGLLGSLMIMAVIVFCIGG
                     FIVQMFAQVALVMIIGLGPLFISLYLFNATRKFTDAWITTLVNFTILQVLVIMLGTIM
                     CKIILYVLDGTYESIYFLFPPVVVISIVGAILFRALPGIASALSSGGPYFNAGISSGG
                     QIFTMLSSGAKTGRNAAKSAASTLSGAAGTATKAAKIGGNGRGRF"
     CDS             483354..483713
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_03770"
                     /product="hypothetical protein"
                     /protein_id="GFF01943.1"
                     /transl_table=11
                     /translation="MSSCVVFKSIYEFKKMKQKITFVMILIIALTGCASLTGPKKPPR
                     CNGKVTRALNRDKWDWDNKNLILQEKNVKPVRTPIILNTLENEKATATVTLKENSLNS
                     ITRETLPENTMEIAREN"
     CDS             483703..484371
                     /codon_start=1
                     /gene="virB8_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010967689.1"
                     /locus_tag="BH623125_03780"
                     /product="conjugal transfer protein TraJ"
                     /protein_id="GFF01944.1"
                     /transl_table=11
                     /translation="MKINEFNEYIKEARSFDIDRMHGMRQRMRIAMALTVLFGLMTIA
                     LALAVAALTPLKTVEPFVIRVDNSTGIIETVSALKETPNDYDEAITRYFASKYVRARE
                     GFQLSEAEHNFRLVSLLSSPEEQSRFAKWYAGNNPESPQNIYQNMIATVTIKSISFLS
                     KDLIQVRYYKTVRELNDKENISHWVSILNFSYINAQISTQDRLINPLGFQVSEYRSDP
                     EVIQ"
     CDS             484368..485234
                     /codon_start=1
                     /gene="virB9"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010967688.1"
                     /locus_tag="BH623125_03790"
                     /product="P-type conjugative transfer protein VirB9"
                     /protein_id="GFF01945.1"
                     /transl_table=11
                     /translation="MMRILKTLFLAFIAAISCYTTPSFAETAPVSARKDNRIRFVNYD
                     PYNVTKIIGSIRSSVQLEFADDEEVTYVGIGNSVAWQVAPAGHFVFLKPREVQPVTNL
                     QIVTSRQDGTKRSYQFELQVREGDVSAGNDTYFLVKFRYPEDEALRKKLAEAAKAAQR
                     EENFVNDIFNTHEDFGPRNWAYEAQGSPLIEPASVYDNGKTTTFTFLGNTEIPAIYLV
                     SLDGQEALVPKTIKGNKVIVHATAAQFTLRRGNDVLCIFNKRFVPAGVNPETGTTSPS
                     VQRKVNIGNGYE"
     CDS             485227..486390
                     /codon_start=1
                     /gene="virB10"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010967687.1"
                     /locus_tag="BH623125_03800"
                     /product="type IV secretion protein VirB10"
                     /protein_id="GFF01946.1"
                     /transl_table=11
                     /translation="MNDPMDENNLLNDRDMIKDGHGKKQRPNTSKAAALVILFGVCLY
                     LAYSTLFTEKQQPVEVQKEGIIKQTELFRPAPPKPVSLEPTIEKNNVLLPKVELPTPP
                     KKTTNSDDSLLEAAQRAPVLAYANTQKGQGSTEKNKDISANQPEAKPDETAQRFNHLL
                     KPTTLEGIRAAKLGNRNYIIAMGASIPCILETAISSDQQGFASCIVSRDILSDNGRVV
                     LLDKGTQIVGEYRAGLKKGQKRLFVLWNRAKTPNGIIITLASPATDALGRSGMDGDID
                     NHWLERIGSALLVSIVKDATNYVKGRLPKDQDKNNSETISSGQNIANIAVENYANIPP
                     TLSKNQGEMVNVFVARDLDFSNVYKLKVIENKKQIVNRALSRNFYKNSAVILQ"
     CDS             486387..487457
                     /codon_start=1
                     /gene="virB11_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_015887135.1"
                     /locus_tag="BH623125_03810"
                     /product="P-type DNA transfer ATPase VirB11"
                     /protein_id="GFF01947.1"
                     /transl_table=11
                     /translation="MNQNLHTLSDETVAIVLTKLEPISTFLKDENLFEIVINRPYQVM
                     TEGVEGWKTIETPALSFNELMGIAKVVASYSKQNISEKNPILSATLPGNERIQIVIPP
                     AVEKNTISMTIRKPSSRSFSLEDLANKGLFSVCEQVSFTPLNNYLSHLSELKHIDHDL
                     VRAYAKKDFVFFLNQAVQCQKNILIAGKTGSGKTTLSKALIAKIPDDERIITIEDTPE
                     LVVPQPNYVSMIYSKDGQGLASVGPKELLESALRMRPDRILLQELRDGTAFYYIRNVN
                     SGHPGSITTVHASTALAAFEQMTLLVKESEGGGDLERDDIRGLLISMIDIIIQCKRIE
                     GKFKVTEIYYDPFKQRNIFGGN"
     CDS             487525..487731
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_03820"
                     /product="hypothetical protein"
                     /protein_id="GFF01948.1"
                     /transl_table=11
                     /translation="MTVEATENLLSITLEELKKRREAVDAVISTHALEGIALHPKTLK
                     ILEGYARGNTSLEEFNTLMDNAKL"
     CDS             487742..489376
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_03830"
                     /product="hypothetical protein"
                     /protein_id="GFF01949.1"
                     /transl_table=11
                     /translation="MPKAKAKTKNTEIISPHHYVYPNTTTLKNKYGIKNLNAFLEKCS
                     HDTAKAMINLREESLPEYFDTAYLCHIHQQLFKNTFEWAGYLRHIPFTFADGTTAAMP
                     EMKRTGWKNAFAIGDEIQEGLQRLDQTLAEKNNLQGLTREEFNSEAIELFNSLNQLHP
                     FREGNGRTQRLFFENLAKAAGHQLNFSLITKERMMVASVAVAENGDLEPMQHLFEDIS
                     NPEKIRLLKEFMHTMKNTGRNVNDRPVMVAKEGETYTGTYRGAGLEGFALNVKGAYII
                     GNIDHLPPEQLKILKPGDKITFTAPKAEELKKTLIPKETLVPLTKLEIAEMVAEDAFV
                     HTCRDQICSLSKIVYGSQGVLNKNIIEIIKNPSKGQQLATQIERTPYSVHSLAGFDLI
                     CFKTGARVRAEKHVALLSCAVANFTHAVKHARQEITKEHQAEQNRLRQEVPMPSQSLQ
                     DLLSLPKEFQQKALGVSPLLQKELTSLLQKVNSRLSSSEQRALRENNHETLAKNLGVS
                     EQKAKEITKTVMKAREVQQKSQTRTVSHSKTLAMAS"
     CDS             489539..491458
                     /codon_start=1
                     /gene="traG"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010967483.1"
                     /locus_tag="BH623125_03840"
                     /product="Ti-type conjugative transfer system protein
                     TraG"
                     /protein_id="GFF01950.1"
                     /transl_table=11
                     /translation="MKYTKTQLALISMPIASGALTIFLVPHMLSFVINDLKTNQIYWY
                     VRSEPLLTLMLVAAVSLFYTLSQKLHLRKAITFVSTAFFCITALYYIGSEIKRLNPYV
                     GQQGITWGYALKFMDPMVVFGVILGFVLLAIQVIITSPRTSNVKRAKKGIFGDAAWMN
                     LKEAARIFPSNGQIVIGERYRVDQDNVRNIPFAPGNKTTWGKGGTAPLLTFNLDFGST
                     HMIFFAGSGGYKTTSTVVPTCLTYTGPIVCLDPSTEIAPMVKFARKKMGNRNVIILDP
                     NSLLTKNFNVLDWLLDENIPRTRREANIVSFSKLLLSEKKSENSSAEYFSTQAHNLLT
                     ALLAHVIFSDKYEDSERNLKTLRAILSQSETAVVNQLRMIQETTPSPFIREMVGIFTE
                     MADQTFSGVYTTASKDTQWLSLSNYADLVCGNDFASSDIANGKTDVFLNLPASILNSY
                     PAIGRVIIGAFLNAMVTADGNYKKRVLFVLDEVDLLGYMNILEEARDRGRKYGTSLML
                     FYQSSGQLVNHFGEAGARSWFESCSFVSYAAIKDLQTAKDISERCGQMTIEVTGTSKS
                     RGLSLTKGSQNINYQQRALILPHEIIQEMRQDEQIILMQGHPPLRCGRAIYFRRKEML
                     AATEKNRFAPQAKKS"
     CDS             491678..491950
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_03850"
                     /product="hypothetical protein"
                     /protein_id="GFF01951.1"
                     /transl_table=11
                     /translation="MRTNHIYLKIPLKKLLKKALLQENRLEKFFTKNKKTPFMKTTKT
                     DPSLLKKEKSTKIRIGTSKNTHEFEGSLFPRSKLEISKEHARGNIS"
     CDS             492000..493628
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_03860"
                     /product="hypothetical protein"
                     /protein_id="GFF01952.1"
                     /transl_table=11
                     /translation="MPKAKAKNISTASPHNYIYPGTQILKNKYGETDLKLLLEKCLHD
                     REQAMMNLRAESLPEYFDCAYLCYIHQQLFQKTFEWAGHLRHTPFTFADGSIAAMPEM
                     KRTEWGKDFAKSEKIPELLQKLDQELAEKDNLQGLTREEFIKQATELFYSLHKIHPFI
                     DGNEHTEQFFFENLAKAAGHQLDFSLVTQKRMMAVCSEAMQYGDTQLMKDLFEDISNP
                     EKIRLLKDFMNNINNTGRNVNDCLVMVTKAGETYRGTYQGCYSEAFVLDMQGTYIIGK
                     KDDLTPERLKSLKPGDTITFIAPKNKELENTLIPKETLAPLTKSECARTVAQTSHVLT
                     AQKKVRQHSKIVYGNANTLNEQIEEITKNPELGQLLADQIRQTPHSLSPLAGFSLCGL
                     QNPARANARNHLDALATTVANYAHIVEHTYHVITQKHQIEQERLGKTVEKPSQNLQNL
                     FALSPEQQREILSQSPQLYQELRTFICCVEHRLSSNEWSAIKNKDYETLAQSIGVSEQ
                     TAREITNTVQKARELHKQVYTHAITRSNTLAIAS"
     CDS             493782..494006
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_03870"
                     /product="hypothetical protein"
                     /protein_id="GFF01953.1"
                     /transl_table=11
                     /translation="MSTFLNARITADGNYKKRVLFILDEVDLHGYRNILKGRSFYLPE
                     KRAKMNKLFSCKNIPLYDVVARSILEGKKC"
     CDS             494698..496296
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_03880"
                     /product="hypothetical protein"
                     /protein_id="GFF01954.1"
                     /transl_table=11
                     /translation="MLEHNYLYKNSNTLKNKYGIKDPQRLYERCAHDTAREVMNLRFE
                     PPPQRFGLAYLKLIHWTLFHRSFEWAGHTRDEPFTFEDGSTARMPAMRPKGHRVPFAV
                     GPQIQKELKQLERKLTAKNNLQGLSRQEFAESAAEVFMTLDHAHPFRKGNGRAQRIFM
                     EKLGQAAGYKIDFSFITKERLTQASIAAMQHGNTQPMKDLFEDITHPQKFLLLKEFIS
                     QMRNSGLEEINEHIVVVAKEGVKYDGIYKGCAAEGFVIELEDGFVVGHKDDLTPEQVK
                     TLQNGDRIVFEKSNVLDLKEILIPKETLPPLTNEELAKRFTDNCGVESYRQEVEHLSK
                     RVYGKSQALNEMIESINIDPSLGAEFADQIAQNPKSFCKLAGRKILGIRSPSRRRAEE
                     AVPQLCEALKSYADMAQHTMENLIEQHQREQRRIAHSVEKPGRDLQQLFTLSPEQQRE
                     VLSHSPTLQKQLHTFARQLQNRLSSEEHRAIQENNPLKLSCMLGVSESKAKEITKAVK
                     QTKEAHCQLRTLKISCSSARALTN"
     CDS             496770..498374
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_03890"
                     /product="hypothetical protein"
                     /protein_id="GFF01955.1"
                     /transl_table=11
                     /translation="MKKNRPSPPTSRSKEQEQEQARTPSPQAEPLYAQVNKPPREHRA
                     QSSEETIYAPQNPPETIYAPQKPLGNPYDRLGGRPRNGRRAKKLVDPYAVTDVQNLDR
                     GADFQTLENPLYEGVGGGAHGGPHPQEPEHLYAELEFDTQSGRSPQKPVESVYATVGM
                     GAEGGQDTQTLKNPLYEGVGSGKTTPPPTPHSTEKEQEQARAPSPQAEPLYAQVNKPP
                     REHRAQSSEETIYAPQNPPETIYAPQKPLGNPYDRLGGRPRNGRRAKKLVDPYAVTDV
                     QNLDRGADFQTLENPLYEGVGGGAHGGPHPQEPEHLYAELEFDTQGGRSPQKPVESVY
                     ATVGMGTEGGQDTQTLKNPLYEGVGPGRATSPPRSPKDEVTSKLLKHTDFQHGVKEVQ
                     EWCKIVYGNQYALNKKLCKILENPKAGDTILWDLAADPESAGKLAGQKILGIKSPDRK
                     QAEEGFGSLCAAFERHVAITQKLHKDFTLEQEKQRGHERETSPERQEHRHHRRHHSQE
                     REQGASEQEARRRNNPTNQKGMAFGM"
     CDS             499240..500094
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_03900"
                     /product="hypothetical protein"
                     /protein_id="GFF01956.1"
                     /transl_table=11
                     /translation="MQEVLQKPSEGEDLSRQVAENPTSVHKLAGRNLCGLKTNARRQA
                     EEGFMHLCQALDGYTSAVTQAQENIKHVPQAEARRYGQESEQRAERLQQSRHPERERQ
                     SLSNQELLGMVQENASIQRYQAQVEHWCKIVYGNSSVLKEKMEGILQDLSEGEELSWQ
                     VAAYPQSVHKLAGHNVCGLKTSARRHAESGLSHLCDAIDNYTDAVRQIKESITRGHQA
                     QTRQNRQEQSVGVKQGLHKEKALSSPKQHGHQTHHQGAEASKRTHQQSPEVPPRKVGG
                     AKAIAFAI"
     CDS             501390..502934
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_03910"
                     /product="hypothetical protein"
                     /protein_id="GFF01957.1"
                     /transl_table=11
                     /translation="MLEAYKEEIKYWCGIVYGDRLILQKRIEEIQENPALGEQLSWEV
                     SEHPKSISKLAGKKMLGVKTKARRKAEENYLALRDTINSYVYTLKYSQQKPLHAPHTE
                     HTRDEQQTHRTQSAEKERAPLSNQELADRIRTEPSVLYSQTEVQYWSKIVFGNPYILQ
                     YRIEDIQKNPDMGEEFSWQVANNPSLFSPLAGKRILGIKNDARRHAEASLSCLCSAIE
                     GYADAVKQAKEDIVQEYQVQQSRQELSTEPAKQLQKQQTLSKPHKLPEHSPTDAHQET
                     TQTSMQTEWERLGARPRTVTTHKKHTQESTLPTSHAEQKTTREQTTENQQKSLTPEKE
                     KTPLSHKEIASRVQNDLSVQRAQIEIYNWCNIVYNNPLVLQHTTEDIKKIPMLGEELS
                     WQVANFSTIFAPLAGKQVLGIKNNARKHAEEAIPSLCTAIDHYTEIVKQVREDIVKNH
                     QEQSPKKDKNVKRQQSLSKPPKLPERSTEIPRHQALEASRQAQQKPSNVRSSEAEKTQ
                     KMVLAL"
     CDS             503221..506250
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_03920"
                     /product="hypothetical protein"
                     /protein_id="GFF01958.1"
                     /transl_table=11
                     /translation="MKKKQPAPSTPSSASVTQMASLSNEEIFNRVQRDPLVQSCEEEI
                     QYWCKIVFGNAYVLQYRIEDMQKIPEIGEELSWQISENPHFFHKLAGSQTLGIKNSAR
                     KEAEAGISSLCNAIETYADTVKQVRKSIVQAHQAQQNRQELSSEPSQDLQKQQSLSKP
                     PKLPEHSPEDRHQESTESSMQAKWNRLGARPRTVPLSQKTQKQQEQLGLHQPIMEGDG
                     KEAAKVSMSAIKATKVTTKSEALKAVEQLIQPPKVETAKVVSVPLAQEAQKTLIEKET
                     IPSLTNEEVASKIRESEVVKSSMQKIKTLCGVVYGNPHILEGKMPKMGIPVTNRNVEE
                     LEKFARQVGSFPSSFGRVAGFSFLGIKSGARAHAEENFLPLSHAIVSYTHNVKQAEKD
                     ILEAHSGKQERYAQSVETPSEEIQNLFSLTQEAQKMLIEKEIIPPLSYVDVASKIRES
                     EVVKSSKQKIETLCSVVYGNPRILEDKMPKMGIPVTNKNVEELEKFARQVGNFPSSCG
                     KIVGFNFLGIKSEARAHAEENFLPLSHAIFSYAHSVKQAEKDILEAYFKEQERCAQSV
                     ETPSEEITNLFSFTQEQQKEILSNSPKLRTQVKAYSQKLHNRLSPSDLQAISERSHTK
                     LAESLGTSVNQAEEIAQILTQTKDVVQILQQQEKLGLYQSIMKGDGKETAKVSMSAIK
                     ATEVTTKFEASKAVEQAVRPPKVETAKVVSVSFTQETQKMLIEKEIIPPLSYVDVASK
                     IRESEVVKSSMQKIKTLCSVVYGNPDILEGKMPKMGIPVTNKNVEELEKFARQVGNFP
                     SSCGKIVGFSFLGIKSEARAHAEENFLPLSHAIFSYAHSVKQAEKDILEAYFKEQERC
                     AQSVETPSEEITNLFSLTQEQQKEVLLTSPELRTQVKAYSQKLYDRLSPSDLQAISER
                     SHTKLAESLGTSVNQAEKIAQILTQTKDVVQILQQQEKLGLYQSIMKSDGRETAKVNM
                     SAIKATQMTKKITSLKAVEQIVRPPKVETAKVVSMSR"
     CDS             506715..506942
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_03930"
                     /product="hypothetical protein"
                     /protein_id="GFF01959.1"
                     /transl_table=11
                     /translation="MHHSLFKNRFEWAGQTRNLSFTFANGSTTFTQVIKEKELTKPFT
                     AGREVQRKLNKLNKMLVEKNNLKDLTRQASV"
     CDS             508030..509601
                     /codon_start=1
                     /gene="mviN"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:C3MF00"
                     /locus_tag="BH623125_03940"
                     /product="putative lipid II flippase MurJ"
                     /protein_id="GFF01960.1"
                     /transl_table=11
                     /translation="MILIKKFATVASGTLMSRIFGFVREMLMAAALGTGPVSDAFNAA
                     FRFPNTFRRFFAEGAFNAAFVPLFAKRITEDGQETACKFAEEVFGVLFSLLLLLTIAM
                     ELSMPFLVRTIIAPGFAEDATKFNATIHFTAIMFPYLTCMSLAAMMGGMLNALRRYFI
                     AAIAPLFLNIILISVLAYAWIYQLDTWHIGLNLSWGVLAAGLLQLTLIAAALRQSGMK
                     IFLRRPRFSSNVRKLLTLAFPAAITGGITQINLLINTNIASSQSGAVSSLMYADRLYQ
                     LPLGVIAIAIATVLLPELTRALRSKNHKETHNLQNRSIELTLLLTLPASVAFLILSTP
                     IVSLLFERGQFTSLSTHYVAQLLKLYGLGLPAFVLIKIFIPNFFAHEDTKTPMIITGI
                     CVFINISLALILFPILSARGIVIAEITSGWMNALLLWTILIQRGYWKYDIQLIKRITC
                     LIITTLLNTIALYYVFDVIDFLSFPLSSQASFFLRASTLAGIMVAILLVHCFAYFLLD
                     TRSFFLTLKNFKKRL"
     CDS             509816..510751
                     /codon_start=1
                     /gene="trpS"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8T789"
                     /locus_tag="BH623125_03950"
                     /product="tryptophan--tRNA ligase"
                     /protein_id="GFF01961.1"
                     /transl_table=11
                     /translation="MHALTVNPDPLALRESTRAVTAAFLAAGIDPKKHIIFNQSQVFQ
                     HAELAWILNCIARIGWLQRMTQFKDKAGKDREKASLGLFAYPSLMAADILLYRATHVP
                     VGEDQKQHVELTRDIAQKFNNDYAQRIVDLNFSVTMQMGEEKKQVFFPLPKALIGETA
                     MRVMSLRDGTKKMSKSDPSDFSRINLTDDADLIAKKIRKAKTDSAPLPDTLAALEERP
                     EIDNLLGIYAAFAQISKEKALSEFSGQQFSLFKTTLADLAVEKLAPITQELRRLHQES
                     SYIDSVLHDGAQRASALAEKNMKKVREIVGFLHNI"
     CDS             510785..511303
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013528063.1"
                     /locus_tag="BH623125_03960"
                     /product="universal stress protein A"
                     /protein_id="GFF01962.1"
                     /transl_table=11
                     /translation="MSAKNRENLRISKQNKAKTNHKRKILVIIDETPECRRAVAFAAQ
                     HAQNTKKTLVLLCIVDSVEFQHFLGVNNVMRTEAIQTAHKVLGEIASDVRTTHSLETQ
                     ITVREGKKIDEIAKLIDEDKQIALIVLAASEHTEGPGPLVQLIGNRGTAFSIPVIVIP
                     SNLADEDIESIA"
     CDS             511360..511938
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003527690.1"
                     /locus_tag="BH623125_03970"
                     /product="iron transporter"
