LOCUS       BDGG01000001         9333084 bp    DNA     linear   INV 20-OCT-2016
DEFINITION  Ramazzottius varieornatus DNA, contig: Scaffold001, strain:
            YOKOZUNA-1.
ACCESSION   BDGG01000001 BDGG01000000
VERSION     BDGG01000001.1
DBLINK      BioProject:PRJDB4588
            Sequence Read Archive:DRR013908, DRR013909, DRR013910
            BioSample:SAMD00054187
KEYWORDS    WGS; HIGH_QUALITY_DRAFT.
SOURCE      Ramazzottius varieornatus
  ORGANISM  Ramazzottius varieornatus
            Eukaryota; Metazoa; Ecdysozoa; Tardigrada; Eutardigrada;
            Parachela; Hypsibiidae; Ramazzottius.
REFERENCE   1  (bases 1 to 9333084)
  AUTHORS   Kunieda,T., Toyoda,A. and Katayama,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-JUL-2016) to the DDBJ/EMBL/GenBank databases.
            Contact:Takekazu Kunieda
            The University of Tokyo, Department of Biological Sciences,
            Graduate School of Science; 7-3-1 Hongo, Bunkyo-ku, Tokyo
            113-0033, Japan
            URL    :http://www.biol.s.u-tokyo.ac.jp/users/saibou/kuma/
REFERENCE   2
  AUTHORS   Hashimoto,T., Horikawa,D.D., Saito,Y., Kuwahara,H.,
            Kozuka-Hata,H., Shin-I,T., Minakuchi,Y., Ohishi,K., Motoyama,A.,
            Aizu,T., Enomoto,A., Kondo,K., Tanaka,S., Hara,Y., Koshikawa,S.,
            Sagara,H., Miura,T., Yokobori,S., Miyagawa,K., Suzuki,Y., Kubo,T.,
            Oyama,M., Kohara,Y., Fujiyama,A., Arakawa,K., Katayama,T.,
            Toyoda,A. and Kunieda,T.
  TITLE     Extremotolerant tardigrade genome and improved radiotolerance of
            human cultured cells by tardigrade-unique protein
  JOURNAL   Nat Commun 7, 12808 (2016)
  REMARK    Publication Status: Online-Only
            DOI:10.1038/ncomms12808
COMMENT     Project website
            URL: http://kumamushi.org/
            
            ##Genome-Assembly-Data-START##
            Assembly Method       :: PCAP.REP assembler v. 06/07/05;
                                     SOAPdenovo v. 1.3
            Assembly Name         :: Rvar_4.0
            Genome Coverage       :: 177.5x
            Sequencing Technology :: Sanger: ABI 3730xl DNA Analyzer;
                                     Illumina: Genome Analyzer IIx sequencer
                                     (Illumina)
            ##Genome-Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..9333084
                     /db_xref="taxon:947166"
                     /mol_type="genomic DNA"
                     /note="contig: Scaffold001"
                     /organism="Ramazzottius varieornatus"
                     /strain="YOKOZUNA-1"
     CDS             join(65..242,441..704,934..1359,1853..2382)
                     /codon_start=1
                     /gene="RvY_00001-1"
                     /gene_synonym="RvY_00001.1"
                     /locus_tag="RvY_00001"
                     /product="hypothetical protein"
                     /protein_id="GAU87103.1"
                     /transl_table=1
                     /translation="MGHCDGRYLALYNLNGWSERDMIDRWALMVTLLVPPAFLLPARD
                     IDNLLTAGHETSPQTGGSDVMSEYVTPFCYVCDSLVDADCRESQDWMPRRRNGLRKKV
                     MWTGQGEDDHGRLAFDWKEVYIRLEKFKQRCPSNNGCTTHVFLNSDRVIRRCFDPKEP
                     PCSGHEWMVNRRNPKKRSKVKVVSRLTCADWPFCNVDSAYYWPNGTVEALLSPHDDPQ
                     LKVRSAKLSCYECDSILQPDCTGQNFVKAVRKPNDAVAHSVDWVGLRKGMEKFRTRCP
                     VESGCFFQGDHMTNRVIRGCRNMTTDLPRHLLVKDRRKESSVFRTEEVCRESECNSRV
                     LFFSHSGAFLDSDWHFNNSSAGRDNGQGEAKKEVYQGDAPATEETGFLPHVKQSGQGK
                     RKEGRLQKRTIGDVEREERRADEARQRRGKPKAEGRGGAGTRVLSFGHRSRKTSAGGK
                     LDSCWLLLLLPFFLL"
     CDS             4113..4340
                     /codon_start=1
                     /gene="RvY_00002-1"
                     /gene_synonym="RvY_00002.1"
                     /locus_tag="RvY_00002"
                     /product="hypothetical protein"
                     /protein_id="GAU87104.1"
                     /transl_table=1
                     /translation="MTDDLLEHVVHEHDPDGSHLGLGDSSSISTTLTNEHSTVRACST
                     EQAISCDMPFSKLTPPLCVEFREIAASATAS"
     CDS             complement(5019..5231)
                     /codon_start=1
                     /gene="RvY_00003-1"
                     /gene_synonym="RvY_00003.1"
                     /locus_tag="RvY_00003"
                     /product="hypothetical protein"
                     /protein_id="GAU87105.1"
                     /transl_table=1
                     /translation="MLDKAKLVLLNKGGRPSIRSAEDGWKVFCKVASTMSCRKRPRSA
                     KANVVVLLSSGADNVFSSVDDTSSKL"
     CDS             join(5486..5652,5729..5805,5876..6095,6172..6418,
                     6943..7239)
                     /codon_start=1
                     /gene="RvY_00004-1"
                     /gene_synonym="RvY_00004.1"
                     /locus_tag="RvY_00004"
                     /product="hypothetical protein"
                     /protein_id="GAU87106.1"
                     /transl_table=1
                     /translation="MFSKNADSYKLDDNRLSGQTIYRTNPTQQEVKWERMKDTLKARR
                     SRILDPVISKLPKEDLDEDVCRLQELQAQERQESIREGQKLRLLDNKHKFLENVVRAE
                     KINEAKRVVAFRQEFQLPQQRRDYDLYDPHRWKSEPLVTYQNPEVQGPAAMMNFEGYK
                     LMDTEGNLEADRRKYQREMLDLQTREDAVRQQRLSKIDELQQEIAATIANKAEDDQRR
                     GELLKKAQAVDNAHQNEAMFQNRALQRQASKLDEARAAQDDIYYWTSGKLLDPQPNKV
                     DIARGTDWRGLSRAEQLANFTGPKSVCQQVYQKRQKEAEEAERERRMVQQSKVQERLV
                     K"
     CDS             complement(join(8172..8204,8309..8400,8481..8631,
                     8821..9119,9553..9832))
                     /codon_start=1
                     /gene="RvY_00005"
                     /gene_synonym="RvY_00005.1"
                     /locus_tag="RvY_00005-1"
                     /note="COG4642"
                     /product="hypothetical protein"
                     /protein_id="GAU87107.1"
                     /transl_table=1
                     /translation="MLCCIQMRSLGIRQRQLSFQEYEGERNELKERHGFGETILPNGD
                     RYRGYYEHSLRNGHGVYLFKSGARYEGSWKDGVKEGHGKFLYPDGSSYEGNFWKDQKH