                     /protein_id="GFF01963.1"
                     /transl_table=11
                     /translation="MFIQTETTPNPATLKFLPGCVVLSEGVLEFRDSEEAAKNSPLAA
                     KLFNIPNVNGVFFGYDFITVSKKEGEWQHLKPAILGTIMEHFLSGDPVINTNATRQAQ
                     THALNEEFYNEKDADIVLTIKELLETRIRPAVANDGGDITFRGFENGIVYLNMRGACA
                     GCPSSTATLKHGIENLLRHFIPEVVGVEAMPQ"
     CDS             complement(512201..512533)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010945858.1"
                     /locus_tag="BH623125_03980"
                     /product="hypothetical protein"
                     /protein_id="GFF01964.1"
                     /transl_table=11
                     /translation="MNQYPKCPHCGGLYTYEEGENFVCPECAHEWPQKDEDTSASNIV
                     DANGQILANGDNVIVVKDLKVKGAASVLKSGTKVKNIRLVDGDHNIDCKIPGMGQIGL
                     KSEFVKKV"
     CDS             complement(513633..515276)
                     /codon_start=1
                     /gene="groL"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:C3MGT9"
                     /locus_tag="BH623125_03990"
                     /product="60 kDa chaperonin"
                     /protein_id="GFF01965.1"
                     /transl_table=11
                     /translation="MAAKEVKFGREARERLLRGVDILANAVKVTLGPKGRNVVIDKSF
                     GAPRITKDGVSVAKEIELEDKFENMGAQMLREVASKTNDIAGDGTTTATVLGQAIVQE
                     GVKAVAAGMNPMDLKRGIDAAVDEVVANLFKKAKKIQTSAEIAQVGTISANGAAEIGK
                     MIADAMEKVGNEGVITVEEAKTAETELEVVEGMQFDRGYLSPYFVTNAEKMVADLDDP
                     YILIHEKKLSNLQSLLPVLEAVVQSGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAV
                     KAPGFGDRRKAMLEDIAILTSGQVISEDVGIKLENVTLDMLGRAKKVNISKENTTIID
                     GAGQKSEINARVNQIKVQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKEK
                     KDRVDDALNATRAAVEEGIVAGGGTALLRAANALTVKGSNPDQEAGINIVRRALQAPA
                     RQIATNAGEEAAIIVGKVLENNADTFGYNTATGEFGDLIALGIVDPVKVVRSALQNAA
                     SIASLLITTEAMVAEVPKKDTPVPPMPGGGMGGMGGMDF"
     CDS             complement(515338..515634)
                     /codon_start=1
                     /gene="groS"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TJG8"
                     /locus_tag="BH623125_04000"
                     /product="10 kDa chaperonin"
                     /protein_id="GFF01966.1"
                     /transl_table=11
                     /translation="MANIQFRPLHDRVVVRRVESENKTAGGIIIPDTAKEKPQEGEVI
                     AVGNGALDDNGKRVPLEVKTGDRILFGKWSGTEVKINGEDLLIMKESDIMGILG"
     CDS             515861..517249
                     /codon_start=1
                     /gene="fumC1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:P28894"
                     /locus_tag="BH623125_04010"
                     /product="fumarate hydratase class II 1"
                     /protein_id="GFF01967.1"
                     /transl_table=11
                     /translation="MVETRQETDSFGTISVRQDRYWGAQTERSLHNFNIGIEKQPLTI
                     IYALSLIKKAAAVVNMEKGKLAKNIGKAIITAADEVLSGAFDTHFPLSVWQTGSGTQS
                     NMNVNEVIANHANMLLGGKLGSKTPVHPNDHVNMSQSSNDSFPTALHIATTLQTRQHL
                     FPILDALITTLKKKEEEFADIIKIGRTHTQDATPLTLAQEFSGYRTALEANRQRIENA
                     LCDVQMLAQGGTAVGTGLNAPQGFDIAFAQTISTFTGIPFKTASNKFEALAHHGALAH
                     FHGSLNALAADLFKIANDIRFLGSGPRSGLGELSLPENEPGSSIMPGKVNPTQCEAMT
                     MVACQVFGNHTSVTFAASQGHFELNVYKPVIGYNVLQSITLLGDCMRSFDLHCIQGLR
                     ANRVHIHSLMERSLMLVTALAPEIGYEKAAAIAKAAHKNDTTLRTEALKLGVSGEDYD
                     RLVDPKKMIHPQ"
     CDS             complement(517965..518423)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04020"
                     /product="hypothetical protein"
                     /protein_id="GFF01968.1"
                     /transl_table=11
                     /translation="MPQALKAKKADLGSVLSSSRNTNARALATGGGKMQARNLRQDKN
                     LHNDIFVGKKIRFRRKMLKMSQKTLADHLKVSPQQIQKYETGLNRVSAGRLKEIADIL
                     SVPIAFFMLISSHNKSTLSSMMKSSRAERNTYCSKDFEFSPQSNKGQFYN"
     CDS             complement(520017..521645)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012066958.1"
                     /locus_tag="BH623125_04030"
                     /product="alpha-D-glucose phosphate-specific
                     phosphoglucomutase"
                     /protein_id="GFF01969.1"
                     /transl_table=11
                     /translation="MTLMTVLTKAFDDQKLGTSGLRKKVSVFQQPHYVENFIQSLFNS
                     IGSVEGKLFILGGDGRYFNRNLLQIVLKMAAAHGVACVKVGKEGLLSTPAVSHLIRKY
                     HAYGGIILSASHNPGGREGDCGIKYNIANGGPAPASLCDAVFAASKRLSSYRIMEVPD
                     IDLEREGTTFLGPMQIDIIDPVADYVALMQEIFDFDCIAKAVAEGLTLRFDALHAVTG
                     PYAHEIFEKCLGFSEGTVVNGVPLPDFGGKPPDPNLLHAKALYDLVMSDQGPDLGAAS
                     DGDGDRNLIMGRGQFVTPSDSLAIMVDHAHLIKGYRQGIVGIARSMPTGRAADLVAEK
                     KGLNFFETPTGWKFFGTLLDAGYVTFCGEESFGTGSNHIREKDGLWAVLFWLNLLAVT
                     GKTVAQIVQQHWRTYGRFYTLRYDYEEVETCKASAIINALRAYLPKPGSEIAGLSVEK
                     ADDFTYHDPVDQSISTGQGVRIFFKNGARLVVRLSGTGTVGATLRLYFEQFEGDPRKH
                     NQDPQKVLQPVQQAAFQLLNIKQHLRRTQPDVIT"
     CDS             521846..522370
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010969958.1"
                     /locus_tag="BH623125_04040"
                     /product="peroxiredoxin"
                     /protein_id="GFF01970.1"
                     /transl_table=11
                     /translation="MIRKTVPNTTFHTRVRDESIGGDNPYRWQEVNSDAYFKGKRVIL
                     FSLPGAFTPTCSTFQLPDFEKLYDEFKKVGIDEIYCLSVNDAFVMNAWGKAQGIKNVK
                     LIPDGSGEFTRKMGMLVAKDNVGFGMRSWRYAAVINDGVIEHWFEEQGFSDNCATDPY
                     EVSSPQNVLKTLKG"
     CDS             complement(523086..523304)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04050"
                     /product="hypothetical protein"
                     /protein_id="GFF01971.1"
                     /transl_table=11
                     /translation="MLWQVGKMLDEDDVNLWFKQKILDHGILNEFLICNFLTEEPQYL
                     DFETFKESINEGECKKIVAKETKKIVIS"
     CDS             complement(523577..523783)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04060"
                     /product="hypothetical protein"
                     /protein_id="GFF01972.1"
                     /transl_table=11
                     /translation="MLLKAVSLYSHLLALDSLYFLVEAQNLARAKEERSREYFILENF
                     FKASQNNRITLIRQFFTGGYLDKL"
     CDS             complement(524886..525128)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04070"
                     /note="frameshifted, deletion at around 524903"
                     /product="hypothetical protein"
                     /protein_id="GFF01973.1"
                     /transl_table=11
                     /translation="MQAKNLHQAKNLYNDIFVGKKIRFRRKMLKMSQKTLADHLRVSS
                     QQIQKYETGLNRVSAGCLKEIADILNVSIAFFMPIS"
     CDS             526047..526232
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04080"
                     /product="hypothetical protein"
                     /protein_id="GFF01974.1"
                     /transl_table=11
                     /translation="MNRLNAKAGATFCADKENDGAGFLLHKCKEGAIQWLYRYTYSWV
                     LYERHREMGLGALRDVF"
     CDS             complement(526816..528303)
                     /codon_start=1
                     /gene="hisS"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A6U6I0"
                     /locus_tag="BH623125_04090"
                     /product="histidine--tRNA ligase"
                     /protein_id="GFF01975.1"
                     /transl_table=11
                     /translation="MSSKQEKTKARLPRGFVDRTSAQLYAIEVMIAQIRQVYELYGFE
                     ALETPIFEYTDVLGKFLPDEDRPNAGVFSLQDDDEQWMSLRYDLTAPLARYFSENFET
                     LPKPYRSYRLGFVFRNEKPGPGRFRQFMQFDADIVGTPTVAADAEICMMAADSLQKLG
                     FQHHDYVIRLNNRKILDAVLEKVGLAGSEQAQRRLTVLRAIDKLDKFGLEGVRLLLGK
                     GRLDESGDFTKGAELKDKEIDGILSLLTIEVGTAEETFDALRKIVDQSEEGLEGVREL
                     EEMQAIFAENDTQNRIKIDPSVVRGLEYYTGPVFEAALLFDVLNDDGQKVVFGSVGGG
                     GRYDGLVARFRGENIPATGFSIGVSRLIAALQNLGKLPVKEKTGPVVVLMMDKEPEIV
                     ARYQKMVMQLRSAGIPAELYLGASGMKAQMKYADRRQAPCVVIQGSQERESGTIQIKD
                     LVEGARLSHEIKDNQTWRESRPAQVTVDEEQLVKTVQDILAAQKR"
     CDS             complement(529652..529837)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04100"
                     /product="hypothetical protein"
                     /protein_id="GFF01976.1"
                     /transl_table=11
                     /translation="MKNLIYPYKSISYIFDIGREDKIRERMLREENKHWCFKREKENV
                     VIMENMFKRKITSIVNK"
     CDS             complement(530630..531475)
                     /codon_start=1
                     /gene="pyrF"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:O08323"
                     /locus_tag="BH623125_04110"
                     /product="orotidine 5'-phosphate decarboxylase"
                     /protein_id="GFF01977.1"
                     /transl_table=11
                     /translation="MFHSTFFKNRKIYGPLCIGFDPSHKVLQSWNLSCDYKGLKDFCD
                     ILLTAVVGNVGIIKPQVAFFELYGVEGLQVLKELIENAQEQGLLVIADAKRGDIGSTV
                     EAYGQAWLGSSSAFKADAITANAFLGFDALIPLIKIAEETGTAVFVVVQSSNPEGKQM
                     RNALIGDQTLSVHLAQRICDYNSQSLEKNYSIGPIGAVVGGTLGSEAKDTIKQLKNCL
                     FLVPGIGAQGGTITQLTNQFPQSLWQNIIPSISRSITDAGSNIVDLKTRINDFAMCAK
                     NALMS"
     CDS             531907..532995
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011267900.1"
                     /locus_tag="BH623125_04120"
                     /product="hypothetical protein"
                     /protein_id="GFF01978.1"
                     /transl_table=11
                     /translation="METRIPEDTAFDTHFLGKTSVEEQYPLFHTPISWSAIFAGLVTA
                     LATSICLSFLVAALGFNQMDFTSSTPFEGSLRSFGIGSLIVTLISLALGGFIAGRFAE
                     SSGALHGFLTWALLTLLMTLQTIHVVSSTAKLGAQAAVENSSAIGQTIDSLKTNFSPL
                     FSKFDGESFEQFLRKTKDNGVDFDKLGNELRALLNKSDIPALNPDRLKTSYQAALKDI
                     GEAITAFKNDPSHYRTYLKDLGERLSDRIEAITAKIDKSDIIKSLMNNGMTRTDAQTA
                     ANNALHVYKTAEEKTEKALKALEEQAETLSDNLEKAMKGAKNTAEKATKTASHMGWWG
                     FLGSLIGAMISSVFGYYGYRIRKASFMF"
     CDS             535483..535887
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04130"
                     /product="hypothetical protein"
                     /protein_id="GFF01979.1"
                     /transl_table=11
                     /translation="MPLIQPGMGTKNSIELLYTLIQMAKPRTVLEIGAGDSTCLIATA
                     LQKAKQAWQQDKKLLRSTTFEERTAFLDPSGVLENYQPRLITIDDFSAEGQSAEQAWQ
                     KPLQDNSIEKDMVTFIHISSLLMMKRSNLGDQ"
     CDS             535926..536093
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04140"
                     /product="hypothetical protein"
                     /protein_id="GFF01980.1"
                     /transl_table=11
                     /translation="MQFVTTLWEHITAHGYLCLHEPTMTITVALDGAQRVRRVRTPFW
                     EETLYRLDGLL"
     CDS             536080..536277
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04150"
                     /product="hypothetical protein"
                     /protein_id="GFF01981.1"
                     /transl_table=11
                     /translation="MGSYEALTLTENHKYRQSGLGIIRKHTPAEQIVRAQSLQAELIE
                     INELPIRNDLLPMGKEALHKR"
     tRNA            complement(537829..537905)
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="BH623125_t00160"
                     /product="tRNA-Met"
     rRNA            complement(538015..538124)
                     /inference="COORDINATES:profile:Barrnap:0.8"
                     /locus_tag="BH623125_r00040"
                     /product="5S ribosomal RNA"
     rRNA            complement(538212..541015)
                     /inference="COORDINATES:profile:Barrnap:0.8"
                     /locus_tag="BH623125_r00050"
                     /product="23S ribosomal RNA"
     tRNA            complement(541422..541497)
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="BH623125_t00170"
                     /product="tRNA-Ala"
     tRNA            complement(541833..541909)
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="BH623125_t00180"
                     /product="tRNA-Ile"
     rRNA            complement(542279..543762)
                     /inference="COORDINATES:profile:Barrnap:0.8"
                     /locus_tag="BH623125_r00060"
                     /product="16S ribosomal RNA"
     CDS             544616..546622
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013529469.1"
                     /locus_tag="BH623125_04160"
                     /product="peptidase M24"
                     /protein_id="GFF01982.1"
                     /transl_table=11
                     /translation="MWDNKQQKNDPGLDPALVVKRFLPDHRQVSIRWLTGTILTGITS
                     CLLMGIALFAALDEQQRLVTPPQWFTPTNLPQTQNSDTNGHKGDRIAQTHARQSFDSK
                     RQFELSILQKKGDQKVIQTQNFEWIRMALAEERPQKYSYPKFDALNIFATDSKNQTAP
                     PQDTGEIYGAKVETKITLRNHNFILDQVNFDGADTLTEDEVQQELQKAGFTLEKNHEL
                     LSILTLVDPLKLEDLSSSSQFTDTPEVRIIQENVTVSSQNHRIDLTKNYAEDIIPIHK
                     KQKIIEAFRETNYTKEQIEQVAKTLAFFNHSETLKAGSLLRIGIVTQAGEEDHLVRAS
                     IYQGMYHVLTVALNDEGQFVESTEPQMSQALKTAFQNGIPHSYVNTTQLPTVYDALYN
                     AILSHNMSQSLSQRIIRLLATNVDMKSRITPTDQLEIFYAVPQQSEIEKNNKETLNGQ
                     KSQKAKEYPTNADPEIRYISATFGNATYKYYRYQSKDGSVDYYDSEGKSSKPFLLRKP
                     TPNGIFGSPFGPRKHPILGYVRMHTGVDWVAPKGSPIIAVGDGIVIKMGVSGGYGNHT
                     EIQHPNGYISSYSHQSRYAPDIKPGVKVRQGQIIGYVGTTGMATGPHCHFEIIVNGVK
                     VDPMRIRIPDSKTLTNQDLQAFLREKNNIDSLLNSPMKPSEDTS"
     CDS             complement(547620..549044)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04170"
                     /product="hypothetical protein"
                     /protein_id="GFF01983.1"
                     /transl_table=11
                     /translation="MTTKTNLLPHIPSSDAIISRWRWLAIIVSLVMALLASAFILLLS
                     NAVDREVAQLNTSSELREQADLVLISLIDMAVADRSYAKNHKAEDKARFEHAARNLDD
                     ILEYIELIVYAHPQWYEWFTSFKKEVEARKAFMNDHMRALDALPDQSSQPSSSSEIPK
                     IQVARLAQLMTSFINGDDVVRQKQREGIALMRAALTLAAIVSVVSTFMSAYFVINRFH
                     RDVRSLKMYQLLLHSENIALEARVKERTQELERARNHAEKERQRVEMLLQDVSHRIGN
                     SLGTVSSLLGLQLNRSDNEEVRSVLGAARDRIQTISTAHRRLRLSDDMETTLLAEFLS
                     SVVHDVELAMPLELRENITIHTNFKECRLSSRDATTLGIILGELLTNSLKHAFPDKRS
                     GDIYISFGPQKNGQLMLIVEDNGVGMKNQTQEKKTGLGRVVVEQLCMQFGEKPLFETS
                     ALGGTKIVIPLPKLTPNASKEAYA"
     CDS             complement(549270..549824)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:C3MGE9"
                     /locus_tag="BH623125_04180"
                     /product="RNA polymerase sigma factor"
                     /protein_id="GFF01984.1"
                     /transl_table=11
                     /translation="MAKSMKDFKQELLLILPSLRAFALSLSSKHDKAEDLVQDTLMKA
                     WAKQDSFEMGTNLKAWLFTILRNEFYSQMRKRGREVQDSEGVFSENVAVHPPQYGSLD
                     LQDFKKALNLLSADQREAIILIGASGFSYEDAAAICGCAVGTIKSRVSRARNRLQELL
                     KVDGESDYGPDSYSAGSTLCSFNG"
     CDS             complement(549832..550035)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04190"
                     /product="hypothetical protein"
                     /protein_id="GFF01985.1"
                     /transl_table=11
                     /translation="MNDRDEKNLTNHFTFGEDLLGVNSEIARKLRQFYLEIQEEALPA
                     HLLELLDRLEKAEQFGLKNVEKV"
     CDS             550202..550999
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012066570.1"
                     /locus_tag="BH623125_04200"
                     /product="two-component response regulator"
                     /protein_id="GFF01986.1"
                     /transl_table=11
                     /translation="MSLSTRIAPHLPYLRRFARSVTGSQTSGDAYVSAMLEALIADIS
                     IFPRASSSDRIGTYWLFCHLFDQTTPNIPEPMPQFGLEQKTSAKLSYLTPRARQAFLL
                     IAVEGFNEKEASEIMNLDAKEFRKLLNQASTDISQQIATQVMIIEDEPLIAMDIEQMV
                     ESLGHQVVGIARTRKEAVVMYHKEKPRLILADIQLADNSSGIDAVNDILQNDRIPVIF
                     ITAFPERLLTGERPEPTFLVTKPFNPDMVKALISQALFFKENASKAA"
     CDS             551077..552033
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013529281.1"
                     /locus_tag="BH623125_04210"
                     /product="histidine kinase"
                     /protein_id="GFF01987.1"
                     /transl_table=11
                     /translation="MQAIRGADICVLYQTTNLVYLWAENLPQHLHSKWRMGCRDSDFF
                     SLDLADNMETIKLQVLATGEMQTIEARFEDMAKQAIWYKFSIDCHRNDNGDIIGIITT
                     GVDISGLRRREQVLKILLREVSHRSKNLLAIIQSIASQTARYTESLQVFLRKFQGRLH
                     SLSHSQDLITASDWRGAQFRELVHSQTLGYVMKETERFSLEGIDPYLFPNAALHIGLA
                     FHELIVNSLSFGALSQEKGSVCVRCEVHTKMNGATQLLITWNESFAAETPLSHHKKAC
                     FGSAVLEKIVPVSVNGSASLKLTEEGIIYRLWVPDSYFDIFF"
     CDS             complement(553371..553574)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04220"
                     /product="hypothetical protein"
                     /protein_id="GFF01988.1"
                     /transl_table=11
                     /translation="MHIALHNGLLKVESAYYPPYYTLLLIVFWAFDGFMLLRAFMQEV
                     YGEGCERGDDVVKTSALFSVDML"
     CDS             553517..553966
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010970155.1"
                     /locus_tag="BH623125_04230"
                     /product="hypothetical protein"
                     /protein_id="GFF01989.1"
                     /transl_table=11
                     /translation="MVDNKQIQPSKDHCGEQCALPQELPLDPAVERVRKKLMRFMIIS
                     ISITLMMTLAVLFLVVYKILATRSTPKHPPQFSSHNRNPEVAYHTLSLPKGTQILSQS
                     LSKHNIVLKVLMPDDHIKFMVYNYHTGTLIAVLSVETTRSNIVPQPR"
     CDS             complement(554331..554630)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04240"
                     /product="hypothetical protein"
                     /protein_id="GFF01990.1"
                     /transl_table=11
                     /translation="MSQTQPQKNGKDQQAEIQNEYAYNDELEASALPNEKMDQVRCAL
                     EEKLEPVKKTRRPSRRCTVKLKENHPFEFSHFRLLWETSENGRCTGRKRMHLCRT"
     CDS             complement(554854..555588)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010973617.1"
                     /locus_tag="BH623125_04250"
                     /product="hypothetical protein"
                     /protein_id="GFF01991.1"
                     /transl_table=11
                     /translation="MRPQQNRRARGRNNNNNGNSNNNRRGPNPLSRNYESSGPDVKIR
                     GNAQQIADKYISLARDAQGAGDRVMSENYLQHAEHYLRIILAAVGQTPQSVRRDENRD
                     ENNAQECGEINAEDAKKDTVVHCDIDVSQTQPRKNGKDRQAEIQNEYACNEVLEASAL
                     SDEKTDQAQCVLEEKPEPVKKIRRPSRRRTVRVKEESSLELSLATSEKNDVRTEKDAS
                     LPVLGAEIQKKPRRRRVVTSSAEENV"
     CDS             557340..557600
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04260"
                     /product="hypothetical protein"
                     /protein_id="GFF01992.1"
                     /transl_table=11
                     /translation="MDNKSHSRRLQQRTDVTLCTVNEKVLTSTGDIKNTKAPFTPHLH
                     SQETPNPSLLSRAIGYDLLEILQVRNVHAVLQEHSQEHSIDL"
     CDS             complement(558953..559396)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04270"
                     /product="hypothetical protein"
                     /protein_id="GFF01993.1"
                     /transl_table=11
                     /translation="MEKRIRARQKAYFKKLYRKIAFVCILLFFVVCFCFGIIKIIGYF
                     FSNKQVTQHVPVELTLPVFDQRVYCKEIAASVMPDMKKEVYQHCLYLESEAYFAIREM
                     WDTLSDTSKKRCMKMVRPGDGNYFLLQDCLLNEKDGEKNKARNHF"
     CDS             560487..560636
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04280"
                     /note="frameshifted, insertion at around 560433,560479,
                     deletion at around 560672"
                     /note="possible pseudo due to internal stop codon"
                     /product="hypothetical protein"
                     /protein_id="GFF01994.1"
                     /transl_table=11
                     /translation="MRNLHYLKDIVLDAFESRKVELKEDDKAHNWFSPLQLHIIPQLG
                     CIPVS"
     CDS             complement(561215..561877)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04290"
                     /product="hypothetical protein"
                     /protein_id="GFF01995.1"
                     /transl_table=11
                     /translation="MRKISKEGLLLIKQWEGLHLHAYQDAVGVWTIGYGHTTQVGEPS
                     VQEGMQITVAEAETLLQKDLAKFEKTVEEMVEQPLNDEQFATLVSFCYNVGIETFCNS
                     TLLKKLNKGKYEAVPAELQKWTRAGGKCLQGLVNRRAAEAGLWVKGAYVSSNYQQVEI
                     PQNSFWGKIEVLAPIIGSFSGLTGILTGQGPIQWALAVVMVLATIAAIGMSVYRMKEE
                     YS"
     CDS             complement(562156..562422)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04300"
                     /product="hypothetical protein"
                     /protein_id="GFF01996.1"
                     /transl_table=11
                     /translation="MALFPFSIADVDDPEHIRVVLYASGRMGHAPLNALLKQMHQAIG
                     SLEKKQLQNTTQILQRMDALEQQLKVILQDLEHFKHQQDAKKGP"
     CDS             complement(562394..562753)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04310"
                     /product="hypothetical protein"
                     /protein_id="GFF01997.1"
                     /transl_table=11
                     /translation="MVLPWGFCPGGSALGVLPWGFCPGGSALGVLPWGFCPGGSALGV
                     LPWGFCPGGSALGVLPWGFCPGGSALGVLPWGFCPGGFCMVQKFVDNNALKSTNIAVL
                     EFGKRRERNGTFSIFYC"
     CDS             complement(563916..564923)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04320"
                     /product="hypothetical protein"
                     /protein_id="GFF01998.1"
                     /transl_table=11
                     /translation="MSSIYDWSLTTSENAYVDESINWAEGQPPSSVNDSARAMMQRIK
                     EYLLDNGGVIETQFMLDEEKNRTSIRLMTKSSFEAYMGGIVVRFKAQGVNKGITNVAL
                     NQLLSRPVYMVNSDDGIVPLKGGEIQRGGLYELVYTCDISGKNVDGWFLTNPTLRLPE
                     IPPLPPLPESFSPGFIGTFATEKIPTGWLLCDGKEYSRNAYASLFAVLGEIWGKGDGQ
                     TTFNVPDLRGMFLRGLDSGKEIDKGRFLGSRQEESFKAHTHEGKTNSVGKHKHSFKGF
                     KSVVVQRNLDEWKAYAYGYDSQNSLTEFEGEHEHQVFLEKTGGDETRPVNVAVVYAIK
                     V"
     CDS             complement(564920..566044)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04330"
                     /product="hypothetical protein"
                     /protein_id="GFF01999.1"
                     /transl_table=11
                     /translation="MSRKTKPQVQTTTQTNAPPAWAADILKKASSQALDLYNKGIGGN
                     VYQGERIAGLGTMTKNALTGLEQAVGQYNNPALTQWFNAPTQSAHNLLGMAKGDWIGN
                     NSKFNAALQSALSKTSDAINQSMAGAGRYGSGAHTGVLADELGALATNAAAQQYNQDI
                     HNMMNANQMIDRSLYDQVNAANNYYQGQSNAQSNALKGGLIQDVNRQNALDAERQKWT
                     EQDNQAWNQLERLLRVGTQAAGNYGTTSGKSTTMPSVTKDPLRDAQQVLGLMGGILGL
                     CDVRAKENIVPVGEKNGYPLYVFNYKGDPQRYCGVLAQEVLRLKPEAVFVNAKTKLLH
                     VDYNKIGLKMKKISEPKKRIATFFSALFARFPFLQKGYLL"
     CDS             complement(566041..566499)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04340"
                     /product="hypothetical protein"
                     /protein_id="GFF02000.1"
                     /transl_table=11
                     /translation="MTRRCERQNSYSAHLTEKWSWQKIAHYQEALNAALKKYAQRFPD
                     DVCLATIAEELARGQAQLWLVLKNKTQFSAFAITKVERTHTGKKRVVLSDLAGEGGLE
                     LVKLIDKVEEWARTIHAEEIHMFGRSGWSKMLSHHGYSRNLIHYRKVLNP"
     CDS             complement(566791..568254)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04350"
                     /product="hypothetical protein"
                     /protein_id="GFF02001.1"
                     /transl_table=11
                     /translation="MAFFPVADYRPDVADINGIFTDELINVLPADGSYIPMPSFQPVS
                     EPCPHPILGALAVKTKNGVSVIVGTGQKIYLLDNTTKQWKDISQKGKSYLANVDAPWS
                     FALFGDYIIAVNANDKPQVIDINHDKNFRDLGGNPPQAGIVRVWGDFVCLMKLTEHPR
                     RVHWSGLNDAEFWTVGKKSCDYQDFPDGGFVQGATETTNPIIFMRSAIYAGSFIPGSK
                     IIFSFQKIHDKRGAKNAESIVCRGDLAFFADEGGFYQITNEGQIIPIGFEKVDRTMTA
                     KSRQNNLYTLSAAIDGVYNRVYWMVDTDESVHKRILLVYDWGLQKWTKAVVDIKMILP
                     IFLAGTTLEGLDHVAQNIDDLPFSLDSKAWKNESPILGAFDHQGRMGSFSGPPMACVV
                     TSQEMGQTNGMITRVKNIMPQVNSGELYLSVGMRFRQSLEEKTVWLPERQPSYNTGQI
                     HLRARARFYRFKLRIPEGVNWSHVTGFDVELQSAGMR"
     CDS             complement(568664..569359)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04360"
                     /product="hypothetical protein"
                     /protein_id="GFF02002.1"
                     /transl_table=11
                     /translation="MTVLPIDPNHLNLTHSDHSQNFASMVALIQDEIDDTTAEYSTQI
                     QDSIFTALRLCEREPFFFNEKREVTFKTQCEKTWYGQEEGVFIQSERSLESVFLGICA
                     ATQIQLLFKPAEVLQQQYGLQPPQGAPLFYTYFDQKIGLFPTPKQVETVRLVYTSLRF
                     GDEQVMEDDNPWLIYAFDLIKARAKYELYKNILKDPEYAAVSFRDFQEQLQALRFETS
                     RRKGSLNILPMSF"
     CDS             complement(569739..570857)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_000214480.1"
                     /locus_tag="BH623125_04370"
                     /product="major capsid protein"
                     /protein_id="GFF02003.1"
                     /transl_table=11
                     /translation="MTVTYIGLNDPMAVRTWSKLLNQEVSKAIPIAPLIGNDSNSIVQ
                     LKDETTKASGDAISFNLRVQLFGDGVSEGQALEGNEEALQFLNDRLAINELVHAVRVK
                     NEGTIDQQRILHDLRTEAKNGLVDWYADRLSLMFFIQVCGYTAKTINFEGRTLTLKPV
                     HYGFNAPTAPTDKRIVRPNGKTKDEDLKQTDVFDLNLIDQAVERAKLANPKIRPVRID
                     GESVYVLYLHPTQVTQLRTNTDAGQWLDITKAIYSGSRLKNPLYDGSLGMYNGVVLRE
                     AEHVTEGVESGATNKAVPNVRRAVLLGAQSAVIAFGKDRGATRYKLVEELFDYEREFG
                     VAAKTIIGMKKTCFTLPGSKQGAQDFGTIVIPTYGAPA"
     CDS             complement(571229..571423)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04380"
                     /product="hypothetical protein"
                     /protein_id="GFF02004.1"
                     /transl_table=11
                     /translation="MERQCGELERQNSARTLAAYNGLTPNGPISLNMLDKMSEAEFSH
                     WVADPKNKAAFNRLMGGGES"
     CDS             complement(571536..571730)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04390"
                     /product="hypothetical protein"
                     /protein_id="GFF02005.1"
                     /transl_table=11
                     /translation="MERQCGELERQNSARTLAAYNGLTPNGPISLNMLDKMSEAEFSH
                     WVSDPKNKAAFNRLMGGGES"
     CDS             complement(571843..572640)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04400"
                     /product="hypothetical protein"
                     /protein_id="GFF02006.1"
                     /transl_table=11
                     /translation="MDQEHLTPAEQNQLKQGFLSGEQQGEDREIGIGEKAKNLEENFQ
                     GHQNVQQQQRSLQAGSQSQDVQKALEVDAPPDPQKDFMGYIQWLGKTLYKQGALLSEQ
                     PPAMSHESEQLHALYQQSVAAVKQKHHDFDQAADFIYDTRAKQLAAFSSLYPEMADPN
                     VVDAVIGNELKQILHDCAKKNQSPAEVIYAVAQKIGYTNAPNTIGENFQKRQNSARTL
                     AAYNGLTPNGPISLNMLDKMSEAEFSHWVSDPKNKAAFNRLMGGGES"
     CDS             complement(573613..575451)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04410"
                     /product="hypothetical protein"
                     /protein_id="GFF02007.1"
                     /transl_table=11
                     /translation="MNISKDSFDPLETLEHQALFKKLVSWYQDDIAHVEQWRKNAQED
                     YDFYNGRQWNEQDLAVLREQNRPVMTFNRIAPLVNAVIGTERNNKRQVQFIPRQEGAA
                     FANQILTGAAEWFRDEADGEYEDSDAFQDAIICGMGWTDTRLDYEEDPQGKPVIARLD
                     PMKMVWDASAVKPNLVDAQRLWYIDEKPLAMAQEMFPHVHWSDLNADWVKHQTFFHQT
                     SADNMQSYQKDVEEESSSQRPKMVTLAECRWFEREVVYKILDPLSGKFIDYSEQDFQN
                     LCKDFPAIQATRLTRKIVKRAFLGRKLLEAPDKPLVPAGQLGWECITGTFDKLSRQFY
                     GIVKPTKDPQRWANKYFSQVMHLLNSQSKGGIMAERDAFDDDRQAVESWARADSITWL
                     KSGAVSGGRIQPKPVAQFPQGFFQLFNEAKSALEQVTGLSSEFIGTRAVNQPGILEQQ
                     RRQSSLNLLASFFDGLRRYRQRQGKIILYLIQNYLSDGRLVRIAGDENARYVPLTREM
                     ITSLEYDIVVDDAPTSLNEKERTFAIIMQLLPLMQSFTTPDIMLDLLRYSPLPASLIH
                     KIALKAQKQSLEKQSAPLQDSAEALGGPSGHAGVEQLMPIHFAEGT"
     CDS             complement(575451..576776)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010951185.1"
                     /locus_tag="BH623125_04420"
                     /product="hypothetical protein"
                     /protein_id="GFF02008.1"
                     /transl_table=11
                     /translation="MTTTQIALIPKLIPVFTGKADVRAAWGGRGSGKTRSFALMSAVI
                     GYRHGKAGERGIILCARQFQNSLNESSLEEIKRAIESYPFLQDYYEIGDKYIKSKDGR
                     IVYVFAGLDRNIASIKSMGRVFLCWVDEAEPVTETAWQTLIPTLREEGNDWNAELWVT
                     WNPCRENAPVEKRFRNVNNPHIKGAEITWRDNPQFPEKLNRDRKADLEQRPEHYNHIW
                     EGEYLQTVEGAYYQKALLEASREGRITTVPRDPLMQIRIFWDIGGTGAKADATALWVA
                     QFVGREIRVLDYYEAQGQPLSEHVGWVFQRGYDKALMVLPHDGATKDRVYNVSFESAL
                     QQAGFQTKVIPNQGVGAVKMRIEAVRRLFPAIWFNRETTHAGRKALAWYHEKRDEQRN
                     IGLGAEHDWASHGADAFGLMCVAYEQPNMRPKKNTYRSSHHSQTSWMAF"
     CDS             complement(577192..577524)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04430"
                     /product="hypothetical protein"
                     /protein_id="GFF02009.1"
                     /transl_table=11
                     /translation="MMAEKPCLPLRRRGRSKGAVNKTTKRFNEALLTAAEQAGYHYGE
                     DGLVSYLQYHALNNPVPFFSLLAKVLPLQVTGEAGGDVKTISRVEIVPVIAKNASSCE
                     PEAKEGDA"
     CDS             complement(577643..577936)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04440"
                     /product="hypothetical protein"
                     /protein_id="GFF02010.1"
                     /transl_table=11
                     /translation="MSVGLSRFFIRKFYFYSISGDCFSKVPLFFLSSIAVIPFMRSLL
                     EAVTGDLRVSLENKEYHGYERKEPGIKGKKIFTQLSSKGLPKMYRHIKASKAI"
     CDS             complement(578521..581100)
                     /codon_start=1
                     /gene="clpB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TAM5"
                     /locus_tag="BH623125_04450"
                     /product="chaperone protein ClpB"
                     /protein_id="GFF02011.1"
                     /transl_table=11
                     /translation="MNLEKYSERLQGFLQTAQNKALSSDHQQFMPEHFLKVLLEDSQG
                     LAASLIQKAGGDLSLIQKALEEALDALPKVQGGNGQLYLSQPLAKVFTLAEDLAHKAG
                     DQFVTVERVLQALIMEKTAKTADILTKAGLTPQALNQAINALRKGKTATSPHAESQYD
                     ALQKYARDLTKDAREGKLDPVIGREEEIRRTIQVLSRRTKNNPVLIGEPGVGKTAIVE
                     GLALRIVNGDVPETLRDKRLYALDMGALIAGAKYRGEFEERLKAVLAEVQAENGQIIL
                     FIDELHNLVGAGKSDGPMDASNLLKPALARGELHCVGATTLDEYRKYVEKDAALARRF
                     QPVFVPEPTLEDTISILRGIKEKYEQHHKVRLADSALIAAARLSNRYITDRFLPDKAI
                     DLIDEAAARLRMQVDSKPEELDALDRRILQLKIEREALKTDVEPTAKERLKTVQAELE
                     TLEQQSREMTTAWQAEKQKLGHAADLKKQLEEARNALAIAQRDGQFQKAGELAYSVIP
                     QLEKQLSIAENDDQQNHLVEETVTAEHVARIVSRWTGVPVDRMLEAEREALLRMEDEI
                     SKRVVGQGEAVQAVSRAVRRARAGLQDPNRPIGSFMFLGPTGVGKTELTKALAAFLFQ
                     DQNAMLRIDMSEYMEKHAGARLIGAPPGYVGYEEGGVLTEAVRRRPYQVILFDEIEKA
                     HPDIFNLLLQVLDEGRLTDSQGRTVDFRNTLLIMTSNLGAEFLTALPEGQTTDQAKND
                     VMNVVKAAFRPEFLNRIDEVILFQRLQRSDMEAIVDIQIQHLQNLLNERKITLHIEPE
                     VRQFLGDKGYDPLYGARPLKRIIQREIQDPLAENILFGKIHDEMAVTIAKEGEHLTFL
                     PEN"
     CDS             complement(581552..581776)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04460"
                     /product="hypothetical protein"
                     /protein_id="GFF02012.1"
                     /transl_table=11
                     /translation="MEIRLWVEQGQVFEVEQGWAFELGKLALDAKDDVDCVNDRVEVA
                     CLRLGSFKCLKLKRSFVFAIKLVKKSKKAA"
     CDS             complement(581789..582058)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04470"
                     /product="hypothetical protein"
                     /protein_id="GFF02013.1"
                     /transl_table=11
                     /translation="MEIRLWVEQGQVFEVEQGWAFELGKLAFRLKNDRALKLGKLVLD
                     AKDDVDCVNDRVEVACLRPGSFKCLELKRSFVFAIKLVKKSKKAA"
     CDS             complement(582365..582637)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04480"
                     /product="hypothetical protein"
                     /protein_id="GFF02014.1"
                     /transl_table=11
                     /translation="MEQNNKQTEQKLSKGREQIKKAHQTQTKPNVKQTEISSIRPPHL
                     CPICGQMAQQNAYPFCSTRCRAIDLNRWLSGSYILPPLPQKADEEE"
     CDS             complement(582663..583361)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TL87"
                     /locus_tag="BH623125_04490"
                     /product="Maf-like protein"
                     /protein_id="GFF02015.1"
                     /transl_table=11