                     AYGVYKGENGDLYAGEWRQGQRHSYGVYKHKDSGAKYCGFWENDRRHGKGEILCGSYK
                     YMGMFANDQPVAGGKFVFLGGYEQHGHFTSVMMDAAQAALTVDTPVEEDTGEEAEEGA
                     QVAVLRWVPERLIFPDVVEPSVDTETLTKKRQKELEEEKALVEAVKRENLPEAFIVPD
                     IFDSFCAM"
     CDS             complement(join(8823..9119,9553..9735))
                     /codon_start=1
                     /gene="RvY_00005"
                     /gene_synonym="RvY_00005.2"
                     /locus_tag="RvY_00005-2"
                     /product="hypothetical protein"
                     /protein_id="GAU87108.1"
                     /transl_table=1
                     /translation="MASVKPSYPTATVIVVTTSIVFAMATASTSSSLEHAMKAAGRMV
                     SRRVMANFSIPMDRLTKGIFGRIRSMHTECTKARMGTCMQENGVKASATVMASTSTKT
                     AAQSIAAFGRTIDDTERERSCVVATSIWACSPTTNRWPVASLSSWADTSNMGTLHLS"
     CDS             join(9972..10182,10492..10613,10863..11107,11161..11328,
                     11587..11797,11861..11938,11998..12322,12617..12798,
                     13366..13567,14189..14382)
                     /codon_start=1
                     /gene="RvY_00006-1"
                     /gene_synonym="RvY_00006.1"
                     /locus_tag="RvY_00006"
                     /note="putative LMBR1 domain-containing protein 2-B;
                     LMBR1"
                     /product="LMBR1-1"
                     /protein_id="GAU87109.1"
                     /transl_table=1
                     /translation="MDVERLLCGLATGLARCAPLTCGSYATSLQPGWIVPNAIPRQHH
                     RDSTPNGNSQLVLGRGLQKIPRVKNAVSLLYEYASWKTQHVCVSIAVLLAWYISFLFI
                     FIIPIDVSTTIYQHCLKDQNVPRETDDVETHGNISITGFDPQTENGLSSENISHQRAG
                     RVEECDRPWSFVEAGIMLHLWLVVYWSSQLLSWVILPLMQAYAMSGEFTVRRRIGVAL
                     KKNLISVGTYLVIFGVLLIYVAVKPNTSLDWDKLYTLEIMASNTWGLFLVVLLLGYGL
                     VEVPRSLWVTADVEHQLNYTKFKLAKVYTEKMDTEETAGTMFEEIKRTSEQISDDNKR
                     LRKFMDVIVSKCPKEIRQKLDSSTPVKGMVRSKKELWKLSANASVSTLPSEASLVALH
                     NRLIASLHKQFKMTSMWRTLLENGFGHEDCLRNQRNKDKVFTPAYPPARNSRLGRFIN
                     PQMEWIWKCRMKSYVMRTLAVVFWLCTAAVIWSECTFFIGEPVLSVFALMIKKSALNN
                     YYFNVEIMGHMRVLDVISKGFNVYFPVLVVLFCLATAFRLGTRCLNFCGFQQFMGDGE
                     MTLSLVAQGQRILQKVHDERRLSQQLNTAKDQQEELLELVNNMSNFGRVATDSASVRA
                     GTSSGWRSMKHPGPSLDTVLA"
     CDS             14501..14716
                     /codon_start=1
                     /gene="RvY_00007-1"
                     /gene_synonym="RvY_00007.1"
                     /locus_tag="RvY_00007"
                     /product="hypothetical protein"
                     /protein_id="GAU87110.1"
                     /transl_table=1
                     /translation="MEDISQKCHLKEKELTAIDNVIVMLQDALVKLKDENAQSDVKIE
                     SLLNDLRALECEEEELDNLVNIGQCHK"
     CDS             complement(join(14958..15157,15523..15885,16158..16242,
                     16332..16465,16561..16809,17101..17324,17402..17685))
                     /codon_start=1
                     /gene="RvY_00008-1"
                     /gene_synonym="RvY_00008.1"
                     /locus_tag="RvY_00008"
                     /note="putative filamin-B; SAC6"
                     /product="hypothetical protein"
                     /protein_id="GAU87111.1"
                     /transl_table=1
                     /translation="MNPALLDLLLLSPTFSPTFLFERGAMQYSSQSSGAKEEGSAVLA
                     ELDRPRERRVPGEDSGDRWGISGEEQVSHMEKDLRDDAPWKRIQQATFTRWVNQQMKT
                     PDKIGYAVHDLSKDLSDGLRLICLIECLSGKKLPRHTTSPVFRSQKLENVSVALNFLE
                     NEGIKLVSIDSTDIVDGRLKLILGLIWALILHYSISNARWSDEEEQLVEEKVTPKQRL
                     LSWFANKLPVPVRNFTSDWNDGRACGALDNAMAPGLCPDWETWDSRDALRNATEAMSL
                     AEKWLGVTQLIRPEDMIDPDIDEQSMMTYLSQFPVAKLKEGAPLWKNSAGNEESFSEN
                     ARSSGSSVTSSTTTSPTSKATGSSQVTETQEVSEDGTTIITRRETRVSKVVSMSSVIE
                     SGDMLLQRGSHSQDVRSAISASRSDASKVTVEGNGLHRAHVNKAASINVVADSAGYNM
                     LLVGIYGKFLHSHEVQTKHMGHANYQVTYVLKQEGEYLLSIKYGDVHIPGSPFVINCI
                     SQSN"
     CDS             complement(18207..19322)
                     /codon_start=1
                     /gene="RvY_00009-1"
                     /gene_synonym="RvY_00009.1"
                     /locus_tag="RvY_00009"
                     /product="hypothetical protein"
                     /protein_id="GAU87112.1"
                     /transl_table=1
                     /translation="MDASLQLEGGDLDEDKLFCAVPGGDPSSSLPNLQFDVYSLRADE
                     ADIYRKVTAVLSDMAGITVPEYMLELLQTMHEEFDLVEDKARRLLFEIDNKILKNLQA
                     MHRAQMCDRVKGFDLKLAKVMSTLFQHYHNSVSEMPDNILEKMVPSWPDQMQAVPVEH
                     VKILNQPFKPSKADAEEAVNLVESEMNLDDSHEAFPDPPSEMPPLASPSMDIPKVVTS
                     QILPFEKVQLPDTSLISEQVSGFFSPPVVQPKSVTIQLPAGTSSAPTEGPSMFSVEQK
                     EKKYSALEYGLTFDIFSPEPQIFSVYLNPKLDYTSEPKEAPADPESSTAEEVGQDSPS
                     EIWKNLKKITTRVTRTLRGNPKYFVTAQHLQADARDR"
     CDS             19823..21163
                     /codon_start=1
                     /gene="RvY_00010-1"
                     /gene_synonym="RvY_00010.1"
                     /locus_tag="RvY_00010"
                     /product="hypothetical protein"
                     /protein_id="GAU87113.1"
                     /transl_table=1
                     /translation="MDLTTAASMPVLDTDLERLLQEQRRKLSALGIFPPARHTSEAHS
                     AGRETVGQSTHQPSTITTSKKVDPAGLFPSSSDGRRSAGDAVTGRLDRLAQTEERIAR
                     LLGVEGGDGGAGSTSSQLDYQALLRPAMADMPHTAADLLNRIRQKSMGQNAVSDSVKQ
                     SQFNIVHANTQLSRRKTVVESGWKKSASVTKSESQLNTKKAAGKIRDRLRTLKSEVSA
                     NLITAGKSCEDALSYVDITAKTLGQEATLQMMKGKLTAKEGELSSICQTASKNQQLAQ
                     KKAAEVRQMEEEHRQLKAKQMEQEKKLRACRKQLEEARRTCEVLTAEVERLSAELKGR
                     RKGQVDVAKKRAMPQISAARWAAANDKALKELLTLKEQNKALRDSGQKLQKDVKNQGK
                     RHEGNLTNFLTVVKKQQALMTCRARQRHLCGQMQLLKTADEQFRQLLDVTSITS"
     CDS             join(21356..21555,21643..21814,22112..22235,22307..22462,
                     22821..22951)
                     /codon_start=1