                     /translation="MEVIRKTFFKKSRLEETSLEEIQLILASASPRRLALLAQIGLDP
                     HQVYATNIDETPKLREHPANLAKRLAKEKALKAQETFLWRDQSSGEKVSAQKIVILAA
                     DTVVAVGRTILPSPESEDEAYECLRFLSGRAHKVYGAVCALNECGKITVKLVESCVRF
                     RRLTSPMMEAYLYSGEWQGKAGGYAIQGKAGAFVVYIAGSYSNVVGLPLAETMDLLTA
                     YHYPLLTHWNGKTH"
     CDS             complement(583557..583775)
                     /codon_start=1
                     /gene="infA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:C3MFX5"
                     /locus_tag="BH623125_04500"
                     /product="translation initiation factor IF-1"
                     /protein_id="GFF02016.1"
                     /transl_table=11
                     /translation="MSKEEVLEFSGIVTELLPNAMFRVKLENDHEIIAHTAGRMRKNR
                     IRVLAGDKIMVEMTPYDLTKGRIIYRYK"
     CDS             585176..585562
                     /codon_start=1
                     /gene="phrR_1"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013384991.1"
                     /locus_tag="BH623125_04510"
                     /product="transcriptional regulator"
                     /protein_id="GFF02017.1"
                     /transl_table=11
                     /translation="MQARNLHQAKNLHNDIFVGKKIRFRRKMLKMSQKTLADHLKVSS
                     QQIQKYETGLNRVSAGRLKEIADILSVPIAFFYADLFTKQDTPTQHDEIASNREEYFL
                     LKSFRELKPKKQKAILWLISDQNESF"
     CDS             587563..587802
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04520"
                     /product="hypothetical protein"
                     /protein_id="GFF02018.1"
                     /transl_table=11
                     /translation="MMGPFSNFISLKTIVNNGFYSIPFEYLHEMGLKTLKKGSLKQGR
                     ELATLGFCCMGYFCGLGNGFFELFVQWHSILHKGH"
     CDS             complement(588881..589462)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_000848063.1"
                     /locus_tag="BH623125_04530"
                     /product="disulfide bond formation protein B"
                     /protein_id="GFF02019.1"
                     /transl_table=11
                     /translation="MEHVQQKNHHFIIFMNTLGLLGLSAVLLVAFYYQLVKFELPCPL
                     CLLQRVGLMLAGCGFLLNIHHKVKNTHYGMVILGCMVTSIVAARQVFLHITPDDLGYG
                     STFFGLHFYTWAFIIAVLCIFAVAFLMILSELSYKFKVFAPFPLLSKMASGLFVFLIA
                     ANLISTVLECGTGQCADDPVRYELLSYWFPSSS"
     CDS             complement(589473..589625)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:NP_456366.1"
                     /locus_tag="BH623125_04540"
                     /product="hypothetical protein"
                     /protein_id="GFF02020.1"
                     /transl_table=11
                     /translation="MFVPFLIALGTAITTVYGKKNISYALWAILLVVILLTFNHHATS
                     TLNLSF"
     CDS             591046..591372
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04550"
                     /product="hypothetical protein"
                     /protein_id="GFF02021.1"
                     /transl_table=11
                     /translation="MQARNLHQAKNLHNDIFVGKKIRFRRKMLKMSQKTLADHLRVSS
                     QQIQKYETGLNRVSAGRLKEIADRVKTFFDDLSGGFSIFLNASVSVRLSYPCHFFKEG
                     RSTCFY"
     CDS             complement(591667..592011)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04560"
                     /product="hypothetical protein"
                     /protein_id="GFF02022.1"
                     /transl_table=11
                     /translation="MKRIVLTATLFSIFSSVLSPVTANALPVGNGWGTKSDAIVGQLV
                     TKNGFGDREKKILQEIIVPERKNLFTYDNNKFKIQKKYHAILRAMGMRNGCRDLDPKE
                     YSGQKWMSCFIN"
     CDS             592291..592665
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04570"
                     /product="hypothetical protein"
                     /protein_id="GFF02023.1"
                     /transl_table=11
                     /translation="MKEQQQDAFATIEIIKEIHRDMKTVHRSIAHAVLFTQSKVVTKS
                     RTSHFVSYRNHQIDTFETEINECDVFSAIFATGDFHRDLNAKEVNDLNAVMSNFEVCA
                     TEVIKKLRDNQTKKENNVMHYT"
     CDS             593020..593193
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04580"
                     /product="hypothetical protein"
                     /protein_id="GFF02024.1"
                     /transl_table=11
                     /translation="MSDFRGIAFTKIISEERLPFEMHIPNTKTLKTFEKTDKGEDIFY
                     AKDIKDLFKQLNI"
     CDS             complement(593967..594194)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04590"
                     /product="hypothetical protein"
                     /protein_id="GFF02025.1"
                     /transl_table=11
                     /translation="MMKNPPHSSELLREDVIKELSLFVTEAVARLGMSRVAFSRVLNG
                     KAAISAHLAIQLEMAGVSTARACWLAMQIMI"
     CDS             complement(594352..594504)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04600"
                     /product="hypothetical protein"
                     /protein_id="GFF02026.1"
                     /transl_table=11
                     /translation="MILSFKHKRLKTPCNTGTYNTGTTEQIITAHPKKLKRIFAALEV
                     AIASND"
     CDS             complement(594729..594866)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04610"
                     /product="hypothetical protein"
                     /protein_id="GFF02027.1"
                     /transl_table=11
                     /translation="MPWFMEEAHVYGKATVSGYARIYGSVYDNAKISGYVNFKIKLMR
                     M"
     CDS             595598..596095
                     /codon_start=1
                     /gene="purE"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:C3MIL3"
                     /locus_tag="BH623125_04620"
                     /product="N5-carboxyaminoimidazole ribonucleotide mutase"
                     /protein_id="GFF02028.1"
                     /transl_table=11
                     /translation="MMKESCDVAILMGSQSDWQTMRHSSDILTCLGISHIAHIISAHR
                     TPERLYQFAKGAKAAGFKVLIAGAGGAAHLPGMLAALTPLPVFGVPVHSQSLSGQDSL
                     LSIVQMPAGIPVGTLAIGKAGAINAALLAAAVMAVYDNHLAQRLDDWRQQQTASVAQT
                     PATEV"
     CDS             complement(596033..596242)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04630"
                     /product="hypothetical protein"
                     /protein_id="GFF02029.1"
                     /transl_table=11
                     /translation="MLDEADMLGEADMLDEADALDEGDALGEGDMLDEADMLGESRML
                     EESVILNLSCRRLRDTGCLLLTPIV"
     CDS             596277..597347
                     /codon_start=1
                     /gene="purK"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q92M66"
                     /locus_tag="BH623125_04640"
                     /product="N5-carboxyaminoimidazole ribonucleotide
                     synthase"
                     /protein_id="GFF02030.1"
                     /transl_table=11
                     /translation="MIGLIGGGQLARMLAIAAAELGFRTVVFCPETDCPASQTTNDHI
                     VSPYDDDSALDRFISLCDVITYEFENLSLQMIQYVEKSKPVYPSSKALEFTQDRLFEK
                     QFLQEQGIKTALWHAVDDMSSLVSGLSKLGGRGLLKTRRFGYDGKNQMMLNHPNEETL
                     EKAFTAFKEQASILEEIVPFLSEISVLSARTKQGEHIFYDCPENQHQNGILHKSFVPS
                     RIPLSVQKAAQEISATVMDALNYVGVLCIEFFVLMDGSLLVNELAPRVHNSGHWTQKA
                     CVTSQFEQHIRAICGLPLGSTYRHSNCEMTNLLGSNLQDFKYYLTQERTSVHLYGKSL
                     LQPTRKMGHVIQLTGPVTKYKQ"
     CDS             complement(598419..598601)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04650"
                     /product="hypothetical protein"
                     /protein_id="GFF02031.1"
                     /transl_table=11
                     /translation="MDAGVIGVVDVPAHHDALAKVLVCFEKGCVLLSGFFAGLSTVTF
                     GKSYGFVSLYFAIKSR"
     CDS             complement(598913..599194)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04660"
                     /product="hypothetical protein"
                     /protein_id="GFF02032.1"
                     /transl_table=11
                     /translation="MRCEEVFGKELLEEDLFWGHWGGVRAVCGGKVFLDAGVIGVVDV
                     PAHHDALAKVLVCFEKGCVLLSGFFAGLSTVTFGKSYGFVSLYFAIKSR"
     CDS             599804..600601
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04670"
                     /note="frameshifted, insertion at around 600696,600721"
                     /product="hypothetical protein"
                     /protein_id="GFF02033.1"
                     /transl_table=11
                     /translation="MRFFVFLKTLQSRSFCIFQQSFLLFFTSFFIIFVSNLCFISRGY
                     GQNPPSLPAEPPSPQLLLPLDDLIPNDPSSAPAEPNSDSAATILEDFDAVHQSYAQRT
                     EQRKEAEILRLLKELKFCADVEKARKISQQLQRLWSQSGSETIDLLMLWAENAINADN
                     YGLALDYIDNALALLPTYAEGWIRRAWVHIQLSDFKLAMLDLNHALKLEPRNYIAFFE
                     LGITMEATERPKLALKAYETALEYYPQMQKVQKRIEELLDKQSPQAL"
     CDS             600696..600890
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04680"
                     /product="hypothetical protein"
                     /protein_id="GFF02034.1"
                     /transl_table=11
                     /translation="MILNLPCLTVTHALKREPRNYIAFFELGITMEATQPPKLALKAY
                     ETALEYYPQMQKVQKRIEEL"
     CDS             complement(601005..601160)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04690"
                     /note="possible pseudo due to internal stop codon"
                     /product="hypothetical protein"
                     /protein_id="GFF02035.1"
                     /transl_table=11
                     /translation="MVIQILAVVTEVEPARILERTNDGCTAAMASGIKFGRKPYPKIE
                     MTLSLMK"
     CDS             601504..601875
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04700"
                     /product="hypothetical protein"
                     /protein_id="GFF02036.1"
                     /transl_table=11
                     /translation="MGDFKVQNKNPHFNDISVGKRIRYRRKMLGLSQKQLGHSLGVTF
                     QQIQKYEKGINRVGAGRLQEIATLLDVSISFFYADISTKEHVSYPRNKGISNKEEDFL
                     LKSFRELKPKKQKAILCLLSD"
     CDS             602331..602687
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04710"
                     /product="hypothetical protein"
                     /protein_id="GFF02037.1"
                     /transl_table=11
                     /translation="MQNKNPHFNDISVGKRIRYRRKMLGLSQKQLGHSLGVTFQQIQK
                     YEKGINRVGAGRLQEIATLLDVSISFFYADISKKEHVSYPRDKGISNKEEDFLLKSFR
                     ELKPKKQKAILCLLSD"
     CDS             605780..606430
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TM27"
                     /locus_tag="BH623125_04720"
                     /product="5-formyltetrahydrofolate cyclo-ligase"
                     /protein_id="GFF02038.1"
                     /transl_table=11
                     /translation="MECFITLYEMIDERMTQDTKTTQSLSSVRAQLRKSGLSKRDALS
                     AQERDVFSQQACSHLMHVLEQRGEDFSRMILAGYWPIKSEIDPRPLFDCIRVRGGNLA
                     LPAVLDSTTMVFRTFSQSTVLEPMHFGTLGPGAENTVVIPSVILVPLSAFDSQCHRLG
                     YGGGYYDRAVEILQKQGHQIALLGLGFSCQEVSSIPHTEHDLIVEGIFTEKGFLKR"
     CDS             606434..607270
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_006314731.1"
                     /locus_tag="BH623125_04730"
                     /product="metallophosphoesterase"
                     /protein_id="GFF02039.1"
                     /transl_table=11
                     /translation="MIKTLMRFLFLGDIVGETGCNAVFAKLPGLVKKWQLDFVVVNGE
                     NASGGFGITQETYQDLLMAGADVVTTGNHAFARREIIRYMHENDRFLRPANFSKETPG
                     RGSGVFTAKNGARVLVVNLLGRIFMPCKVDDPFEIAEKILLACSLQEQADAIIFDFHA
                     ETTSEKQCFAHFLDGRVSVIVGTHTHTPTADAQILEGGTAYLSDAGMCGDYNSSLGMD
                     KEEPLHRFLYKKKQDRYEPARGPATLCGLAVEISEKTGLAEKVSPVRIGPHLKPASPD
                     FW"
     CDS             complement(609249..610544)
                     /codon_start=1
                     /gene="murA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TL93"
                     /locus_tag="BH623125_04740"
                     /product="UDP-N-acetylglucosamine
                     1-carboxyvinyltransferase"
                     /protein_id="GFF02040.1"
                     /transl_table=11
                     /translation="MDSIEIVGGKKLKGIIPISGAKNAALPLMIAALLTEETLSLDNI
                     PHLADIELLIRILNNHGVGYAVDGQKNHTECVHSRTIHFTAQKITTTYAPYDLVRKMR
                     ASFWVIGPLLARCREAYVSLPGGCAIGTRPVDFILEGLKTLGARITIENGYVHAKVPK
                     GLKGAHYRFPKVTVGGTHVMIMAAVTANGKTVLENAACEPEVTNLVQALNAMGAKITG
                     EGTTILTIEGVQKLNGARISVIPDRIEAGTYAMAVAMTGGDVMLKNANPHHLTQVLEI
                     LQKTGLDIEIKPQGIHLKRNLRQTKIMPVDIKTGPYPAFPTDLQAQFMALMTRAQGIS
                     HITETIFENRFMHVQELNRLGAQIKLDGQTATVFGTEHLQGAPVMATDLRASVSLVIA
                     ALAAKGKTTVNRVYHLDRGFERLEEKLARCGATIQRITV"
     CDS             complement(610696..610848)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04750"
                     /product="hypothetical protein"
                     /protein_id="GFF02041.1"
                     /transl_table=11
                     /translation="MTQMHQNQKQEKMNHQEQKEKQRQERLAQQLRQNLKRRKEQSRK
                     RAQKEF"
     tRNA            611028..611102
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="BH623125_t00190"
                     /product="tRNA-Thr"
     CDS             complement(611728..611925)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04760"
                     /product="hypothetical protein"
                     /protein_id="GFF02042.1"
                     /transl_table=11
                     /translation="MSAGYVCEGEDALGEEYQRDACEGGCLGEEYQRDACEGEDALGE
                     EYQRDACEGGCLGGRVSAGCV"
     CDS             complement(612310..613026)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04770"
                     /product="hypothetical protein"
                     /protein_id="GFF02043.1"
                     /transl_table=11
                     /translation="MPIIIDCIQGTEQWYQARNGLITASLFEMVMAQKKQGQKTSKYH
                     AVMRKLAGERITGKTVEEATTLSMRRGTELEPTARKLYATLTHTEPQSVGFVLADDRM
                     KGFSPDAFIGTNGLLEIKTKKPEILIPYFTQKSFPAEHKAQCQGGLWIAQREWIDLML
                     YWPDMPLLIKRAYRDEAYIRKLESEINRFNEALEMMVQQIQCVKTAEGVRIQNTSEEG
                     TSRRLVRGGCFGGRVSTGCV"
     CDS             complement(613120..613305)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04780"
                     /product="hypothetical protein"
                     /protein_id="GFF02044.1"
                     /transl_table=11
                     /translation="MVFWGECLGGVDKGGSVYTGKRCSVSMGMRGLQGIDSAPMGMWA
                     RIHGGGSIAHNVAKVWK"
     CDS             complement(614789..615178)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04790"
                     /product="hypothetical protein"
                     /protein_id="GFF02045.1"
                     /transl_table=11
                     /translation="MKNIAFVKEDEIIVLLCEDESCDALEGPIEQVEEVLEFIDEKET
                     VHRILRLDLTTLHADDVSEQIADAYVLNYEIDEQNTQLQPFILNSDAYHACLDKKVAH
                     EYDDNLYGSYEKQHRLRPCDVLNDYWW"
     CDS             615266..615571
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04800"
                     /product="hypothetical protein"
                     /protein_id="GFF02046.1"
                     /transl_table=11
                     /translation="MSNYFILNKRYIFSLYDVPNGMCEQKFALFCSPHVLVLFSICSY
                     STQPQTDRRAKMSDLELIKYWRTLDLKTQKELILMLHRMAAAKESKSLASPEERALK"
     CDS             complement(615492..615872)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04810"
                     /product="hypothetical protein"
                     /protein_id="GFF02047.1"
                     /transl_table=11
                     /translation="MQVCFIKKDVFFLKDALYGETMYINGWRQRLAAALEKSGRSKRS
                     ISLAAGKGAGYLHSILVEGKEPTIESLARVCHEINISMNYILYGQGASPEDKEFLDLI
                     SKLSPQERQAILTLLRRPSDEASE"
     CDS             616265..617293
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04820"
                     /product="hypothetical protein"
                     /protein_id="GFF02048.1"
                     /transl_table=11
                     /translation="MQHANQQENPYYESCTLPYVCWYQNDFLGGVRGMRAHEIGIYTI
                     LLNEMYARGRPLELSIERLARLCGCDKRTFVNVLEMLVREGKILNLAHGLWNKRCENV
                     FYERAKLLEQKSFAGRSSAKKRKKINAEIQQLLNERARDDKRNSESQKVKEKETPYGV
                     SEKPSFLTQTGEEKGHETTCTDLCSGCTSTQTSTQACSLTAPPEQEGTKHCADFIGEQ
                     AKFSGSSGQTKSRSMLPKGQRLPSDWQADIGAAISEGLSEEQARWQEKKFRDYWHAKS
                     GKEALKVDWQATWRNWFRREIERIKDHQERLAMFSSHASLTRHSSDSDALYRTLINYR
                     TNKHEHDC"
     CDS             complement(617737..617985)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04830"
                     /product="hypothetical protein"
                     /protein_id="GFF02049.1"
                     /transl_table=11
                     /translation="MEEKAGVWSVGVGAWCVEADAWCVEDFVRSEKEGAFFVFVCKLV
                     GFLVFVCEWLELSSFAGVAGRLWVLLFVLEMRCLEEGR"
     CDS             complement(619268..619978)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04840"
                     /product="hypothetical protein"
                     /protein_id="GFF02050.1"
                     /transl_table=11
                     /translation="MLFVSRMQFMEESVWSVGVGAWCVEADAWCVEEAVRSEKEDAFF
                     VFICKLVGFLVFVCEWLELSSFAGVAGRLWVLLFVSRMQFMEESVWSVGVGAWCVEAD
                     AWCVEEAVRSEKEDAFFVFICKLVGFLVFVCEWLELSSFAGVAGRLWVLLFVSRMQFM
                     EESVWSVGVGAWSVEADAWCVEEAVRSEKEDAFFVFICKLVGFLVFVCEWLELSSFAG
                     VAGRLWVLLFVSGVQFMG"
     CDS             620058..621455
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04850"
                     /product="hypothetical protein"
                     /protein_id="GFF02051.1"
                     /transl_table=11
                     /translation="MQINTKNASSFSDRTASSTHHASASTDHAPTPTDQAFCFTNRTL
                     VITEGEIDALSLAAYGYPAVSVPFGGGVGGKQNWIENEFDHLESFEIIFLATDMDKPG
                     EEAAHEIANRLGRHRCYRVQLPCKDANDCLTAGIDAATIKAAFSSAKSFAPKGLRRAS
                     DYKDQVIGLFWPEPKQHLGYTVPYPKLNGKLYFRPAELTLWSGASGAGKSQLLSDCIP
                     HWISQKSRLCLASLEMKGAQSLRRLTKQTGGLEHPTREMIERILQFLDDGLILYEHVG
                     KSSVDTLLDVFDYCRARYGCDQFIIDSLMRLGIASDDYTGQEQAVYKMVDWAILNNVH
                     IHLVAHARKSGLDKDIPGTEDIKGASEIGANAFNIITIWRNRSLEDKIFAASLEQEKA
                     DLAKRPSVIMNIAKQRSGDFEGKIGLWFDRQTYRYRCSSEHPLTPRRYLEHPIQNTNL
                     LKNQSQVKPERFAPI"
     CDS             complement(622495..622707)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04860"
                     /product="hypothetical protein"
                     /protein_id="GFF02052.1"
                     /transl_table=11
                     /translation="MSEWGFLSEWGFLSEWGFLGEWGFLGEWILICIVGSVLRGAYEG
                     SFANEVAKGVSMTWLWFSKGKGFAVQ"
     CDS             622997..623563
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04870"
                     /product="hypothetical protein"
                     /protein_id="GFF02053.1"
                     /transl_table=11
                     /translation="MKHQDKRKNTTPPSARSHCDKEQPHLGHLKTQEVVIETSNPYFQ
                     PTHLESSNNPRTIKAIVNAGSRPIALLYAKGHISKAQYRAAERFYVYWRQSQSDLHMS
                     PDYTRPKIACGQSYTHPIERQIEASNHLQKVKVLLGILGYSLIEQVVGYGQAIKDLNP
                     SKRKQNSLADHLRDCLELLACHWGYTSG"
     CDS             complement(625867..625998)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04880"
                     /product="hypothetical protein"
                     /protein_id="GFF02054.1"
                     /transl_table=11
                     /translation="MAAGALIAGGGKGTGEQGEWMEKDGLVAGEKGLVSRVKGWGEG"
     CDS             630065..630238
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04890"
                     /product="hypothetical protein"
                     /protein_id="GFF02055.1"
                     /transl_table=11
                     /translation="MNIRYIFIAGAITSSLALAMQENDYIINTQQANIINPYTIPGSD
                     LQFIELINIELNK"
     CDS             complement(631113..631397)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04900"
                     /product="hypothetical protein"
                     /protein_id="GFF02056.1"
                     /transl_table=11
                     /translation="MGDFVLHKMLRFQFSIPPWKKDFLSWSTGKTKVISYALTYLGVL
                     TLLGDVEVLQFYSKSFAVVDQLGFDENREDFYREEIHLKHALLIDCRRDG"
     CDS             complement(633302..633580)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04910"
                     /product="hypothetical protein"
                     /protein_id="GFF02057.1"
                     /transl_table=11
                     /translation="MTSRNAGEGNNEEFFISFVCVVCRAMIFALSLRRCIHESKVAFC
                     CSDGGVIIAVYNTIITCSKFYSKMVRELKKVIKPCLRALERFLKMEQL"
     CDS             complement(633955..634113)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04920"
                     /product="hypothetical protein"
                     /protein_id="GFF02058.1"
                     /transl_table=11
                     /translation="MTFFTTLLVGLAILGLIILVILNNMMIVGIYYFCIKRARLYFRM
                     NKELKNNH"
     CDS             complement(635730..635948)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04930"
                     /product="hypothetical protein"
                     /protein_id="GFF02059.1"
                     /transl_table=11
                     /translation="MFGLFAREIRPLGSLGLPVILGLPRFLTVFMNLPFEVKKNSLAN
                     DDSMGKILSVMLLWGGAYRWEGDEKQRV"
     CDS             635857..636405
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04940"
                     /product="hypothetical protein"
                     /protein_id="GFF02060.1"
                     /transl_table=11
                     /translation="MKTVKKRGRPRITGKPREPNGRISRAKRPNKAVPQVTIEMRAKH
                     FGLSIEEAKNPLSSSYIGRLYMLGTKQNGSGINKEQYDTAQRYLQIRNDYLCAKGLPS
                     GYYDNFTHALSDEKAKKQWVRRATDHYEEMQEAIKEAQQLHRQHNFHGALQYLVVEDQ
                     SLPSLVCSLRLILDALHKHFDG"
     CDS             complement(636471..636716)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04950"
                     /product="hypothetical protein"
                     /protein_id="GFF02061.1"
                     /transl_table=11
                     /translation="MKGDGKDERFFVFKVLYLPKLSCLPVSKIMQTDRGNSLILIWYI
                     QSSHVAVCNKFLASHFTTVLPFSNNNIMMFQYKCMNA"
     CDS             639346..640008
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04960"
                     /product="hypothetical protein"
                     /protein_id="GFF02062.1"
                     /transl_table=11
                     /translation="MRKISKEGLALIKQWEGLRLSAYQDSIGVWTIGYGHTKSAGKPF
                     VRKGMTITEKQAEELLCRDLQQFENAVEQAVTVSLTDEQFAALVSFCYNVGTTAFCNS
                     TLLKKLNNGDYEAIPTELQKWTKAGGKRLQGLVNRRAAETGLWAKRSYVSSNTQKVEM
                     KDATGLFKLEALAPIIGSASGLGGLLTVNGPVQWALATVMIIAACAGIFFVAKRFQEH
                     RL"
     CDS             640005..640232
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04970"
                     /product="hypothetical protein"
                     /protein_id="GFF02063.1"
                     /transl_table=11
                     /translation="MIWWMKRNLIVTSAVLAAFFMALAKAFTLGKKIEQQKQTEKTLK
                     SATTRLEIENEVNKKSDADVRAELSSWLRDK"
     CDS             640349..640582
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_04980"
                     /product="hypothetical protein"
                     /protein_id="GFF02064.1"
                     /transl_table=11
                     /translation="MGGNMARKKTEKMKELTEAEKEMLQEIILTYQSVKMMSRFMKWI
                     AFFLFLLILDFARLIDAIENIFAHLKQWVISKK"
     tRNA            complement(642395..642479)
                     /inference="COORDINATES:profile:Aragorn:1.2.38"
                     /locus_tag="BH623125_t00200"
                     /product="tRNA-Leu"
     CDS             642764..643384
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013529435.1"
                     /locus_tag="BH623125_04990"
                     /product="membrane protein"
                     /protein_id="GFF02065.1"
                     /transl_table=11
                     /translation="MKDLMILNKLKLWTISLANRRTASYWLGFIAFIESSFFPIPVDV
                     LYLPMALVHPKKAYRYAFIATVCSVLGGVSGWFIGHFAYDTLAKPILEFYGKVESFQT
                     LKNSATLKFLVILLITSGFLHLPPLKITTLLAGVMGVHLGLFILTCIFARGARFYLLA
                     WLIKHFGRQAMHFLARHFKWIVLIGCVTLFLVYGIFITFVNKYLLF"
     CDS             643472..643969
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_006315687.1"
                     /locus_tag="BH623125_05000"
                     /product="disulfide bond formation protein B"
                     /protein_id="GFF02066.1"
                     /transl_table=11
                     /translation="MWAFSLSFFFLSIIGLALGFEHIGGYIPCDLCFIERFPYYGSLP
                     FLLLAGVGAWFFRTSFWVQLSFWCVFVLMTISLVLAVYHAGVEYGFWPAPLSCGVNMI
                     RRTPDVNQLFNQLNNIHPPSCSEASIRFLFLSFAGWNVVASLFSMLTSLYIASKGLLA
                     SYKKL"
     CDS             complement(643914..644099)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_05010"
                     /product="hypothetical protein"
                     /protein_id="GFF02067.1"
                     /transl_table=11
                     /translation="MVLGAGYWCFERAYVCALQGACVLWLESGDWRARGTEFGFRDAV
                     KVFYNLLRALLKQYISS"
     CDS             644763..645572
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_05020"
                     /note="frameshifted, deletion at around 645728"
                     /note="possible pseudo due to internal stop codon"
                     /product="hypothetical protein"
                     /protein_id="GFF02068.1"
                     /transl_table=11
                     /translation="MLRSFFSFVQRKALSFRSAQRVIFRALKTKKQHAALYLGYARAL
                     KPYSPKQAAVFTAMGIQELENYKQLLCLSCSNRAGTMDSACGRSSFVARKQPHTYSRT
                     KTTTQTTKKPSKAQKQTLLTWIQPGLAGLMDGSVSTLAPIFAAAFATGDTHQTFLIGL
                     SASIGAGLSMGFTEAAHDDGKLSGRGSPFKRGLASGIMTTIGGLGHALPYLISSFYIA
                     TIIAFIIVFFELWAIVWIQNKFMATPFWRASLQVLIGGALVFATGIFIGSI"
     CDS             646088..646558
                     /codon_start=1
                     /gene="dut"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q92SM6"
                     /locus_tag="BH623125_05030"
                     /product="deoxyuridine 5'-triphosphate
                     nucleotidohydrolase"
                     /protein_id="GFF02069.1"
                     /transl_table=11
                     /translation="MTLSIQRLDHGQGLELPHYATAGSAGLDLRAALSEEETVILAPG
                     QRALIPTGLIFHLSPGFEAQIRPRSGLALKHGITCLNTPGTIDSDYRGEVKVLLINCG
                     QEDFAIKRGMRIAQTVIAPVLQVNVCALEPQQNESTKNTVGNRGAGGFGSTGHD"
     CDS             646725..646937
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_05040"
                     /note="frameshifted, insertion at around 647025,646646,
                     deletion at around 646731,647110"
                     /product="hypothetical protein"
                     /protein_id="GFF02070.1"
                     /transl_table=11
                     /translation="MRLAGSEVKVLLINCGQEDFAIKRGMRIAQTVIAPVLQVNVCAL
                     EPQQNESTKNTVGNRGAGGFGSTGHD"
     CDS             646843..647028
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_05050"
                     /product="hypothetical protein"
                     /protein_id="GFF02071.1"
                     /transl_table=11
                     /translation="MCAPLNHSKTRAQKTLWETEEQEALAQQDTIKHPIAQEETVILA
                     PGQRALILTGLIFHLSP"
     CDS             647104..647325
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_05060"
                     /note="frameshifted, insertion at around 647025, deletion
                     at around 647110"
                     /product="hypothetical protein"
                     /protein_id="GFF02072.1"
                     /transl_table=11
                     /translation="MRLAGSEVKVLLINCGQEDFAIKRGMRIAQTVIAPVLQVNVCAL
                     EPQQNESIKAIREIEVPLSRRQKLNAMGI"
     CDS             complement(647384..647965)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_05070"
                     /product="hypothetical protein"
                     /protein_id="GFF02073.1"
                     /transl_table=11
                     /translation="MKANFNEDWDLDESGLHNEINVTPFIDVVLVLLIVFMVAAPLAT
                     SVIPVQLPSITQAPSVIQPDEPLYVTLQKDHSLYVGDHLVSKTTFVEALLKETNQNLE
                     TKVLIKADSEIDYGTVVDLLNQIRTAGYTKVGLIGLQKSTNISARGVKNNKTAGAVEA
                     TEINVTGDAGVVAKSGEVVNANTATMEIVSPGE"
     CDS             complement(647962..648804)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_05080"
                     /product="hypothetical protein"
                     /protein_id="GFF02074.1"
                     /transl_table=11
                     /translation="MESETIPLDTPPAVFAAHDLSPFSMFMAADFVVKAVIVLLLLAS
                     LASWTIAFVKIIEITLAKRKARHELRLVLSAQTLTRLAASLKDSKGPGVFFFKEMLKE
                     VYLSTQKVNFIATEDSSERQGEQTVVCEDAIPYAEIARYGETARGVNEGLKERVHSLL
                     SRCLLAATRRVACGSAVLATIGAIAPFVGLFATVWGIMNSFIGIAQSQTTRLDVVAPG
                     IAEALLATAIGLFVAIPAVVMYNSLMRALSGYRNDLGDIAAALERLLSRELDRYRQQK
                     SHKQ"
     CDS             649290..649616
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_05090"
                     /product="hypothetical protein"
                     /protein_id="GFF02075.1"
                     /transl_table=11
                     /translation="MANNKTTEHNKTAAEKDLQTQLENLRTEISGITSTLTDLGSSKL
                     NSVKNKAGKLYNSAKENSEDILSQAKDKIGDLEHTMNQCVRDNPGKSVLFAAGIGFIL
                     AHLLRR"
     CDS             649626..650057
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_05100"
                     /product="hypothetical protein"
                     /protein_id="GFF02076.1"
                     /transl_table=11
                     /translation="MFIAPLLNHLVGGELKSTVKQVRLQAICFGIIGISLFMSLIFLS
                     VIGFIALSSVIKPLTAASVLFFIWLFLATLGILISRFLKAYQHYDQQKKSEEQRHKLM
                     TEATLESVALLSKHLPFAKLGIPILGLATYFLWKKEKKDRF"
     CDS             complement(650149..650337)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_05110"
                     /product="hypothetical protein"
                     /protein_id="GFF02077.1"
                     /transl_table=11
                     /translation="MKGIGEHLKEMRKDAKETEGCLKGAYNLLEKRHVMIQGMVDAWD
                     VKAYRFLLFLFTRKDEGF"
     CDS             complement(650818..651186)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_05120"
                     /product="hypothetical protein"
                     /protein_id="GFF02078.1"
                     /transl_table=11
                     /translation="MVDAMRKKGYNVGGEASGHIVLSDFGTTGDGLVAALQILACMQE
                     IQIPMSHLCQRFEPVPQIFKNVMIKNKNVLKKNPVKTAIEQATQRLGKKARLVIRASG
                     TEPVVRIMIECINAKFYAVC"
     CDS             complement(651338..652717)
                     /codon_start=1
                     /gene="glmM"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A6UCS2"
                     /locus_tag="BH623125_05130"
                     /product="phosphoglucosamine mutase"
                     /protein_id="GFF02079.1"
                     /transl_table=11
                     /translation="MPQKYFGTDGIRGKANVFPMTPDFAMKVGMAVGILFRSQNQSRR
                     VVIGKDTRLSGYMLENALVSGFTAAGMEAFLLGPVPTPAVAMLCRSLRADLGVMISAS
                     HNPFYDNGIKLFGPDGFKLSDEIEEKIEQLIDTDLSKSLASCAEIGYAKRVEGDIYRY
                     IEYAKRTLPRDVRLDNLRIVVDCANGAAYKAAPRALWELGAEVFAINDTPNGTNINHK
                     CGSTDLASLKQKVHEVRADVGIALDGDGDRVLLVDEKAQTVDGDQLIAVIAEHWHKNG
                     RLQSKGVVTTIMSNLGLERFLNSKGLDLVRTKVGDRYVVDAMRKKGYNVGGEASGHIV
                     LSDFGTTGDGLVAALQILACMQEIQIPMSHLCQRFEPVPQIFKNVMIKNKNVLKKNPV
                     KTAIEQATQRLGKKARLVIRASGTEPVIRIMGEGDEREMLDAVVTEMVDIITHHDTLS
                     KACASLERS"
     CDS             complement(653537..655684)
                     /codon_start=1
                     /gene="ftsH"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TN14"
                     /locus_tag="BH623125_05140"
                     /product="ATP-dependent zinc metalloprotease FtsH"
                     /protein_id="GFF02080.1"
                     /transl_table=11
                     /translation="MNSNYRSLLIWGVIALILIVSFSLFNGDSQRSGGGELSYSEFLQ
                     KVENNELQAVTIQGQKLTGKTVENRVISTYAPRDPGLIQKLESKNVNVKAVPESSGNS
                     IFLNLLFSLLPVIIIVGAWIFFMRQMQSGSRGAMGFGKSKAKLLNEAQGRVTFQDVAG
                     VEEAKQDLQEIVEFLREPQKFQRLGGRIPRGVLLVGPPGTGKTLLARSVAGEANVPFF
                     TISGSDFVEMFVGVGASRVRDMFEQAKKNAPCIIFIDEIDAVGRHRGAGLGGGNDERE
                     QTLNQLLVEMDGFEPNESIILIAATNRPDVLDPALLRPGRFDRQVVVPNPDVSGREQI
                     LKVHVRNVPLAPNVDLKVLARGTPGFSGADLMNLVNEAALMAASRNKRVVTMQEFEDA
                     KDKVMMGAERRSTAMTQEEKELTAYHEAGHAIVALNVPVADPVHKATIVPRGRALGMV
                     MQLPEGDRYSMSYRWMISRLAIMMGGRVAEELKFGKENITSGASSDIEQATKLARAMI
                     TRWGFSDLLGNVAYGDNQDEVFLGHSVARTQNVSEETARMIDAEVRKLIDDAYTNATK
                     ILKAKKKEWFALAQGLLEYETLTGAEIQEVIAGKPPSRTQKNENASPRTSSVPKAGAS