                     /gene="RvY_00011-1"
                     /gene_synonym="RvY_00011.1"
                     /locus_tag="RvY_00011"
                     /product="hypothetical protein"
                     /protein_id="GAU87114.1"
                     /transl_table=1
                     /translation="MQRNSPARSFLSPEECALIEAACVTLRESNKPSKFAFWGKIHGI
                     QNDYYIVQSYVFVPQEHPATFYSRDGLTWFNLAPAADALISSGAYLNGPFTGEPTTPY
                     TYSISELLTSNAAEKKPPLENTIREEERLAYVVRCVDDEGMMIPKYSYDNEVVGPVVP
                     APSYRGMSFDDCSNLENYLTFNPTSKAQWRSAVAAGDRARQMLQPLLHSCPENLTDHP
                     MAPHYKLKRLAAIGMAAGLLKFRLEARPRRKFDFSRISQASA"
     CDS             complement(join(24257..24573,24691..25189))
                     /codon_start=1
                     /gene="RvY_00012-1"
                     /gene_synonym="RvY_00012.1"
                     /locus_tag="RvY_00012"
                     /product="hypothetical protein"
                     /protein_id="GAU87115.1"
                     /transl_table=1
                     /translation="MSDSESGSQKERDDSQRSRRCRFAYKPCHLIALLRQVAAKNPFQ
                     YASGSAKDKAWESIRAALKEAGIKAQAQSNFLKVRKLLDDQDKKMSKLPKSGTAEQYK
                     ELKQLLEELAFLRKEEARHHAEEAAKAPAVLAAKKSSRKARGVTEVQQGKNIRDASMN
                     MMKRRRGKLGFSSDDGDTDGEEEHEINGHMGVNTRNPNRKAEHGEGDADRSKRYRPPT
                     RSDRLVDVLSASAKTEQEYGTMKLDLQNRQLAFQKAQLAEQKAVREEAAALRI"
     CDS             join(25451..25466,26021..26448)
                     /codon_start=1
                     /gene="RvY_00013-1"
                     /gene_synonym="RvY_00013.1"
                     /locus_tag="RvY_00013"
                     /product="hypothetical protein"
                     /protein_id="GAU87116.1"
                     /transl_table=1
                     /translation="MTSETASWRLCDRTHENLVVFQNIHWPGLLFHHAMDGGSFGRFY
                     CGRGLREISVPFLYGAPGDTVLSVDISIVPDYDMNVSYEERERVKKEKFDAAEKAAEQ
                     ADFDQRYEAGGSVYSSEGEQTENAELLETGDVQPIDYSAPPSQDE"
     CDS             complement(join(26790..27257,27482..27549,27612..27720,
                     27802..27881,28312..28456,28528..28585,28800..28939))
                     /codon_start=1
                     /gene="RvY_00014-1"
                     /gene_synonym="RvY_00014.1"
                     /locus_tag="RvY_00014"
                     /product="hypothetical protein"
                     /protein_id="GAU87117.1"
                     /transl_table=1
                     /translation="MSAKKGKSTSKSKGKKKKVTPVAPPADLPPDPILIAIQARKDGK
                     SKRQEAHKLCQQYIKELQQEIEVDIRPYREYRDDEYRAIKVRFANEATAYAQHLAATQ
                     RQLDARHHRLLQKLSSELSRVRDFRQDLGKKLADLEYLRDVKEGQKNTIGTLKKQLDT
                     AREEQAEGAQRIRLRHAKHRLIDLEGREHRLEILSEHLAKETLPYFVYRLKIKMDENR
                     RLRADVLRRVNEVKLLNKFRAELDAKDKMLAFDYQHLLKYRQNTSAMLKRLAISPVPT
                     APMERDFLMSPHGVRGWSWRQPSMAPLPVEDTRPSTASKSFMKSDDLNKEEKMDDSSQ
                     CPIFDQQPQDDLVPRQSAEEN"
     CDS             join(29573..29773,29848..30081,30333..30611,30754..31446)
                     /codon_start=1
                     /gene="RvY_00015-1"
                     /gene_synonym="RvY_00015.1"
                     /locus_tag="RvY_00015"
                     /note="SMC_prok_B"
                     /product="hypothetical protein"
                     /protein_id="GAU87118.1"
                     /transl_table=1
                     /translation="MLLNSICVFFPRQLQGERRQIDAVGNELQQLICKHQRCRQRLIE
                     AQSKAQLLQQSATARQCHQQSHTDESKPTHDALAARIAQQRQAIFSKRNEVNYIKSIE
                     ITAANKRRQDIRAKLSGVSQEVLQLRQHTADNHSKSLLAKEKTMASLRRKLHKAKKEL
                     DQRRFDLQSKKRDLQSEVEVHRQRHEALKRKLDNALTYQEHMDEPRLKKQDECQKAYT
                     AVQLQQSDKRQKHSSTLQDIDLALSSALARRTQAQLLVSKLSEKEANLAKKLNSLCSK
                     QGKIERMREHIAQLEREAENFRLQSQRKVQSTQAQLEEVRRASETGQLAQALAEQEKS
                     YTELRGLKYTFAFYTVVALKVKSNFCTDQETTIVYLEQVLKKLDNKMQEVDEMCHELK
                     SQLQQAGEKLQAEQQLAQANERKSEKILTWKRKFDKDDIKPTLYLKELKNRLATMKEE
                     VRKEERGSQLVDGGPSGS"
     CDS             complement(join(31523..31728,31885..32032))
                     /codon_start=1
                     /gene="RvY_00016-1"
                     /gene_synonym="RvY_00016.1"
                     /locus_tag="RvY_00016"
                     /product="hypothetical protein"
                     /protein_id="GAU87119.1"
                     /transl_table=1
                     /translation="MAEDNVGGKEGRLRYKLSIASRLLYKLIKDTRMLEADRQRLLTE
                     NQQIKEKLGHSLAQFDINQAVNGAIAAAYSTALAANNVKGAPVSLRPPPAVVTLPLPT
                     ANGGPLMDTVWDLLK"
     CDS             join(32291..32688,32977..33124,33191..33538,33612..33734,
                     33994..34168,34252..34400,34550..34966)
                     /codon_start=1
                     /gene="RvY_00017-1"
                     /gene_synonym="RvY_00017.1"
                     /locus_tag="RvY_00017"
                     /product="hypothetical protein"
                     /protein_id="GAU87120.1"
                     /transl_table=1
                     /translation="MSCDNDAEADPTSTIAISEEEKPSPPSAPPLRPLDPLVNFPTFK
                     FTPKEAQPVLTDHNQRTITSGQPVEKAKAFQPAIEFLASAKDVVVPRTRLPQATKHIP
                     IEHHKKHHYGCEICGRPPSIMCSACKETYYCGEEHCLLDFHAIHKFICVKLKIVRNVA
                     SKSEQWKRHSKQDIAENIKMRKIILLNIANNMAGRHLIRGNYSFTICCSLLAQKMVQE
                     LYGGNSPQIVRPYLSMAEAYLLRQKLERSRYYSALIHFLTSHKLGQQLPTEQEQQLRR
                     LEANQLARQGKWQQAKLVLATQIVEIAFETGLDNHCLLDSLFHLANVCFLDKDIVAAT
                     AFYAYFLQILSDALVKDVTQGAASLHRVIEEDLNEEVIEENKLGITLKDDLQWAHLMS
                     QTDYAVYLKRERILMYLRTIMLQFETANRTDFPDIFPALHYCVAMALFICRQWKEASN
                     MYGEAVSLTTPARQADFSDIHKVMDTLQAHAKVGLNALEVVEAPLEVRHKKGKKKREP
                     IALKPAEVKPCINPVKPLWRPQLVDFEAEEKLDQDDELGLTMKRLVDNVNQYKKEQQQ
                     KEAAANADNINILSKLGII"
     CDS             join(35401..35919,36192..36443)
                     /codon_start=1
                     /gene="RvY_00018-1"
                     /gene_synonym="RvY_00018.1"