                     KAEFDQETLDKKDAHKADKEKEKLKAGMEKVKSNHAKSNDSVSKRKKSPGAEKKTQST
                     KKTPQAANFSGSKENTEKDLNAAERKGKQEPKA"
     CDS             complement(655799..657280)
                     /codon_start=1
                     /gene="tilS"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TN13"
                     /locus_tag="BH623125_05150"
                     /product="tRNA(Ile)-lysidine synthase"
                     /protein_id="GFF02081.1"
                     /transl_table=11
                     /translation="MCVRLAGNLFKTSDFIQCQKLILAVSGGSDSLALLFLVKDHLKT
                     LSVPPEIIVVTVDHQLRQESAREASIVAEICRAHHIQHRIVRWEGKKPKTHIASSARV
                     ARYDLLFQEAQKQGATLIMTGHTLNDQVETYQMRYQRLQKSADVLQQEAFAEMGGGVH
                     ADVLQQEAFAERCERMGVGGHGGDIAEKSDGLIYERGLSCIPREALLRGTVRLIRPLL
                     GVKRETLRTYLRLKEKTWIEDPTNEDCNFERVRVRQSLQPKKFTCIARKVHEAALQRR
                     QQAKNIADLILALDITVEYGRCFIAKPALFLQKHPGFPFVVGLFAVLMGGGFYLLPHK
                     KLSTLVQKLSLHSSEKRRFTYAGSVIEYNRSGIAFWREARNIKEAIVEKGQTFLWDGR
                     YQITNHSHEPIKVGAAGLQQLKSLFKNNNFNLENTHFPSLKSLLMISNDKGYDIPELA
                     YHAAMQHTITIRRIMAPFDWLLSSQDAAFVNVVQPFFDIKVKG"
     CDS             complement(657633..657821)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_05160"
                     /product="hypothetical protein"
                     /protein_id="GFF02082.1"
                     /transl_table=11
                     /translation="MHGYLNETGEHLKEMHKDAKETEGCLKGAYNLLEKRHEERDHVE
                     LHYGENFSLLKLLFSSIV"
     CDS             complement(658154..658903)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_05170"
                     /product="hypothetical protein"
                     /protein_id="GFF02083.1"
                     /transl_table=11
                     /translation="MWMYCRKKLKIVFYMAIFIACSASFAQSAAHWVSKYFTHDSESS
                     ATDKPSDAVDETAPGATDKPSDAVDETAPGATDKPSDAMDEAAPDAADKPSDAMDEAA
                     PDAADKPSDAMDEAAPDAADKPSDAVDEAAPDAADKPSDAMDEAAPDAADKPSDAVDE
                     AAPDAADKSSDAVDEAAPDAADKSSDAVDEAAPDAADKPSDAVDEAAPDAADKSSDAV
                     DEAAPDAADKSSDAMDEAAPDAADKASDVGE"
     CDS             complement(658953..659477)
                     /codon_start=1
                     /gene="omp16"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q926C3"
                     /locus_tag="BH623125_05180"
                     /product="outer membrane lipoprotein Omp16"
                     /protein_id="GFF02084.1"
                     /transl_table=11
                     /translation="MRFLKNIIFQPLTVVLFFSLSLVGCGDKKNVGALSGINGAFLNN
                     AGFNQATLGSSQDFTVNVGDRVFFSLDSSSIEPDAEAILMRQAEWLLRYPFYSIVIEG
                     HADERGTREYNLALGQRRAVAVRNYLISLGVSAQRIQTISYGKERPVAVCDDISCWNQ
                     NRRAVTTINNINRN"
     CDS             complement(659678..660376)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012067400.1"
                     /locus_tag="BH623125_05190"
                     /product="hypothetical protein"
                     /protein_id="GFF02085.1"
                     /transl_table=11
                     /translation="MATQLLMPKATAVWLVDNTALTFDQIAEFCKLHVLEVKAIADGE
                     AAYGIKGLDPISSGQLTRSEIARVEADKNARLKISQSKVHIPEKKRKGARYIPLSRRQ
                     DRPNGILWLVTNHPELKDAQIARLIGTTKGTIEQIRNRTHWNSANLVALDPVGLGLCL
                     QIDLDIELKRAAKNRPLSNEEDKSLLPASVTENVAIHEKEHEQDFNKNFDADKVFAKL
                     NALQKNRENDASTE"
     CDS             660789..661535
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q92M88"
                     /locus_tag="BH623125_05200"
                     /product="putative transcriptional regulatory protein
                     R02753"
                     /protein_id="GFF02086.1"
                     /transl_table=11
                     /translation="MAGHSQFKNIMHRKGRQDAMRSKIFSKLAREITVAAKQGSPDPA
                     MNPRLRLAVQNAKAQSMPKDNIERAIKKASGSDVENYDEVRYEGYGPGGVAVIVEALT
                     DNRNRTASNIRAAFTKSGGALGETGSVSFMFNRIGEIIYKPEAGTTDNIMDAAIEAGA
                     EDVQSEETGHHIICTFEDIGEVSKMLEAKLGEAESIKTVWKATTLTPVDEEKALSILR
                     LISTLEEDDDVQNVYANFDVSDEILAKLSA"
     CDS             complement(664179..665510)
                     /codon_start=1
                     /gene="tolB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8U9L4"
                     /locus_tag="BH623125_05210"
                     /product="protein TolB"
                     /protein_id="GFF02087.1"
                     /transl_table=11
                     /translation="MMIMTTRTFFSWFIVICAFWLTSFSSVPVHAQLKGTISTADFNP
                     IPIAVTDFFSNDSIGLKIAAVVAADLERSGLFLPLDKASFLEKISNPNRQPHFPYWQE
                     IKAQGLVIGQVIRENDGRLRVDFRLWDVFGQRQLKGRRFYTATERWRRVAHMIADEIY
                     SEMTGESGYFDTRIVFIDETGPQNARIKRLAIMDQDGANLIYISDGSELVLTPRFSPK
                     RQEITYMAYEHNQVPHVYLQQIEMGQRELIGTFNNMTIAPRFSSDGQKVIMSLLQNDG
                     SANLYTMDLRTRMMTRLTTTSAIDTSASYSPDGTKIVFSSDRSGKPQIYTMNADGSNL
                     QRISSNEGSYSTPIWSPRGDYIAFTKQLEGQFSIGVMHPDGQGERILTTGFHNEGPTW
                     APNGRVLMFFRKNPGMGPKIYTIDITGRNERQLPTPNDASDPAWSPLLNIQ"
     CDS             complement(665554..666699)
                     /codon_start=1
                     /gene="tolA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012709284.1"
                     /locus_tag="BH623125_05220"
                     /product="hypothetical protein"
                     /protein_id="GFF02088.1"
                     /transl_table=11
                     /translation="MALSLVVHVIFLSWGSIYFTNPVSLPQQLEAVPIILAPVTEEFA
                     SQQGALNAPVRAIPAVKPTTKPQEKEDARHFGEGQIDSLAPFKPKEKPRSVETTPSSS
                     GEEKASEKSLPVIREQELRETKAEKVSEKPLEVAEKIAPASPEEVHPEVAEKVASETV
                     QQTHKNQGGILPQDLASTEKKVPGDQATRYQQLPKIALPEKFPFPQFKPKPVKESAVQ
                     NAQAVKKQNQRMKEKTIEDVLAMEENNLLNHARSQGGGAKRSSELESLGARKNINDTT
                     KMAQTLVSIAGGCIQKKLKLVALGGDLKNRPVVRLRFYLNREGMIMGDPIIDPLSGEQ
                     SQQAIMIRQVYAAVFSCQPYTDLPRDQYDLWGQGFDFNVDPLQEIIR"
     CDS             complement(666814..667266)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013529146.1"
                     /locus_tag="BH623125_05230"
                     /product="protein TolR"
                     /protein_id="GFF02089.1"
                     /transl_table=11
                     /translation="MGISVASSAHKNTRRRRRSHSQLMSEINVTPFVDVMLVLLIIFM
                     VSAPLLVNGVPLDLPRSQAGPVQMEKTPLTVSLDGQGRLALNQDYYETFEALIAQLKT
                     LLKTDVEQKKQRIFVRAAKTIEYQKVLQLLAELQKAGFSQVALASLAQ"
     CDS             complement(667280..667993)
                     /codon_start=1
                     /gene="tolQ"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003527594.1"
                     /locus_tag="BH623125_05240"
                     /product="Tol-Pal system subunit TolQ"
                     /protein_id="GFF02090.1"
                     /transl_table=11
                     /translation="MPHIELTNPETIGIVHLFMQAGFVVKAVMIGLLLASIWSWAIIF
                     DKILTYRRIRREIKQFERIFWSGKPLEDLYATCKSQRTSSISAVFMAAMVEWKKSLEK
                     GIHTSISLQSRIDKAMDLILGRESAKIEAKLSFLATLGSAGPFIGLFGTVIGIMGSFL
                     SISASQNTSLAIVAPGIAEALLATAIGLFAAIPAVIAYNKFVNESAQIIAQIENFADE
                     FSTIISRRIDETLTSHSPL"
     CDS             complement(668138..668578)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013529144.1"
                     /locus_tag="BH623125_05250"
                     /product="tol-pal system-associated acyl-CoA thioesterase"
                     /protein_id="GFF02091.1"
                     /transl_table=11
                     /translation="MLEKKTFKSSHTNAFHDFQARVYVADTDFSGVVYHARYLEFFER
                     GRSEFLRDTGFNNTLLASGVEGEKLFFVVRHMEINFSRPAQIDNLLTIKTRISRLQGA
                     RFFMEQYILHGESMLVTAKVEIALINEEGKPRRLPKELFSTIVV"
     CDS             complement(668793..669878)
                     /codon_start=1
                     /gene="ruvB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TN03"
                     /locus_tag="BH623125_05260"
                     /product="Holliday junction ATP-dependent DNA helicase
                     RuvB"
                     /protein_id="GFF02092.1"
                     /transl_table=11
                     /translation="MHKDEDQRLLGAVPLPNDPDRSLRPQVLDDFIGQEAARANLKIF
                     IEAAKARQEALDHVLFVGPPGLGKTTLSQIMAKELGVNFRSTSGPVIAKAGDLAALLT
                     NLEERDVLFIDEIHRLSPAIEEILYPAMEDYQLDLIIGEGPAARSVKIDLAKFTLVAA
                     TTRLGLLTTPLRDRFGIPIRLNFYTIEELEYIVQRNARLFSVQISEDGAHEIARRARG
                     TPRIAGRLLRRVCDFALVKRAKKIDRKIADEALSRLEVDHLGLDPLDRRYLLLIAQTF
                     LGGPVGIETIAAALSEPRDAIEDIIEPYLLQQGFIQRTARGRILHQKAWSHLGLCAPA
                     STQKHPQLFDMPDNASRQTVLWDEADD"
     CDS             complement(669891..670508)
                     /codon_start=1
                     /gene="ruvA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TN02"
                     /locus_tag="BH623125_05270"
                     /product="Holliday junction ATP-dependent DNA helicase
                     RuvA"
                     /protein_id="GFF02093.1"
                     /transl_table=11
                     /translation="MIGKLKGILEHIFDDHIIVNVQGVGYVVFISNRLRPSLPALGES
                     LSLFIETHVREEAIRLFGFIAKAEQEWFCLLQNVPGVGAKVALAILGTLSPDELAQAI
                     ALNDIAMISRAPGVGKKVSERIVSELKSKALPFSEKVIHSAPLPHLEVTNQPTNDALS
                     ALIKLGFERDQAARALALAVNALEGETVSSALLIRHSLKLLSPPT"
     CDS             complement(670505..671032)
                     /codon_start=1
                     /gene="ruvC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8U9K4"
                     /locus_tag="BH623125_05280"
                     /product="crossover junction endodeoxyribonuclease RuvC"
                     /protein_id="GFF02094.1"
                     /transl_table=11
                     /translation="MYKLGFMAETIRIIGIDPGLRRTGWGVIDFSGNRLQFVAAGTLT
                     SDARCDLASRLCQLYKGLTDILHQFMPQEAAVEHVFVNKDATATLKLGQARAIALLAP
                     AQANLPVFEYAPNKVKKSVIGVGHGDKEQIHMMVKVLLPRAEFDSSDAADALALALCH
                     STHRIGASYHARIMA"
     CDS             complement(671464..671982)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013529136.1"
                     /locus_tag="BH623125_05290"
                     /product="AraC family transcriptional regulator"
                     /protein_id="GFF02095.1"
                     /transl_table=11
                     /translation="MSAYKRPYDEPIIMVEHNAFDNAFNRLYEETMALIEQTATYIDT
                     EGKLAARSLSAEVSALYAKEAMYLSTRLMQIASQLLLLRAEREGEMSPEQIQKELAKV
                     SLHTPTLKLESAHWQEFPEVFRNFVARSLRLEARMQYLRTGREGISSPVLEDENPVGK
                     QIELLKTAFRRS"
     CDS             complement(672148..673290)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013532270.1"
                     /locus_tag="BH623125_05300"
                     /product="membrane protein"
                     /protein_id="GFF02096.1"
                     /transl_table=11
                     /translation="MAYQSVLKHNIHPLHRDTRIDVFRSLALLTIFINHIPGTLYESL
                     THRNFGFSDSAEVFVLLSGVALGLSFHNRLQQKPFTFIVRKLWRRALQLYAAYLFTTF
                     VTLSLFLGAFCLWQTEKLLSMNNVGLFFTQPFIAFFSVLSFGHQLGYNNILPLYIVLM
                     LFAPFALYLSCKQKGLLLLGSFMLYLLSGFYEIAPPSYPLKGKWFLNPLSWQFLFVIG
                     LVSSLSLQQGKNIACQTFFLVFAAAYLLFSLLWVRLEWWGVLGWLGWSSPLINFNKTF
                     LSLPRLLHVVALSFFILCLPRFHTWFHVAEKHPLAILGKHSLPVFVTGTVFAMVGQIL
                     KTVMTGTFFSDSLLIISGIALQFGVAYYYEKRPSLHRFFARKPLCL"
     CDS             673401..674063
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_05310"
                     /product="hypothetical protein"
                     /protein_id="GFF02097.1"
                     /transl_table=11
                     /translation="MTKQKSKPVEYHPFPQLVLTLDVRRSFTPTFLRQILQTRSFACV
                     ILYDSQGVQDDAVFLQKQAQIYAEDIQSNGAAFLISGERRVSERIKADGLHIEGDLKA
                     LEYCDYQKKEQKIIGFGNIRNRHCAMVAGEAGVDYLLFGKLGADKKPHAHPRNLQLAR
                     WWAEIMETPAIVQAGSDFATFDEVIKTACEFIAIEEVIFAHDNPLMLLKMMQEKCKNS
                     PL"
     CDS             674393..675139
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_05320"
                     /product="hypothetical protein"
                     /protein_id="GFF02098.1"
                     /transl_table=11
                     /translation="MEYKYRGTFEDFQKTICEAGYCILEAKLLPHQSPGTYQIKTFCG
                     GVIIWFEKTGTLSFQGKDPAAKKLKEDLTPYIEQKSKTPSPKTSSNTSNKKIFIVHGH
                     DHVSLKDLELSLRRLGFEPYILQNTGGNGLPIIETLKKEICNDSIGFGIVLLTPDDMG
                     YAKSDGEEAAQPRARQNVIFEMGMLAAVFPLERIAILQKKGVEIPSDIHGVYYLSFNE
                     YVKEIMPKLSKRLGEAGFTIDPEKLAYASS"
     CDS             675599..675985
                     /codon_start=1
                     /gene="phrR_2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013384991.1"
                     /locus_tag="BH623125_05330"
                     /product="transcriptional regulator"
                     /protein_id="GFF02099.1"
                     /transl_table=11
                     /translation="MQARNLHQAKNLHNDIFVGKKIRFRRKMLKMSQKTLADHLRVSS
                     QQIQKYETGLNRVSAGRLKEIADILSVPIAFFYADFLTQQKSPTQHDEIASNREEYLL
                     LKRFRVLTSVKQRAILQLLSEPNESF"
     CDS             676995..677381
                     /codon_start=1
                     /gene="phrR_3"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013384991.1"
                     /locus_tag="BH623125_05340"
                     /product="transcriptional regulator"
                     /protein_id="GFF02100.1"
                     /transl_table=11
                     /translation="MQARNLHQAKNLHNDIFVGKKIRFRRKMLKMSQKTLADHLKVSS
                     QQIQKYETGLNRVSAGRLKEIADILSVPIAFFYADLFTKQDTPTQHDEVASNREEYLL
                     LKRFRVLTSVKQRAILQLLSEPNESF"
     CDS             677696..678094
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_05350"
                     /product="hypothetical protein"
                     /protein_id="GFF02101.1"
                     /transl_table=11
                     /translation="MLKYLFLSSLVLAAGCASVGSYSSNYVDQNITENEAKLVANDFI
                     SNIKRPLPPATTTILIKKNDTADNFTPLFINLLQRTGYNVIYTDQPQKQQNIGVNLNY
                     RIQLNNRTIVYVLQYNVAGEPRVHIHSRPR"
     CDS             678929..679972
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010947931.1"
                     /locus_tag="BH623125_05360"
                     /product="HcpA family protein"
                     /protein_id="GFF02102.1"
                     /transl_table=11
                     /translation="MLKRSIRLLTMGIIWFAISVANSTGRAEKSSDLERYLNTIQDPE
                     NIDKPFQPLQAGEYDQAYDYYIQGYYLKAFREALRRAEQNDPFAQTLVARIYMEGCAV
                     PIDGARAALWFGRAAKQGEPQAQLRYGLMLFDGNFIAQNQEIGEEFIRKAVDAGVKEA
                     YYYYGQLLLYKASREKQALAGVFSQSQENEAIDQALKWFLKGAALGDAAAAFAAAKIL
                     SLGTLTRPKDDRNARKLMEVAAQNKHLEAQILLAQWLVQGRGGETDFQRAFHLLLSNA
                     TKMIAPAQVALARLYRDGIGTKGDIVRAAAWYMLAKHAKIQAPDLEMMLEGMDHAQLE
                     EARKEIIKLLPIF"
     CDS             680190..680792
                     /codon_start=1
                     /gene="efp"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TMY9"
                     /locus_tag="BH623125_05370"
                     /product="elongation factor P"
                     /protein_id="GFF02103.1"
                     /transl_table=11
                     /translation="MQEWNWIETMKINGNEIRPGNVIEHQGSLWVAVKCNAVKPGKGG
                     AFNQVEMKNLIDGTKLNERFRAAETVERVRLEQKDFTFLYQQGDALIFMDSQSYEQLE
                     LQKDFVGERAAFLQDGMTVTVELYQEKPIGISLPDQVSVTIVEADPALKGQTVTASYK
                     PAILENGIRILVPPFINAGERIIVDTNELIYVRRANEKDK"
     CDS             680803..681594
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013529126.1"
                     /locus_tag="BH623125_05380"
                     /product="inositol monophosphatase"
                     /protein_id="GFF02104.1"
                     /transl_table=11
                     /translation="MPQSAVMNVMVQAAMKAGRSLVRDYGEVQNLQVSLKGPADYVSQ
                     ADRKAEKIIFNELSKARPKFGFLMEESEEIIGEDSQHRFIVDPLDGTTNFLHGIPFFA
                     VSIALESQGKIVAGVIYNPINDELFTAERGSGAFFNDRRCRVSARRRLEDCVIATGMP
                     HLGRPGHGTYLIELRNVMAEVSGIRRFGTAALDLAYVAAGRTDGFWEDNLQIWDMAAG
                     ILMVREAGGFVTDKEGGNDIFRKKNIIAGNEHIRIKLERALKKGI"
     CDS             complement(682402..684192)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013529119.1"
                     /locus_tag="BH623125_05390"
                     /product="ABC transporter"