                     /locus_tag="RvY_00018"
                     /product="hypothetical protein"
                     /protein_id="GAU87121.1"
                     /transl_table=1
                     /translation="MDFSALFEGWDVSQFLGVEALSLPTAPQQPPSLLPTSTSSSVRQ
                     GRGCLEARLSSAAPPSISSLAALTLSTSNNAHSFFQQPRQPAPQLQQYPTRPYVPLPE
                     GWLEIMHQCGMPLYYRSASRVSTWSRPYVSDKQERVRTHKVPISAFPCWDYRRALDEK
                     RESQPEPLSNANMSMNEPKGFAEILSGLEFREKSMMSAEQIHKYCGKRFQFRTVASSA
                     VKSSQAKRVRREILAQKLEGKERETVLGEGLMVAFRRG"
     CDS             join(36493..36697,36759..36868,37135..37494)
                     /codon_start=1
                     /gene="RvY_00019-1"
                     /gene_synonym="RvY_00019.1"
                     /locus_tag="RvY_00019"
                     /product="hypothetical protein"
                     /protein_id="GAU87122.1"
                     /transl_table=1
                     /translation="MTVIQSKKDQRISYQCGPSMDSNIIFHTEALIDGKVEGTADAMS
                     KKATKQAAALNALRKLVPELHSVLGETFGGTKQSGNVHEVALFRDVPISDPCIGDMAV
                     KAGVCLPTRQIGPKRNEYSCTAGRYSAAVVHTRMVRAKQLCAQRILQELHPQLRTYGK
                     FLELYGSVFQEKRKRLLKEAKSLYQLAPGAVEDKIDWPRLVRLQEEMRKLIAQTPGVL
                     SSIRYV"
     CDS             complement(join(40345..40897,41104..41698,41770..41887))
                     /codon_start=1
                     /gene="RvY_00020-1"
                     /gene_synonym="RvY_00020.1"
                     /locus_tag="RvY_00020"
                     /product="hypothetical protein"
                     /protein_id="GAU87123.1"
                     /transl_table=1
                     /translation="MYSINPLNVLKLLEEEYKLRYQPDDAPSEADKQLKDLIKNLIDI
                     KIARSDSPVLEVEEDLQGGLQLDGLTFDDFEKTAGDANLLNGSAERYFEDDRLNEPVT
                     SDTEPSSHEIFVPRLPDPRVPSSQAVNLDYKKRAVDYWCNATAKKRRSLSSVRNYFTK
                     VRDERQLRDWKKQLAEGGSRFDKLKVIRLETAKQYFIAKQKRQVVKDLDLQRWAITAN
                     NDVDLPGFTASPYWVSKFKRYYGIVDRKITKFVTKKSLEAAPQVKQSAEECVALVRSR
                     IAEHGLDCLWNTDQSGFEYEMRPGRTLEQKGVKHVEDITQSENSMTHSHTVMMTISPG
                     TRKFHPILFITLKEEKGVFGSIVSKTMFKADNLYMTASTSGSSTWNGPKKCCFRIWKT
                     AVSFWLTPERRSPIGTLLSNSSPKSCSTR"
     CDS             complement(join(44061..44515,45146..45254,45377..45742))
                     /codon_start=1
                     /gene="RvY_00021-1"
                     /gene_synonym="RvY_00021.1"
                     /locus_tag="RvY_00021"
                     /product="hypothetical protein"
                     /protein_id="GAU87124.1"
                     /transl_table=1
                     /translation="MGADEPEAAAGISKGRQRFRFISLPALPSLPSLSLAPLRQRLSQ
                     FLNLVRFVLSSSNEMVAYHRQVVGAAALPFLFAMGTLLAYSSGYIHTLFMRRAIQFIF
                     MICTVYSTDIIRTKLLPRQKTYEKWCSYMSSLKHNPHACAVLLAFHMQMQHGDAPPGL
                     WPEDVKLKYVNFCWRYTYRLWLNKLNMLAAKRDPSSGSSSSSDSTLAEKDSAMSLLHQ
                     SHPVEEAALDGDLPSMQAARRLLEPAEYLKLDVLDKLAGRVRQYARVLAGSARQKSQH
                     DHHYMESSMGGDDPMLTKLKVRMMAAHDHEHAS"
     CDS             join(46894..47067,47129..47284)
                     /codon_start=1
                     /gene="RvY_00022-1"
                     /gene_synonym="RvY_00022.1"
                     /locus_tag="RvY_00022"
                     /product="hypothetical protein"
                     /protein_id="GAU87125.1"
                     /transl_table=1
                     /translation="MVYLTISNEKAEERYLDKIKYVEHLPDQTEHIRRASEAFDKMTV
                     PVIDGLKKENRVVEVDAEQGSEKVLQEAVKIYEKWLLRSKQGIDFLENYKNLAGVQSY
                     ENTRRSI"
     CDS             complement(47615..48361)
                     /codon_start=1
                     /gene="RvY_00023"
                     /gene_synonym="RvY_00023.2"
                     /locus_tag="RvY_00023-2"
                     /product="hypothetical protein"
                     /protein_id="GAU87126.1"
                     /transl_table=1
                     /translation="MQRLGYPQREQYPHNQRQSILEKLIRAVDQALKNPDRKQRVEIE
                     SWLKRNLPKDPKLQLKLASDARGEVSLEDLLMTKEDLEAASKALLNESSKSGLHLPGL
                     DESVQNIWPNDARGVLSLTELLVEAPAEPLRIFPSTYVADLIVTLVASLLEKEEVTLQ
                     KVLEMFPQLRNTFKPVETYLRKREEEKAEESRKAEEEARRRSDEQRKADEASGKVSPA
                     NARSPSKSPVKLELQHKPSARSAKEIKSPH"
     CDS             complement(join(48318..48471,48711..49510))
                     /codon_start=1
                     /gene="RvY_00023"
                     /gene_synonym="RvY_00023.1"
                     /locus_tag="RvY_00023-1"
                     /product="hypothetical protein"
                     /protein_id="GAU87127.1"
                     /transl_table=1
                     /translation="MSDLCCCPPKALTCNYFNLEDIHINPKSILFRKIELGTGSKRLV
                     SLTNMGQSTIRFWLDSPSNKAFAISLMDIVILKPREFAVAEVLFQPTSITHYLDSFVI
                     HIADQSDRSITQSFTVNLQAHPSIELKVPHVLAFGHTIMGKTLHKVFSLENKTEIDFE
                     IETVCRGNRGDFCLCPNGTSALPAKSCLRYLLYFRPTRRETQTMEIGLRPVWRGIAGK
                     QVFISVSGYSTVKLKFLCQEVFPKRHRFVPGKPNAEASMVVRRKPDVTRMNVVKKERE
                     VGKEVLDRRREWIRQHEEEIRRQGRSTHATTWLPATRTIPP"
     CDS             join(50042..50459,50951..51070,51150..51299,51840..52262,
                     52951..53705)
                     /codon_start=1
                     /gene="RvY_00024-1"
                     /gene_synonym="RvY_00024.1"
                     /locus_tag="RvY_00024"
                     /product="hypothetical protein"
                     /protein_id="GAU87128.1"
                     /transl_table=1
                     /translation="MSWLSPEKRALFQQIQEAQRVEDEAAGLQARFQKVPDVGTAVRS
                     LVTNRSRVDGGEQQRYQNPKGQPPADAAQHGPDATRAGPSHLGPDEGETAHKSGLQQQ
                     SSGNIARKLYNEDFGQRSMKATSSTPALHLENFVGRSGDITVQRRDMVGREVTRRSIN
                     VVERRLSDRPNAMMLVDSNGSYHPPSPTARISMAKTQRLREERLQQAKMRQEAQGRFF
                     LPRPSLKLKVSDHGARIVNSRTSEHRPPPSLPSASERYENFRRQSAVGPTDRGNSAKK
                     RMVQTKMNDVFRRLGQDGSSSPSGNDRMTMAKNSVSQASYRNSARLSQLAQPRVLSHH
                     NAPKTVRKVAAAPRNAPGIQVSSKLSTTTGQKTVHTKKHVLGRTSKTGTKRRGKRARK
                     NTSKLGHDTSKTDTTSASDNSSTSVDSSTLSFPTETTSVTFETSDTTVSQPEKNSRKT
                     KKTVRRKTTIRKISASLYKPNANKESVEQVRARITERRSFAFGSAVPRAAPLPTTNQV
                     EESKKPVVVPQARKPSIQARQFGTVGFRKGQVREQTVPEVSENEASHGSSRSEEKVSG
                     EYSATSEGETEESTSEEEPAPNPVDIIRSLTQKLALENKNDFASNSQIFYTPDSR"
     CDS             join(54332..55060,55365..55488,55576..55884,56292..56587)
                     /codon_start=1
                     /gene="RvY_00025-1"
                     /gene_synonym="RvY_00025.1"
                     /locus_tag="RvY_00025"
                     /note="putative cytoplasmic polyadenylation
                     element-binding protein 1-B; ORB"
                     /product="hypothetical protein"
                     /protein_id="GAU87129.1"
                     /transl_table=1
                     /translation="MEYYETTEEPSFWPAFAHQRPPAGFAQFDATSAAAAGLDGDARL
                     HHQYHSLDHGKDLPFDEEQVASALDSGGKEWEGRRFGTVSGVQGAGVHGGAGGYGTAL
                     VNAGGGGTALCQRKLAVIRQAMWKAPQRPVAAQLQMSQTSNGSSIVSGSGPQSLASSF
                     DYSRADSDDSSVNDSGVELKGVPIRPGALGQGSLTGDPRWSGDMCVERQAQAYRSAAS
                     GATAAAVWSGTLPPRNTKGSAFSCKVFLGGVPWDITENDLQCAFGRFGNPKIEWPAAH
                     DSSSRNVKGHLYLIFDTEKSVKQLLGSCNYDFNQGHHNWYYKVASKRMRVKEVQVIPW
                     QLADASYVRNGCMTTFGTKTVFVGSLHGMLTAEGLGKVLDDLFGGVVAATIDTDKYKY
                     PIGSGRVTFNSNDSYMKALRAVFVDLRTPKFNKKIQIDPFLEDSACSICSTQLGPYFC
                     RDLQCFSYFCHACWQWQHSASNIGHHIPLMRNPRS"
     CDS             complement(join(57258..57601,57767..58565))
                     /codon_start=1
                     /gene="RvY_00026-1"
                     /gene_synonym="RvY_00026.1"
                     /locus_tag="RvY_00026"
                     /product="hypothetical protein"
                     /protein_id="GAU87130.1"
                     /transl_table=1
                     /translation="MKPNPVVLKSVSVSTASATPATTKPSTNPQSPKHRKPVKIDRSV
                     KNTKVVHKNLTTTAGSKQTFTLFKKATNVTSEKANKDKTGKSAKHVKLNIPTKISANK
                     TTIIKPSTSKKKSASKPKPPRTHPFVRKKSSTNSTSTKVRHVPKSHPPPKHSKLGTIH
                     RQDNTGKVVQVNGSIWRRFPKGESNMTVSKKWWKMMLPTNTTVPPGTSTTMKPTDKPK
                     YSRKSDENYFQAYSDTRAQQDVPAPQASFRTSPYGTSSWNEWEGYSSAGGNLDRSSKS
                     QNSLDVPPIQLVRKHRDLKNERACKRMMRDMEAFERDEQQKSEELMMVSFRDGVDEVQ
                     TLMHSWVKTPVHVMEALTFVSIMACMILYWVEISIQSRLRKKGFNI"
     CDS             complement(60181..60732)
                     /codon_start=1
                     /gene="RvY_00027-1"
                     /gene_synonym="RvY_00027.1"
                     /locus_tag="RvY_00027"
                     /product="hypothetical protein"
                     /protein_id="GAU87131.1"
                     /transl_table=1
                     /translation="MENSTSSSPSISKKTGALVFFVGCAIGLVISEILVGVASQKASQ
                     EAHKASVEYIQQVRKGGNGSVDKHHPSLKSPSNPKTPPGPGAKHLATLQSTVLVSRAD
                     NNRRSTEELEWEKTHKIQETHRRKMKKSKGHEKDKPHPRRNVHKRHQKHLQTVNVIRI
                     RAEGDGRIVTRICRPDDKNCASE"
     CDS             join(60972..61489,61810..62176)
                     /codon_start=1
                     /gene="RvY_00028-1"
                     /gene_synonym="RvY_00028.1"
                     /locus_tag="RvY_00028"
                     /product="hypothetical protein"
                     /protein_id="GAU87132.1"
                     /transl_table=1
                     /translation="MQRPEEISEESRMPSFPPPPPPPQDGDQRGPGPMNQEPAPPNNN
                     STDQSNNQNNNSQPSNKAEEEGPVSFDGGVNELKMNLRNMQNDHEEKLRVVKRGMDKW
                     KQITIPVLRVLHWEKNWYAAALIGGNTVFFYLLRYCNMSVLSLLFGLGAVLALMDGML
                     PMLSKAFLEKQNWSPEDDKKFDQLCSCLLEMWDYAHESMGSLRNLRKQMPHLFTVGLC
                     GLCLFGAVVSSKFNTAGSMYFLTTGMLLLPGICANKQRLTKMRVEVENALAHSAKGRV
                     PAGKQQDAKREPPPPPVF"
     CDS             complement(join(62494..62616,62691..62886,63057..63505,
                     63874..64011,64090..64227,64292..64350,64632..64727,
                     64840..64927))
                     /codon_start=1
                     /gene="RvY_00029-1"
                     /gene_synonym="RvY_00029.1"
                     /locus_tag="RvY_00029"
                     /note="enolase; ENO"
                     /product="hypothetical protein"
                     /protein_id="GAU87133.1"
                     /transl_table=1
                     /translation="MSGIRKLLARQIYDSRGFPTVEVDVFTPKGIFRAAVPSGASTGV
                     YEAKELRDGDQAKHMGRGVNMAIENIRNEIAPKLVASNISILNQAEIDKFLCDLDGTK
                     DKSRLGANAILAVSLAVAKAAAHEKKIPFYRYIGELSGNPGVTLPVPAMNVINGGKHA
                     GNRLAMQEFMILPRMGSEVYHHLKKIIEQKYGKSAIGVGDEGGFAPDIADGKDALQMI
                     KEAIEAAGYTGKIKIAVDTAASEFCQKEGENRLYNLDMKAEDQSSARKMTGDELAELY
                     KSYLQDFEIVSLEDPFEQDDFESWSKLTASVPIQVVGDDLTVTNTERIQMCIEKQACN
                     CLLLKLNQIGTLSEAIAAAVLARSNGWSIMVSHRSGETEDVTIADVAVGLGSGQIKTG
                     APCRSERCCKYNQLLRIEEELGSKAKFAGENFRNPQ"
     CDS             complement(join(65194..65496,65849..66124,66389..67084))
                     /codon_start=1
                     /gene="RvY_00030-1"
                     /gene_synonym="RvY_00030.1"
                     /locus_tag="RvY_00030"
                     /product="hypothetical protein"
                     /protein_id="GAU87134.1"
                     /transl_table=1
                     /translation="MSESFTESVSAKTAFLENFLPTLKEEWKLEKEAYEGVMGVKQDD
                     INERIVLDQLIRDVKLSRLRDMQRDKEDFLVLQETMANTCIGYVDQSRQDIEDEFRAY
                     MKKQDKMKSQQMGQMLDVQSKSLNNLRNYYQDIVSCNADMISDLKKQVDLRRGKLDRL
                     ERCIFQSLEELNKFTGPMEAIEREIGKCRQTLEGATALREQYAKKHILRKRLLDDVKR
                     LQWIKEIAMTKVQKYQEEMDHLDKGYFETTFNISQKASLSSLMHSKAYDLMAEEATIY
                     EICFHSLQAVASQDEAVIKQGGRHIQELLQHHRDDIIELHRYGAALKQKHEEVWKMAR
                     LQFKKKHRSSLDAFGFHQPKMDEIFPQNITYFKLEENTEKLPDRIEYAGRGNGDVLER
                     VKMLTMRSDNRDNGSPAVFGLTSTSKMTIASA"