                     /protein_id="GFF02105.1"
                     /transl_table=11
                     /translation="MNFFNHSEKAKKFFHTKPSFSSLTTFSPYLVRYRWLFVFAFIAL
                     SVAALVTLTLPVAIRQMLDHGFSTSSHGHINFYFALLFVLALLLALASACRYYCVITL
                     GERIVADLRRDVFVHIMKLSPAFFDRSHSGELVSRLLTDTTQIKLAVGSTASTALRHL
                     IVVIGAIVMMVITNAKLSSLVLLAIPFVAIPLVVFGRKVRTRTRAAQDRIADANALAT
                     EQVSAIRTVQAFTAEKLVSKRFSQLVERAFQTARSSVILRSFFTGFAIFLVFGSVVAV
                     LWIGSRDVLNGTMTGGALGQFVLYAVFGASTFAQLSELGAELIQAAGAAERLAELLQE
                     QPTILAPKAPAPLAKPVQGALVFDQVDFTYSSRPQEKILRSLSFSVKPGETVAFVGAS
                     GAGKSTLFSLILRFYDPISGQIRFDGVEIKRLSLQDLRSSISYVPQDVAIFDGTLRDN
                     IVFGTENMTEEQIIAAAKAANALEFIEALPNGLDTEVGERGIMLSGGQKQRIGIARAI
                     LRNAPLLLLDEATSALDANSEKLVQEALEELMQNRTTLVIAHRLATILKADRILVMEK
                     GALVEEGTHAELVAQNGVYAYLAKLQFSPE"
     CDS             684380..684601
                     /codon_start=1
                     /gene="rpmE"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TM38"
                     /locus_tag="BH623125_05400"
                     /product="50S ribosomal protein L31"
                     /protein_id="GFF02106.1"
                     /transl_table=11
                     /translation="MKANIHPDYHKITVVMTDGSQYTTRSTWGKEGDVLNLDIDPRTH
                     PAWTGGSQTLVDHGGRISKFKNRFGNLGM"
     CDS             complement(687533..687745)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_05410"
                     /note="frameshifted, insertion at around 687391, deletion
                     at around 687538"
                     /product="hypothetical protein"
                     /protein_id="GFF02107.1"
                     /transl_table=11
                     /translation="MLYQTVEGRNILLCERLKDYYALGARFAKWRAVIAIDAQTLPTR
                     GAINQNVQAFARYAALCQEAGLVLIC"
     CDS             complement(687811..688842)
                     /codon_start=1
                     /gene="fbaB"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q92M78"
                     /locus_tag="BH623125_05420"
                     /product="fructose-bisphosphate aldolase"
                     /protein_id="GFF02108.1"
                     /transl_table=11
                     /translation="MNERLEDIALTLVGAGKGILAADESTATIGKRFESIGVECTEDN
                     RRAYREMLFTAKEAMESAISGVILFDETLRQKASTGQMLTDLIRDAGAVPGIKVDTGA
                     KPLAAFPQETITEGLDGLRERLKDYYTLGARFAKWRAVIAIDAQTLPTRGAISQNAQA
                     LARYAALCQEAGLVPIVEPEVLMDGPSRQHSITRCFEVTKVVLHTVFKELFEARVLFE
                     GMILKPNMVIDGKDARIASVEEVAEKTVHVLKQTVPAAVPGIAFLSGGQTDEEATAHL
                     SAMNALGALPWKLTFSYGRALQAAALKAWAGKNENIVVAQKAFCHRARMNHLAALGQW
                     TKDQEKSCA"
     CDS             complement(688950..690143)
                     /codon_start=1
                     /gene="pgk"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q8U9I9"
                     /locus_tag="BH623125_05430"
                     /product="phosphoglycerate kinase"
                     /protein_id="GFF02109.1"
                     /transl_table=11
                     /translation="MGFRTLDDVDVTGKRVLVRVDFNVPMAQGKVCDDTRLKRHKETL
                     LELQKRGAKLILLSHCGRPKGQVEPEFSLHPVVQVLEKIINQPVNFASDCIGVAVQTA
                     VEALQNGGILLLENVRFHSGEEKNAGSFAEALAHNGDLYVNDAFSVSHRAHASVEGIT
                     HFLPSYAGRSLQCELQALEKGLGKPERPVIAIVGGAKVSSKLFVLNHLVKKVDYLVIG
                     GGMANSFLAAQGVCVGKSLCEHALIETVKKVIEKARECQCTLLLPVDAIVGFRFEKDA
                     PHRLYDIGDIPEDGMILDVGTRSIAHINAVIDKAATLVWNGPLGVFEMSPFDQGTIAV
                     ARHAAELSLTGKLVSIAGGGDTVFALNHAGVADDFTYLSTAGGAFLEWMEGKMLPGIL
                     ALTQA"
     CDS             complement(690650..691657)
                     /codon_start=1
                     /gene="gapA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_011084339.1"
                     /locus_tag="BH623125_05440"
                     /product="type I glyceraldehyde-3-phosphate dehydrogenase"
                     /protein_id="GFF02110.1"
                     /transl_table=11
                     /translation="MSVRVAINGFGRIGRNILRAIIESGRQDIEVVALNDLGSVETNA
                     HLLRYDSVHGCFPGTVQVVGDAIDIGSSLIKVFAERDPAQLPWKALDIDIALECTGIF
                     TARDKASAHLDAGAKRVLVSAPSEGADLTVVYGVNHQFLSKEHHVISNASCTTNCLAP
                     VAQVLHNTVGIEKGFMTTIHSYTGDQPVLDTMHRDLYRARAAALSMIPTSTGAAKAVG
                     LVLPELKGLLDGVSIRVPTPNVSVVDLTFTAKRSTTIEEINTAIRTAAQGSLKGILDY
                     TDEKLVSCDFNHNPHSAIFHNDQTKVIDGQLCRVLVWYDNEWGFSNRMCDTAVAFAKT
                     I"
     CDS             complement(691987..693993)
                     /codon_start=1
                     /gene="tkt2"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q92M82"
                     /locus_tag="BH623125_05450"
                     /product="transketolase"
                     /protein_id="GFF02111.1"
                     /transl_table=11
                     /translation="MTNTETKKQMANAIRFLAIDAIEKANSGHPGLPMGAADIATVLY
                     TKFLAHDPKNPHWPNRDRFVLSAGHGSMLLYALLYLSGYEDISLEDLKNFRQIGSKVA
                     GHPEYGHAAGIETTTGPLGQGIANAVGMALGERLLNARFGDLINHYTYALVGDGCLME
                     GISQEALSLAGHLKLNKLIVLWDDNNISIDGEISLADSTDQIARFKASGWNTHKVDGH
                     DQAAIARAIEAARNSDKPTLIACKTTIGFGAPNKAGTNKIHGAPLGASEIAETRIALG
                     WEAEPFVIPADILDNWRLAGLNAAKKRQKWKEKFAALPLSERIEFERLMRGDLVGGFD
                     GAIDVYKKKLVEDCPCVATRKASEMALEVINEVVLETIGGSADLTGSNNTKSSQMKTI
                     SAEDFSGRYLHYGVREHAMGAVMNGLALYGGFIPYGGTFLCFSDYMRPAMRLSSLMGL
                     RVIYVMTHDSIGLGEDGPTHQPVEHLASLRTLPNHLVFRPADAMETVECWQLALKTRG
                     TPSTLALSRQNLPLLRREYEEENLCMLGAYELLTASDDAQVTLFASGSELQIAVHAHA
                     VLEEKGIPTRVVSVPCFELFTQQSPSYQRALIGDAPIKIAIEAALRQGWDYFIGTNGV
                     FIGMQGFGASGTIDALYAHFGITCENVVAAVEKKLEDIHKENVK"
     CDS             694211..694603
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_05460"
                     /product="hypothetical protein"
                     /protein_id="GFF02112.1"
                     /transl_table=11
                     /translation="MLKSLTYLKIDFSQEKKMSDSFLHKELINGYTHLEDVNIMNQET
                     TVLSQTLEQLEKALRTLEIAIINRNAVIDKNNEWEEEIQRMNADRSRLAQALDKAEAQ
                     VERLEAVNKEVSKRLIKAMETIRVVIDR"
     CDS             694616..694993
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8T7F4"
                     /locus_tag="BH623125_05470"
                     /product="cell division protein ZapA"
                     /protein_id="GFF02113.1"
                     /transl_table=11
                     /translation="METVSVTIDGKVYRMACDKGQERHLIELAARLDQYITHLKKNFG
                     EMGDHRLSVMAGIMILDEMEEIKRENKKLQEDYEALLRLHNEKNHTMGRIMRDTTKRI
                     EKLTSQLLKDEQNSLISQEQEDL"
     CDS             complement(695798..696151)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_05480"
                     /note="frameshifted, deletion at around 696294"
                     /note="possible pseudo due to internal stop codon"
                     /product="hypothetical protein"
                     /protein_id="GFF02114.1"
                     /transl_table=11
                     /translation="MTAIVAYTASGTTGVRTSRERPNRPIIALSPIVKTARRLALVWG
                     LHCVVTEDARDLEDMVDRAAAIAFQEGFCQGGDHFLVTAGVPLGTPGATNLLRIASVS
                     QDGTKVFECLYVLSF"
     CDS             complement(696453..697889)
                     /codon_start=1
                     /gene="pykA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q92M63"
                     /locus_tag="BH623125_05490"
                     /product="pyruvate kinase"
                     /protein_id="GFF02115.1"
                     /transl_table=11
                     /translation="MKRARKVKIIATLGPSSFSISMIEKLFMAGADVFRLNMSHTDRE
                     TMVDLVQRIRKVEKTVRRPIGILVDLQGPKLRVGCFDKGQEDLRIGQSFTLDDRDILG
                     DAQRVFFPHGEVLAAIKPGDRLLIDDGKLELLAQVCDGHSVQCLVVAGNRISDRKGVS
                     LPDTVLPFGPMTLKDKADLQAVLEQPVDWVALSFIQRPEDIIAVRALTKSKVSLMAKI
                     EKPQALEHIEEIIDVADGIMIARGDLGVEMPLERVPAIQMELIKACRLAGKPVVVATQ
                     MLESMITSSVPTRAEVSDVATAVYTGTDAVMLSAESASGRYPEEAVLMMDRIAQQIEQ
                     DQTYAAQVGAQHPAPESTGTDAISLAARQIAETLQLTAIVAYTASGTTGVRTSRERPN
                     RPIIALSPIVKTARRLALVWGLHCVVTEDARDLEDMVDRAAAIAFQEGFCQGGDRFLV
                     TAGVPLGTPGATNLLRIASVSQDGTKGV"
     CDS             complement(697886..698419)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013529203.1"
                     /locus_tag="BH623125_05500"
                     /product="hypothetical protein"
                     /protein_id="GFF02116.1"
                     /transl_table=11
                     /translation="MFCFRGLHHKGGFVVAEKQTGVFQRVREIFLLSVLLLLPFAGFA
                     KADFRVCNTTQQPVGVALGYRTFSGWVSEGWWVVPVTECKTLIEGPLSSRFYYFYAEG
                     AEKKNSWPGSVTMCVQDSQFTIQGVHDCFPRGYQKAEFKEIDTGNQTSWMVQLTDESL
                     FNNSVVQSPSLSGDSPP"
     CDS             698660..698917
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TM19"
                     /locus_tag="BH623125_05510"
                     /product="UPF0335 protein"
                     /protein_id="GFF02117.1"
                     /transl_table=11
                     /translation="MNTVTDETHAISVNQLRAFIERIERLEEEKKTISDDIKEVYAEL
                     KGSGFDSKAVRSIIRLRKKEEHERMEEEAIIQLYKDALGMS"
     CDS             699916..700146
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_05520"
                     /note="possible pseudo due to internal stop codon"
                     /product="hypothetical protein"
                     /protein_id="GFF02118.1"
                     /transl_table=11
                     /translation="MPAVDWRNIPAFYQIFRKTTNITHLALRLLILTGIRTNPLRHIR
                     EDQIDDDIWTIPAENLKGKRDIIEDFCVPLSS"
     CDS             701134..701349
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_05530"
                     /product="hypothetical protein"
                     /protein_id="GFF02119.1"
                     /transl_table=11
                     /translation="MIAITKKRTISTLIGLEDAGELSSYSLHNANPLCPWEPIKSDDQ
                     NTLLEQHESTLLLVKMHKEQHTDMPYD"
     CDS             complement(701964..703826)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_012067311.1"
                     /locus_tag="BH623125_05540"
                     /product="elongation factor 3"
                     /protein_id="GFF02120.1"
                     /transl_table=11
                     /translation="MVVPLLRLDRICLTFGKTPLFNQACLAVEQGARIALVGRNGCGK
                     STLLKIAAGIIEPNEGEIFRHPRATLRYLSQNPDCSGFEDVHAFVEAGLDHVPDAQWI
                     NTLLANLGFSGTEKLANLSGGERRRVSLLQAIAAKPDILLLDEPTNHLDLPTIEWLEG
                     TLFSLRSALVVISHDRRFLENVTRSTVWLDRGITKRLEKRFSEFENWRDKALEEEALE
                     QHKLRRQIAREEQWLRYGVTARRKRNVRRLGALKELRQLHQTYKGPSGSALLTVAKSH
                     DSGQLVLEAKRISKSYGERVIVKDFSLRVQRGDRIGLVGPNGIGKTTLLSVLIGQEAA
                     DSGTVKHGYNISMAFLDQQRILNEEETLAHYLTGGRGDTLVINGQERHVVSYMKDFLF
                     LPEQARTPLKEFSGGERARLMLARLLSRPANFLILDEPTNDLDMETLDLLQEFIADFA
                     GTVLLVSHDRDFLDRTVTHMLAPQGDGHWILYAGGYSDMIAQNKHAALLGCKEGAVSQ
                     GKALSNPRVLENKNSNASTNRASMEPEKIKPRKLSYKQVYALEKLPEQIAVLQDEIKK
                     IEQELFDPALYCNDKERFERLSIKLQEKQKLCAGKEEEWLELELLREDIEGVKS"
     CDS             complement(703826..704239)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_05550"
                     /product="hypothetical protein"
                     /protein_id="GFF02121.1"
                     /transl_table=11
                     /translation="MLKSILKVAVISTIGLSTVACTVNDQRIARYGVGGAAIGALAGT
                     AIAGSTPEAALTGAAVGAIAGSVTGAAVNQQRQQRQRQQRQIVAPHPAMCTYRNRKGQ
                     VYSAPCAQKVQTPQLCTYRDGRGVMYQAPCPQRVR"
     CDS             complement(704341..704976)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013529167.1"
                     /locus_tag="BH623125_05560"
                     /product="thiamine pyrophosphokinase"
                     /protein_id="GFF02122.1"
                     /transl_table=11
                     /translation="MTTFTILLNGDLFITDRLRNQIRNSRVIAADGGMRHAEALNVVP
                     ELWLGDFDSSQQALKSKYADIPREIFPPDKDMTDSALACERALQKGAEKLILCGAFGG
                     ERSDHSLSHMTQALVMEEKGISVLLTSGREEGWPLLPKPFSCDLPDDSLFSIIGFSDL
                     KELTISGAKWPLYNKNVLFGSSLTLSNRICGTFSCHLCSGKAIVLASVPIS"
     CDS             705248..706666
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013529171.1"
                     /locus_tag="BH623125_05570"
                     /product="metalloprotease"
                     /protein_id="GFF02123.1"
                     /transl_table=11
                     /translation="MLLLSACHTTSSPNETLSSWDSSARREQASKNNIYVTLSAKQHP
                     RILQIYGGAYYNPKLERLLENIVRKLTVGLQNSYKSYSLTILNTQSVNAFALPNGSIY
                     ITRGMLTLANDSSEVAAILAHEIAHITANHGILRLQKKAELKTTERISSNLLSLSGEK
                     IHKSIENKRKLAQFSRNQELQADSIALEMLKQAGYDPFSLPRFLQSMAAYSLFRSIPG
                     SQNAPLGFLITHPTTPQRIRLAIEKAHKISSANTGNTDRDAFLKSIDGMIFGGSPHTG
                     FVQNNQFIHPQLGITFSVPQNFIIENSAHTVWASGPDKIAIRFDAIPHPAEISASEYL
                     QSGWLAGLDKSSVHPFIIQGLPGAHARARNAQWQFDVVVILFNNHVLRFLTAAPHDSQ
                     NFAEIAEKTVQSFRFLSSSQLKKLKPLRIRIVRVQKGESVASLAKKMQNIPHNEKLFR
                     ILNSLSPSQALQTGAAVKIITQ"
     CDS             complement(706831..706995)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_05580"
                     /product="hypothetical protein"
                     /protein_id="GFF02124.1"
                     /transl_table=11
                     /translation="MKFFQAVVREWYGIGYKKLDLESSRICVKKPHPTREKEEGKSES
                     KVQKMMKSVN"
     CDS             complement(706999..707910)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013529172.1"
                     /locus_tag="BH623125_05590"
                     /product="RNA polymerase factor sigma-32"
                     /protein_id="GFF02125.1"
                     /transl_table=11
                     /translation="MGNLSNAVYKNSKNYSDADKSLGRNMMRSAMQAPYLERQKEHDL
                     ALRWKDKRDDEAMHQIAAAHMRLVIAIANRFKRFKMPLGDLVQEGYVGLLEAAARFEP
                     DREVRFSTYATWWIRASIQDYILRNWSIVRGGTSSSQKALFFNLRRLRAKLVQDDSAL
                     SKQDIFRSIAEKLGVSVRDVETMDFRFSSSDNSLSVSVSENSDNPVAKMDALVDDSPL
                     PDALIEQVIDGQRRTQWLYDALQILNERELEIIRFRRLNEEGATLEVLGEKLGISKER
                     VRQIEARALQKLRSALLTVNPADAYDV"
     CDS             708493..710055
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_05600"
                     /product="hypothetical protein"
                     /protein_id="GFF02126.1"
                     /transl_table=11
                     /translation="MNSEIVQENDILQDDILIEKHGRGKFEGFRFYANKNTTDNQATT
                     TQIVAENENLTLAFSKRAARFCASGNGDFTLSSNGIVRWIGQPVGQLAATDDFLKPKP
                     IILADTQLTGEARDNVVKRLERFVTFHFETALKPLFDLRGAEGLTDSTSNLASQLVNS
                     LGVIPRREIATVVKNLDQESRAILRRLGVRFGAFHIYVAGMFKPAPVQAITLLWNLQN
                     EGCDQTGLDEIFAALSAGRTSLVVDPRYNRQFYQLAGYRILGQRAVRIDILERLANLI
                     RPALYWKQGNEPKPDGAYDGKSFFVTPTMMSILGANGTDMEEILKGLGYQSHAISSAF
                     FEQNYLQNKTSAHTCTTVQDVPAAECVGEQWQIMDISPKQEEKEALPTCITQSDTGDC
                     LPAAEPVGNFATKQKRVLEEEKVVLLWRYNHHHPHKNNERSGHRGQNKKSKPFKKEVN
                     AQENNSREATSHTRHSHKSNKQHSKRSNHQSSQREKRPNPDSPFAKLAALRDQLIREK
                     DKDAHTLSSKSH"
     CDS             710076..710414
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_003535779.1"
                     /locus_tag="BH623125_05610"
                     /product="ferredoxin"
                     /protein_id="GFF02127.1"
                     /transl_table=11
                     /translation="MAYVVTDNCIHCKYTDCVEVCPVDCFYEGENMLVIHPDECIDCG
                     VCEPECPAEAIKPDTEPGLEKWLELNLQYANKWPNLTTRKDPLPQAKEMDGIPDKLEK
                     YFSENPGSGE"
     CDS             710723..711307
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013529179.1"
                     /locus_tag="BH623125_05620"
                     /product="CarD family transcriptional regulator"
                     /protein_id="GFF02128.1"
                     /transl_table=11
                     /translation="MASQHGTSSNAKGFSTSEYIVYPTHGVGQIIAIEDQEVAGHKLK
                     LFVIHFAKDKMDVKVPIAKAISVGMRKLSAVDSVERALKILHGKARVKRTMWSRRAQE
                     YDAKINSGDLICIAEVVRDLFRSDLQPEQSYSERQLYIAALERMAREIAVINSLSETE
                     AINLIEMHLSQKPKRQFKTKRDEVNANSEAVYAA"
     CDS             complement(711849..712028)
                     /codon_start=1