     CDS             complement(join(69450..70408,70668..70734))
                     /codon_start=1
                     /gene="RvY_00031-1"
                     /gene_synonym="RvY_00031.1"
                     /locus_tag="RvY_00031"
                     /product="hypothetical protein"
                     /protein_id="GAU87135.1"
                     /transl_table=1
                     /translation="MSAEGMEQDLERDEAERGSLADGELQDKASGCPLGYIICLRCRQ
                     IFKHSRTSSTLVYKRHISACGKANNQPLIIGFAVGTLPNSIPEAAKHSQLHSQIYSWR
                     TIARSDYYQQIRRRGSGKTASEVASWNEADFDSARRWDDFGFFGKRNTPKLPTSVILI
                     LWRTISRALQVHALNVFKAKLQPDDIHKVAVFLNPSMKHMSFLPESDCVKVIATVMKH
                     VQQIEVPHDERALMPSADIGAPKPKSIFDFSNLCMFSSNEPGAQSEVEKYNRMRNPPA
                     TQDLLAFWQQNEKELPCLSLYAKRILSVPASSNPSERLFSHTGNALNSKRTSMLPKTL
                     SDLMVIR"
     CDS             join(71531..71667,71835..71862)
                     /codon_start=1
                     /gene="RvY_00032-1"
                     /gene_synonym="RvY_00032.1"
                     /locus_tag="RvY_00032"
                     /product="hypothetical protein"
                     /protein_id="GAU87136.1"
                     /transl_table=1
                     /translation="MLSSLAADGDGEGTQFSEDVVKSTTDFMGDVLAEGFLPIFCVSA
                     LREAPQIETI"
     CDS             complement(72105..72380)
                     /codon_start=1
                     /gene="RvY_00033-1"
                     /gene_synonym="RvY_00033.1"
                     /locus_tag="RvY_00033"
                     /product="hypothetical protein"
                     /protein_id="GAU87137.1"
                     /transl_table=1
                     /translation="MLYKSLVRPVAEYACSVWNSSSHKHQKQLEQVQKDFLKSIRPSK
                     LLRGQHDSDFSQYRQNLTDVQWKYLWERRAKAVMVNAFKIWTNGFPD"
     CDS             complement(72730..73461)
                     /codon_start=1
                     /gene="RvY_00034-1"
                     /gene_synonym="RvY_00034.1"
                     /locus_tag="RvY_00034"
                     /product="hypothetical protein"
                     /protein_id="GAU87138.1"
                     /transl_table=1
                     /translation="MSAKKPRRRELLSVIKEFGLFQRVREVTRVRKESSSHILFVTQL
                     SLVRQVNILPKLTFSNDHGGLHCLVKVWTVNFPTPPKPIWVLETGSQQEFRKEVAGLD
                     WKSFFDAQCNSDVAVGTFEAKLVEIAQKHFRLKKVGSRSLTQPSLSPRTIDSLKRRDA
                     VFRKWTKTMDPRDFNSWVDRARESKRILKATKTKQLRNIATVKKTSRCTVEHVKRSTK
                     TGSISPIPVPGTDHKYLVHPKDKAE"
     CDS             complement(73607..73936)
                     /codon_start=1
                     /gene="RvY_00035-1"
                     /gene_synonym="RvY_00035.1"
                     /locus_tag="RvY_00035"
                     /product="hypothetical protein"
                     /protein_id="GAU87139.1"
                     /transl_table=1
                     /translation="MTNVRETTDGNLGKQLTLRYANLDGIKSKTEEVKAWTEKGSVDI
                     GAFVETMADDTVTDGLIADLQKYSVYRKDRAGGTVAVIAREELHMLRVDEYEVEGLEL
                     LWLKVVG"
     CDS             complement(77658..77879)
                     /codon_start=1
                     /gene="RvY_00036-1"
                     /gene_synonym="RvY_00036.1"
                     /locus_tag="RvY_00036"
                     /product="hypothetical protein"
                     /protein_id="GAU87140.1"
                     /transl_table=1
                     /translation="MVILSFATFTRFLLSTNDQRPKPHISPPQSSLVSIEEIFRVDVE
                     KCLRQIIQKPLFKSDQVLTGFHARKYESL"
     CDS             78021..78515
                     /codon_start=1
                     /gene="RvY_00037-1"
                     /gene_synonym="RvY_00037.1"
                     /locus_tag="RvY_00037"
                     /product="hypothetical protein"
                     /protein_id="GAU87141.1"
                     /transl_table=1
                     /translation="MTTTIFNSWLDWLNGEMVKQNRVVLLIVDNFIAHKVSSRSNVKL
                     HFFPPNYTARAQQLDAGIIKSFQDSFKRHLFQRVFERIPIVNGVEDFVKELTIFDAVD
                     WSFEAWKDVKPSTVVNCPHKCKMASEKWQDAHSEVPAVVPSTNFSAALLVVQNLVSFD
                     DDSV"
     CDS             join(80713..81030,81244..81330)
                     /codon_start=1
                     /gene="RvY_00038-1"
                     /gene_synonym="RvY_00038.1"
                     /locus_tag="RvY_00038"
                     /product="hypothetical protein"
                     /protein_id="GAU87142.1"
                     /transl_table=1
                     /translation="MKACGTFSQASATFDSNEMTMEKGQCQTTTNVRFHGKYIFGSHT
                     DLGHSYDLLIANMQGDYTCKVVKGFRICTCDTSLCNKEMGSESKSLNDIEAAVSSTAA
                     SSSTWPSADQLFYSNDPMLLSTFSRRPEPKTN"
     assembly_gap    81458..81507
                     /estimated_length=50
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     CDS             complement(join(82029..82412,82493..82566,82657..82822,
                     83077..83388,83499..83522))
                     /codon_start=1
                     /gene="RvY_00039"
                     /gene_synonym="RvY_00039.1"
                     /locus_tag="RvY_00039-1"
                     /note="Piwi_ago-like"
                     /product="hypothetical protein"
                     /protein_id="GAU87143.1"
                     /transl_table=1
                     /translation="MLKAFTQEVTMVLGADVTHPGFGEDVGKPSVAAVVASTNETYTE
                     YVAEVRAQHKKVQESTSLKKKSKTQEIITDLGDMVLDLLEKFYTVNNKALPTLIIFYR
                     DGVSEGQYKEVMKMEVEAIREACFEAYADKPIPPITYIIVGKRHHIRLFATNPADQAG
                     RAKNVPTGTIADVKITHFSEFDYYLCSHGGIQGTSHPAHYDVLHDDSTLTSDQIQLFS
                     FYLIFLYARCNRIVGIPVSFSPAIRGTSLQFETKPSRPSFQVTHIFSVIGWKRAPVEV
                     IVSSSLFVLFKWRCPTIIGWKDALLVQKVLFVSFAGLPFQLKK"
     CDS             complement(join(82165..82194,82284..82412,82493..82566,
                     82657..82822,83077..83388,83499..83522))
                     /codon_start=1
                     /gene="RvY_00039"
                     /gene_synonym="RvY_00039.3"
                     /locus_tag="RvY_00039-3"
                     /note="Piwi_ago-like"
                     /product="hypothetical protein"
                     /protein_id="GAU87144.1"
                     /transl_table=1
                     /translation="MLKAFTQEVTMVLGADVTHPGFGEDVGKPSVAAVVASTNETYTE
                     YVAEVRAQHKKVQESTSLKKKSKTQEIITDLGDMVLDLLEKFYTVNNKALPTLIIFYR
                     DGVSEGQYKEVMKMEVEAIREACFEAYADKPIPPITYIIVGKRHHIRLFATNPADQAG
                     RAKNVPTGTIADVKITHFSEFDYYLCSHGGIQGTSHPAHYDVLHDDSTLTSDQIQLFS
                     FYLIFLYARCNRIVGIPCYWLEACAS"
     CDS             complement(join(82361..82822,83077..83388,83499..83522))
                     /codon_start=1
                     /gene="RvY_00039"
                     /gene_synonym="RvY_00039.2"
                     /locus_tag="RvY_00039-2"
                     /note="Piwi_ago-like"
                     /product="hypothetical protein"
                     /protein_id="GAU87145.1"
                     /transl_table=1
                     /translation="MLKAFTQEVTMVLGADVTHPGFGEDVGKPSVAAVVASTNETYTE
                     YVAEVRAQHKKVQESTSLKKKSKTQEIITDLGDMVLDLLEKFYTVNNKALPTLIIFYR
                     DGVSEGQYKEVMKMEVEAIREACFEAYADKPIPPITYIIVGKRHHIRLFATNPADQAG
                     RAKNVPTGTVDFSRVRTQWIPCEKQARWGRGVCFFSSGTIADVKITHFSEFDYYLCSH
                     GGIQVCDNHNTSNETNRWTTSYGLTFVTENRELLIQPTTMSFTTTPR"
     CDS             complement(join(83946..84097,84247..84257,84443..84567))
                     /artificial_location="low-quality sequence region"
                     /codon_start=1
                     /gene="RvY_00040-1"
                     /gene_synonym="RvY_00040.1"
                     /locus_tag="RvY_00040"
                     /product="hypothetical protein"
                     /protein_id="GAU87146.1"
                     /transl_table=1
                     /translation="MEVLPLEVISCLNTVLREAAITGNHNIPSERSYFSENHNAFTSD
                     SLFYGKGSLHEFMAKLLGLPPNFTADSDRPTAQTTHVRLQEPQGLHQELQQ"
     CDS             complement(84598..84849)
                     /codon_start=1
                     /gene="RvY_00041"
                     /gene_synonym="RvY_00041.2"
                     /locus_tag="RvY_00041-2"
                     /product="hypothetical protein"
                     /protein_id="GAU87147.1"
                     /transl_table=1
                     /translation="MVFALKINGQFDCDVVFDAGQKVFSGTIPTFDGESNLFSTSELA
                     MENASSKTLERTMSIPKDAEYRQRTFRLLIQECRPKKIA"
     CDS             complement(join(84630..84791,85632..85778))
                     /codon_start=1
                     /gene="RvY_00041"
                     /gene_synonym="RvY_00041.1"
                     /locus_tag="RvY_00041-1"
                     /product="hypothetical protein"
                     /protein_id="GAU87148.1"
                     /transl_table=1
                     /translation="MLETRWPTACRACPCAILLPNHRPSSSCPKRWSQNRLRDEPSKF
                     SSNRKVRRCSAAPFQLSTAKATSLAPASWPWRMPAARHWSEPCPSPKTPSTGNGPSAY
                     "
     CDS             complement(join(85954..85960,90197..90513))
                     /codon_start=1
                     /gene="RvY_00042-1"
                     /gene_synonym="RvY_00042.1"
                     /locus_tag="RvY_00042"
                     /product="hypothetical protein"
                     /protein_id="GAU87149.1"
                     /transl_table=1
                     /translation="MDGLDGLLVVLAEEIVESSSKLLSLLFHRADLLAECLDGGVEVV
                     YHAPLDGQADVTLIGLAHTPLHVPPALPVHSTVLPSNGQKLGDITEVEELLRLLQHER
                     TQIGK"
     CDS             86760..86945
                     /codon_start=1
                     /gene="RvY_00043-1"
                     /gene_synonym="RvY_00043.1"
                     /locus_tag="RvY_00043"
                     /product="hypothetical protein"
                     /protein_id="GAU87150.1"
                     /transl_table=1
                     /translation="MESGIEVEFAVRRNDTATAWRHPLRSFANTTAPIYKPYQNFRLD
                     ISAKNSSDARPAGAEAH"
     CDS             join(88148..88933,90223..91933,91964..92226)
                     /codon_start=1
                     /gene="RvY_00044-1"
                     /gene_synonym="RvY_00044.1"
                     /locus_tag="RvY_00044"
                     /product="hypothetical protein"
                     /protein_id="GAU87151.1"
                     /transl_table=1
                     /translation="MKKVRKKASKTKLFSPSRMPHTLDTTVFLEKEPDKDSDSEGDYV
                     SPDEEPKTSPLTRKFSSQKVECIRLGRCEKRPAKHTIHAIEKEIERHTAQVKQQKAVE
                     HLTTPGSPTSKSNLDSESTSLYVPTELLIKTSSVDMAIKQFLIKPTRKPSLSQLLHVL
                     TKRKLARKVEKEAQSVESLLKINPFKMNKELDMLELREMLNQGKRSKYANAILKITDD
                     KARRQYQVFNDRRLLAPVFNFCKTAHMEEGKKATYANLDTREKTKPQQFFHFRDVPQL
                     LAVTRKNRRMYRESRWDVKRRVRETNQCNISLAIKRRMIDYLNSSVQTFSKEISTVEE
                     ETEQFARAFDDFLRQNDEQTIQAIHRARQASRQRKAAAVRCRAIDMRNNLLVNHNIRS
                     EDKIRLLDRFINLCYAVLAGDVRAANLKRAEDERKKFNQERFRGYSSAATSFGSFVED
                     SSVRISEAVAPIITVEAHSEDFGVTKSISESLLVHLTLSSESEAEYSSVSPNELNPVF
                     VQEALKVPPVPFPNVTSALQTIADFRAKCLDLCTASHTFREHTKEMKAKMLDERQTAG
                     EIQRQSSIRIRVLQEEVNALTDRLDNTESTIALYNSGLQSREEFFKPMKQLSQDIVDV
                     YRTCMDSVDQPPTVELMLSALRKCLIDHQLKLKAYPPAYIKRWYEKVVANRVAEGRDV
                     VLQEKQQRGEEAMADRALQGANVIPRRQLRPRSQPPDHDNEVVTAMKSQPAMLDVMVQ
                     KMEHEVSREDEAGEQVVDESVSRYFDQGPSLPTIDEEAVDQLIIESSASLSLDSLPHI
                     SSAGNFRLSSVDVSVLGEVNASLPNDIQMPEVPDTETAGEQEPVAISAVREDSIHPKL
                     DDIFSDLDEGNNKPEDRKRSAKAALVDKVADTETVQPSDETKSGKARGPKGHGAKKSQ
                     ASSKK"
     CDS             join(92497..92726,93349..93796)
                     /codon_start=1
                     /gene="RvY_00045-1"
                     /gene_synonym="RvY_00045.1"
                     /locus_tag="RvY_00045"
                     /product="hypothetical protein"
                     /protein_id="GAU87152.1"
                     /transl_table=1