                     /gene="rpmF"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A6UE65"
                     /locus_tag="BH623125_05630"
                     /product="50S ribosomal protein L32"
                     /protein_id="GFF02129.1"
                     /transl_table=11
                     /translation="MAVPKRKTSPSKRGMRRSADALKAPTYIEDKNSGELRRPHHIDL
                     KTGMYRGRSVLPAKD"
     CDS             712353..713153
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_013529224.1"
                     /locus_tag="BH623125_05640"
                     /note="possible pseudo due to internal stop codon"
                     /product="(2E,6E)-farnesyl diphosphate synthase"
                     /protein_id="GFF02130.1"
                     /transl_table=11
                     /translation="MHEFITLLAKHAHSVEKRLATLLSDQVQNGEIARPEILLKAMRY
                     GVLNGGKRLRPFLVIQSCALFDIPIEYSLNVASALECIHCYSLIHDDLPAMDNDTLRR
                     GQPTVHIAFDEATAILAGNALLTFAFEIIAHKTSELSFETRIRLITALAQASGLGGMI
                     GGQMLDLEAEKKPQESKDITTLQHMKTATLISFACQAGAIIGNASQELTEKLAAFGTY
                     LGLAFQLTDDLLDVTASTKVLGKTAGKDETAHKATFIRLYGIEETQKK"
     CDS             713465..713644
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_05650"
                     /note="possible pseudo due to internal stop codon"
                     /product="hypothetical protein"
                     /protein_id="GFF02131.1"
                     /transl_table=11
                     /translation="MPEKLAAFGPYLGLAFQLTDDLLDVTASTKVLGKTAGKDETAHK
                     ATFIRLYGIEETQKK"
     CDS             complement(715141..715401)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_05660"
                     /product="hypothetical protein"
                     /protein_id="GFF02132.1"
                     /transl_table=11
                     /translation="MAELFNALSLTLIAGAYNALLVQYAKTKITSPKKVLGSSSQYNY
                     IGMFVFSLIGAYFADYSSQYIWYISAFLMLMTTIFSLFFWMI"
     CDS             complement(715467..715673)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_05670"
                     /product="hypothetical protein"
                     /protein_id="GFF02133.1"
                     /transl_table=11
                     /translation="MTSILTFGFLFNGIRILTEAFLVFYMLEKGLTLIDIGIIKSFQA
                     FVMMVTNIPLGYFADRKSYKYLSF"
     CDS             complement(715766..716137)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_05680"
                     /product="hypothetical protein"
                     /protein_id="GFF02134.1"
                     /transl_table=11
                     /translation="MSEAAVNVRVPLLYVGSATVNALVRPLIIPGKTRCYACVNQNHM
                     KGVSEFEFVKNIKQNSMNTLIDPYNAVAGSLAALEAVKYLTDFDKCQIIEKTLFIDFS
                     RYKIDRTEDPYSGYCYICKKV"
     CDS             complement(716307..716465)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_05690"
                     /product="hypothetical protein"
                     /protein_id="GFF02135.1"
                     /transl_table=11
                     /translation="MKDAKITIVGLGGCGSYVFYTLSAMGIGHIKSYDFDIVEESNLS
                     KQILYKVT"
     CDS             complement(716477..716713)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_05700"
                     /product="hypothetical protein"
                     /protein_id="GFF02136.1"
                     /transl_table=11
                     /translation="MTQKNTIGDIILKCNLDTTKSEDFLYLTKYMLDNRIIKPPFSKE
                     DSIRKAGLNESGYNRFDRKINLFKLYQVILTMPF"
     CDS             complement(716688..716867)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_05710"
                     /product="hypothetical protein"
                     /protein_id="GFF02137.1"
                     /transl_table=11
                     /translation="MNSLYNNKYVYSYTMSVRQEGDEVLLGADIHNVVALDMSDTSPN
                     VIKALACFDAEEYYR"
     CDS             complement(717061..717243)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_05720"
                     /product="hypothetical protein"
                     /protein_id="GFF02138.1"
                     /transl_table=11
                     /translation="MKMSPCLLMKGIQLLIPKVMGGIGAMDLFKSFMLEQNLKLIIAT
                     TSTELAHIQGDAGLFS"
     CDS             complement(718345..719586)
                     /codon_start=1
                     /gene="ispG"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:C3MAL6"
                     /locus_tag="BH623125_05730"
                     /product="4-hydroxy-3-methylbut-2-en-1-yl diphosphate
                     synthase (flavodoxin)"
                     /protein_id="GFF02139.1"
                     /transl_table=11
                     /translation="MNTVYSLSKPLERRQSVAVTVGDVLVGGRSPIVVQSMTNTDTAD
                     VDATVAQVAALWQAGSQLVRITVDRYEAAAAVPKIRERLERLGFVIPLVGDFHYIGHK
                     LLSEHPACAEALAKYRINPGNVGFGAKKDRQFAEIIEIACRYRKPIRIGVNWGSLDHV
                     LLTRLMDENAQQENPLSGGEIMREAVVQSALHSALWAEEMGLKRDQIILSAKVSDVQD
                     LIAVYSTLAERCDYALHLGLTEAGMGTKGIVASSVALGILLQKGIGDTIRISLTPEPG
                     GDRTREVKVAQELLQVMGFRQFFPVVTACPGCGRTTSTVFQQLAQKIETDLHKNMSVW
                     REKYPGVESLKVAVMGCIVNGPGESKHADIGISLPGTGESPAAPVFIEGQKVKTLRGT
                     HIAEEFELLLSDYIHTRFGQG"
     CDS             719847..720131
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_05740"
                     /product="hypothetical protein"
                     /protein_id="GFF02140.1"
                     /transl_table=11
                     /translation="MCLFSTHTKNAKIKKRIAQLKNELVPMSRLSSHSNSFENISDIF
                     DTWKQKGQHALYHFNEHVTELKKKVKENPKTTLALAAGLALAGFLLVRKN"
     CDS             complement(720571..721575)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010971388.1"
                     /locus_tag="BH623125_05750"
                     /product="hemolysin secretion protein D"
                     /protein_id="GFF02141.1"
                     /transl_table=11
                     /translation="MIKALRSRATIIAFFSGITGCLLILWAWKLPPFVSAIQITDNAS
                     VKGNMTLVSSQISGVIARIYVQDYQRVEQGMLLFELDDSLFRQQLARAQAVLDSKNAK
                     LASVVLQAQLLQGEINTAEAELTRSRAFSNVIPENKKLGFGDGASSVSRPLSQLLAAL
                     ETKRQLQKQLDLERQSLQSEVAGAKVGVELAKLNLKHTKILSPKTGHVGLVGARVGQY
                     VLPGTQLVSLISDDIWIIANYKETQLSQMRVGQPVVFSVDALNNQKLTGRVVRFAPAT
                     GSEFSLLKTDTAIGNFIKIAQRISVRISLDPGQEGVEKLIPGMSVVTYVDTSQRGSGE
                     "
     CDS             complement(721572..723236)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:RefSeq:WP_010969063.1"
                     /locus_tag="BH623125_05760"
                     /product="MFS transporter"
                     /protein_id="GFF02142.1"
                     /transl_table=11
                     /translation="MSGRRSAVVSAKKRGGKPFPHPGVVFAGPLPKCFVYIFASFILQ
                     WAYGLGANIVQSNIIYLTGDFHATLTETTWLVAAYMAPNVSVAIMLIKIRYQFGLRAF
                     AELSILSFVLVCILQLFVTDLRSALIIRFFAGVAAAPLASLALLYMMEAFAPAKKFTV
                     ALSLNYMNAALAAPLSRLISPDLLENGGFLSLSALEMGLVLISLGCIYTLPLTPVVRS
                     RVIQKLDWVSYSLIAFGLGLNAVIMSVGTLYWWYEAPWIGWGLALAFLSLVVATIIEL
                     NREKPLIDLRWIFSKEIVQSVLILLVFHVFLLERSTLAASFFNLFGLLNREMMPMYLA
                     VTFGTLLGGAVCVFFLRVGREDYFYLLSLGCLALGAYLDSHVNHLTRPQDMMLSQGLV
                     SFSYALFLPPALSRGFVIAGERGPRYVLSFITVFLLTQVTGGLMGSAFFGSLQLFFAY
                     KNFESLTQNIVGTDRLISGEVNTLFSSSFWGTASYDLGHEQGVSRLIEKFKLTANIFA
                     YDDVFRLYFYISTVVFAIFLAKIFLKACFLNAFKKQSNLIQEECKK"
     CDS             complement(723260..723676)
                     /codon_start=1
                     /gene="atpC"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:E8TL34"
                     /locus_tag="BH623125_05770"
                     /product="ATP synthase epsilon chain"
                     /protein_id="GFF02143.1"
                     /transl_table=11
                     /translation="MENNRVNHFLFELVSPEKPVFSEQVVSVVLPSASGALTVMANHA
                     PLVASIVLGSMYVLTSSGEKLFAVCGGVANITSSGCSVLVERVVVVQHLSFHDLEQRI
                     LRVRATLEGDSNDGISHKIEDFFHQLKVGDAGLTEA"
     CDS             complement(723750..725345)
                     /codon_start=1
                     /gene="atpD"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:C3M9S1"
                     /locus_tag="BH623125_05780"
                     /product="ATP synthase subunit beta"
                     /protein_id="GFF02144.1"
                     /transl_table=11
                     /translation="MVKAVTSSKETAKVEKKKSAPRSGVKKAVSKSQAGVKDSSSPVH
                     KSSKKAPLAEAAVGVIKQVIGAVVDVQFEGPLPNILNALETDNLGNRLVLEVAQHLGE
                     NTVRTIAMDTTDGLVRGQKVFDTGTQISVPVGEATLGRIMNVIGEPVDNVGPIATSKT
                     RSIHQEAPEYVEQSTASEILVTGIKVVDLLAPYSKGGKVGLFGGAGVGKTVLIMELIN
                     NIAKAHGGYSVFAGVGERTREGNDLYYEMIESRVNVNPKDNNGSTEGSKCALVYGQMN
                     EPPGARARVALSGLTIAESFRDEGQDVLFFVDNIFRFTQAGAEVSALLGRIPSAVGYQ
                     PTLATDMGALQERITSTRTGSITSVQAIYVPADDLTDPAPATSFAHLDATTVLSRSIA
                     EKGIYPAVDPLDSFSRMLDPLIVGEEHYTVACQVQTILQRYRSLQDIIAILGMDELSE
                     DDKLLVGRARKIERFLSQPFHVAEAFTGSPGKLVPLEETIKGFKGLCAGEYDNLPEAA
                     FYMVGSIDEAVEKGKRLIAEVSS"
     CDS             complement(725365..726276)
                     /codon_start=1
                     /gene="atpG"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A6UDM2"
                     /locus_tag="BH623125_05790"
                     /product="ATP synthase gamma chain"
                     /protein_id="GFF02145.1"
                     /transl_table=11
                     /translation="MASLKDLRDRIASVKATQKITKAMQMVAAARLHRAQEAAHSARP
                     YAKRMAAILANLANDVDPIDAPSLMRGTGRDDVHLLVVCTAERGLCGAFNVQIARRAR
                     EHIKTLLAAGKIVKVLTVGKKGADILSRDYKALMIDHIDLQSIKRVGFAEAAMISQKI
                     VDLFDDDAFDVCTLFYSEFVSVINQRPVAFGLVPMVSSGGAVETAEVEQKIDNSADLQ
                     SIVYDYEPDAASLLDVLVPRNLSVQIFRALLENVAGEMGAKMTAMDNASRNAGEMINK
                     LTVAYNRQRQAQITTELIEIIAGAEAL"
     CDS             complement(726297..727832)
                     /codon_start=1
                     /gene="atpA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:C3M9S3"
                     /locus_tag="BH623125_05800"
                     /product="ATP synthase subunit alpha"
                     /protein_id="GFF02146.1"
                     /transl_table=11
                     /translation="MDIRPSEISKILKEQIKNFDQKAEVSEIGWVLSVGDGIARVYGL
                     DNVQAGEMVSFSNGVRGMALNLEIDNVGVVIFGSDRDIREGDCVKRLGAIVEVPVGPA
                     LLGRVVDALGNPIDGKGPLKATEYRRVDVKAPGIIPRQSVHEPMSTGLKAIDALIPIG
                     RGQRELVIGDRQTGKTAILLDAFLNQKPFHEKDAGNEKDKVYCIYVAIGQKRSTVAQF
                     VKVLEERGALEYSIIVAATASDPAPMQFIAPLAGCAMGEYFRDNGQHALIGYDDLSKQ
                     AVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNAENGSGSLTALPVIETQAN
                     DVSAYIPTNVISITDGQIFLETNLFYQGIRPAVNVGLSVSRVGSAAQIKAMKQVAGSI
                     KGELAQYREMAAFAQFGSDLDASTQRLLNRGARLTELLKQPQFSPLKTEEQVVVIFAG
                     VNGYLDALAVADVGRFEQGLLTLLRSDHSDLLQAIADQKQLTDDIKDKLIVVLNTYAK
                     NFS"
     CDS             complement(727822..728415)
                     /codon_start=1
                     /gene="atpH"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:Q7CWL8"
                     /locus_tag="BH623125_05810"
                     /product="ATP synthase subunit delta"
                     /protein_id="GFF02147.1"
                     /transl_table=11
                     /translation="MSNSFSLIPLPLVDQRYAQALFDLAQEEGLVEILEKAVESFLMV
                     LDQDEDLKHFVQSPFFSVKEQVKVMHSVCENIPFADEGAGQILSRFLRVITLNHRLRA
                     LSGILHAFQRRVALSRREFSAQIIAARPLNSQQEQQLQSVLESVVGGKVFLNICVDPE
                     ILGGLIIRLGSSQIDTSLMAKLSSLKIALKKRSADGY"
     CDS             728753..729301
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_05820"
                     /product="hypothetical protein"
                     /protein_id="GFF02148.1"
                     /transl_table=11
                     /translation="MVKYFCSKRATATATATATATATATATATATATATATATATATA
                     TATATATATATATATATATATATATATATATATATATATATATATATATATATATATA
                     TATATATATATATATATATATATATATATATATATATATATATATATATATATATATA
                     TATATATATEKMCYFKFISKRL"
     CDS             complement(729271..729531)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_05830"
                     /product="hypothetical protein"
                     /protein_id="GFF02149.1"
                     /transl_table=11
                     /translation="MIVFSEKRQAADYARVLRQVAPGEKNISLMGLVEAPRAFVRGRY
                     RFWYRSSALLICKGLFCAWFVSAPKMLFYGDIRYNLLLINLK"
     CDS             complement(729638..731848)
                     /codon_start=1
                     /gene="priA"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A6UDM6"
                     /locus_tag="BH623125_05840"
                     /product="primosomal protein N'"
                     /protein_id="GFF02150.1"
                     /transl_table=11
                     /translation="MTEGEREKKIVSVLVPLPVAHAYSYEVPSSMECEVGSFVRVPVM
                     GRQVCGFVVGIGEQTAKDRQSSAPVAHDKLRVLLHVFDCPPLKTEMIAFLRFVSRYTM
                     APFGLVARLVLSVPAALEPEAQMPGLRYCGGEVGRLTPARLRVLELARDGEVWTRSGL
                     AHAAGTSVSVVEGLKSLGVFEEVMMPPSALVALPDPDFDPPVLEGEQSEAARLLREGV
                     VSAQFQVFLLDGVTGSGKTEVYFEAVAQALIEGKQVLILLPEIALTQQFLDRFHARFG
                     VAAAEWHSDLAPRRRERIWRQVAEGRVRVVAGARSALFLPFHELGLIVVDEEHDGAYK
                     QEERIFYHARDMAVARGSFEHFPVILSSATPSIESQANVLRGRYQKVHLPSRFKEAAL
                     PRLRVVDMRQGGVQKGRFISFALEEALKQTLEKGEQALLFLNRRGYAPLTLCRVCGHR
                     FHCSDCSSWLVEHRAQGQLKCHHCGYHQSLPEACPECGTLDHLVACGPGVERIAEETR
                     TLFPQARQLILSTDLKGGIGQLRRELEAIAKGDVDILIGTQLVAKGHHFPGLSLVGVI
                     DADLGLANGDLRAGERTFQLLSQVTGRAGRMGLESLGLLQTYQPDHPVIKALLSQKSE
                     DFYTYEIAMREHYHLPPYGRLASLIVSSEKRQAAEHYARVLRQVAPGEKNISLMGPAE
                     APLALIRGRYRFRLLLQGQRSFDIQGFIRAMLANAPKIPSSVRVQIDIDPQSFL"
     CDS             732634..733290
                     /codon_start=1
                     /gene="tal"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:A6UDM7"
                     /locus_tag="BH623125_05850"
                     /product="putative transaldolase"
                     /protein_id="GFF02151.1"
                     /transl_table=11
                     /translation="MKFFVDSANIEEIQELQNLNLVDGVTTNPSLILKSGRNILEVTK
                     EICTLVVHGPVSAEVAATEFEDIMKEAAVLANIADNICIKLPLTFDGLKACKALTAQG
                     LKTNLTLCFSANQALLAAKAGATFISPFVGRLDDYGINGSDLLHEIRTIYNNYSFETQ
                     ILAASIRTINHVKEAALSGADVATIPPTILKALIKHPLTEKGLQSFLEDWKKTGQNIA
                     "
     CDS             complement(733330..733479)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_05860"
                     /product="hypothetical protein"
                     /protein_id="GFF02152.1"
                     /transl_table=11
                     /translation="MAGGMVATSASLNANSIGTVRVFFERMRQEYTILQAEKDAHKRV
                     TEKPN"
     CDS             complement(733566..734141)
                     /codon_start=1
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /locus_tag="BH623125_05870"
                     /product="hypothetical protein"
                     /protein_id="GFF02153.1"
                     /transl_table=11
                     /translation="MSFFKSCILAGLAVLFTLLYGCKVEPLYRQVSQISTIESVPGEF
                     SGKNSLGLSEKLASIVIEEPSDRFGQMVRNHLLFLLYGNGSKPSTPVYQLALQISVLT
                     RESVQIEIDFDKKRRGRPSVGTVVSKAFYTLRDMKNVPVSNGMATMSTSFERMRQEYA
                     TLQAEKDAHKRVAEELAEQIFLLLSGDLAKD"
     CDS             complement(734128..736770)
                     /codon_start=1
                     /gene="leuS"
                     /inference="COORDINATES:ab initio
                     prediction:MetaGeneAnnotator"
                     /inference="similar to AA sequence:UniProtKB:C3MB60"
                     /locus_tag="BH623125_05880"
                     /product="leucine--tRNA ligase"
                     /protein_id="GFF02154.1"
                     /transl_table=11
                     /translation="MTIEHYNLGERYNPRACERKWQAIWDEKKTFQTVQEDRREKYYV
                     LEMFPYPSGRIHMGHVRNYAMGDVVARYKRAKGFNVLHPMGWDAFGMPAENAAMQNKV
                     HPKTWTYQNIAVMRGQLKQLGLSVDWSREFATCDVDYYHRQQMLFLDFYQKGLVARKV
                     AKVNWDPVDQTVLANEQVVDGRGWRSGALVEQRELTQWFFKISDFSEDLLAGLEELEQ
                     WPEKVRIMQKNWIGKSQGLLIRWALKSTEEADEVCKSFDEVVCYSTRPDTLFGASFLA
                     LSVDHPLAQALAQKDKALEFFIENCRSGGTTTAELETAEKQGFRTSLVAVHPFDVAVH
                     IP