                     /translation="MSNGPSSTSNPRAKLNNPANQQAARVLMQELQSLQKEKTEGFTA
                     KLVQDDNLFEWEVAIFGPPDTLYAGGYYKAIMNILHPQTDNQRSGELPSERWNPTQNA
                     YSVLMSIISLLNEPNTNSPANVEASIMYRRWKEKGDKEYERIIKEGVEASRPDAARDG
                     VKVPTTMAEYCVAKPPALKDKPPLPPILDFNFDDDGDEPFDYTSEEENAPADVIINGR
                     TRTPPGS"
     CDS             complement(96190..98382)
                     /codon_start=1
                     /gene="RvY_00046-1"
                     /gene_synonym="RvY_00046.1"
                     /locus_tag="RvY_00046"
                     /note="RT_nLTR_like"
                     /product="hypothetical protein"
                     /protein_id="GAU87153.1"
                     /transl_table=1
                     /translation="MTPNFKTKPKLVWKIDGENINVFKTALSSIDWGQVFDLMCNVDV
                     AVTVFQDKFIAAAKSAFQLKSVGAKRLHRPSLSERAIDSLRRCGSAFKKWRRTRDQAD
                     YSSWKELEVSKRRIIQSDKHRRLYGIAKASRRNPRAVWKHVKKNTSAASIPPIPIPGH
                     DEKYIVDPQDKAEFISREFSKVYPACPRHCLPLHFTTSVILKQIQRLDSAKAAGSFLI
                     ANQLLKIAGTSVVYPLSRLFDLIVSKREFPTAWRQAEVVPIPKKGSSSFRPISLLPPL
                     SKLFEKIVASHLSNYLDKNNLLSDTQYGFRKQRSTEMQLLHMAHQYSQALLQRAEEDV
                     VLLDCSKAFDKLPHSSIVTSLSSHGVNGEMKGLLSDYLKGRSQRVVVEGHFSSEQSVP
                     SGVPQGSILGPLLFTIAVNSLAKSISSTVMQYADDIVLSRTIKKHEDCVLLQQDLQRL
                     VAWCKEVGLEINPEKSQHLRISNKRDKSVKVPGEYYVISGKKIPLVNEAVCLGVTFSS
                     KLEWTAQVDKVSAKCRQRLYAVNAFFPQRYGAEKQLLYKSLVRAVHDYASSCWFPTTK
                     SLQRQLESIQKKFLQNIRLSRADKDRHDPDFKRYHQHLQEVAWKPLWHRRCENLLVNV
                     FRIRTGNFASGNRLLKSQEPSRNLKTRSQAKILMMLPVSTAPLSCKLLESTSGSFAYI
                     TEALLKDSLFCPSALHVNSLLSFKNYLSGLNFSNFMWCKSNVDVLLLV"
     CDS             complement(98435..98998)
                     /codon_start=1
                     /gene="RvY_00047-1"
                     /gene_synonym="RvY_00047.1"
                     /locus_tag="RvY_00047"
                     /product="hypothetical protein"
                     /protein_id="GAU87154.1"
                     /transl_table=1
                     /translation="MEEKKADIVALVETWADNSTPDCLIADPEHYNLFRKDREGCKKQ
                     AGGGVAIAIKKGLQAVRMESLEVDGVEVMWIKLICLRLNVLIGVVYAPAYDAQVFSKL
                     RTSMELIPPFLRRNILLVGDFNCPKIVWDGDTSGNSERDRDFIQLKNEFKLAESERHH
                     SKAGTKRITTRPALRYPTGLRSQHQDR"
     CDS             join(99807..100046,100130..100384,100564..100938)
                     /codon_start=1
                     /gene="RvY_00048-1"
                     /gene_synonym="RvY_00048.1"
                     /locus_tag="RvY_00048"
                     /product="hypothetical protein"
                     /protein_id="GAU87155.1"
                     /transl_table=1
                     /translation="MHQSDKLKNSYSAFFDESVYNLRPAVAERQLKAQRYTSKFTEGI
                     RQAARKQKSTRNTLGVPAVAAPKPDRYLKRHANKKPMHVRRECTVSSTEGWSSKARQR
                     CSTSTVPMCNPHAVNQDWGKRNLEELGQIKPKEPSMRNVVSRYGRLGEKMPLSGLMSH
                     YVWKKGYGECPKYIQRYKKQSIAQHQHSLAARKAAQKEALGAQYQCISPHERQQVLDN
                     LKHLRDDTMHKFLLQTFALDNQTKLRDSVLLDTALKEFERQIDIVQRHKVIVVKKCNT
                     GPNDSEENQLIPT"
     CDS             complement(join(101490..102139,102212..102394,
                     102579..102981))
                     /codon_start=1
                     /gene="RvY_00049-1"
                     /gene_synonym="RvY_00049.1"
                     /locus_tag="RvY_00049"
                     /product="hypothetical protein"
                     /protein_id="GAU87156.1"
                     /transl_table=1
                     /translation="MSSDRPSPKAYHSSLYLATTRNTCPSKGWCRPHRVFLKEKGQCG
                     EHRQPIHGIQSTVTRCKHWLPTVSAPEVWNVLKRMPVKKAAGSSLLTNALMKAAVLAL
                     VYPLTRLFHLVLSTKHYPTSWKKADVVSVPKKALSERKEVEAVFLDCTKAFDRVPHEV
                     LVRSLQAHAIIGDLLQLLSHYLRGRTQRVTVGGYYMNRLSESVKCELFQYADNFVANR
                     MVGKLEDCQALQECLVQLGENCAGARLRPKPKQVATYPSVLNYGYSIDGQKMPTESQS
                     TCLGVVPDNKLNRTAQVDAATAKCRKRLHVIRSCFPAQFGTAKQMLYKILVRLVTEYT
                     CSVWNPASHKHQRQLEQVQKDFLRSIRLSRLLKGQHDSDFSQYRQHLTDVQWKYLWER
                     RAKAVMVNAFKIWTNGFPD"
     CDS             complement(join(103346..103489,103701..103772))
                     /codon_start=1
                     /gene="RvY_00050-1"
                     /gene_synonym="RvY_00050.1"
                     /locus_tag="RvY_00050"
                     /product="hypothetical protein"
                     /protein_id="GAU87157.1"
                     /transl_table=1
                     /translation="MAGNQRTSAKPDPSARTFFIRWEEIYLVWRTLERYRASRSCTIS
                     MTSIQGTSDGELGKRLTLRYANLNGVE"
     CDS             join(104242..104320,104673..104905)
                     /codon_start=1
                     /gene="RvY_00051-1"
                     /gene_synonym="RvY_00051.1"
                     /locus_tag="RvY_00051"
                     /product="hypothetical protein"
                     /protein_id="GAU87158.1"
                     /transl_table=1
                     /translation="MANRSFSRFVSVHGISHGHYLGAWGSQKNLRGSAVQPGFAANKA
                     EELKRHKYRELDGRYLFCPVAFETFGPFGNKASSLIQQIGKRIAEATGETGSLVFEFD
                     H"
     assembly_gap    106251..106813
                     /estimated_length=563
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     CDS             complement(join(109594..109925,110710..111003,
                     111122..111161))
                     /codon_start=1
                     /gene="RvY_00052-1"
                     /gene_synonym="RvY_00052.1"
                     /locus_tag="RvY_00052"
                     /product="hypothetical protein"
                     /protein_id="GAU87159.1"
                     /transl_table=1
                     /translation="MSERNMSFGTEELEKQKKYCQTLEVVNSGLYGGWTVEKNKCQSP
                     ADFPKFLTIPTFQTNGYWEDVYKPMVIAEGFVYPPATIEKFKVCTCDTPLCNDQDTVP
                     SSSFSSQEPDSTAKYCRSLATVHSEFYSGWPMEKDRCTSPADLAKFRSTARIFMQNVY
                     VEDLYKLPMRILGYDYNSLTVKRFEVCMCDRPLCNGRDTLPWSPPGLDAYPGQRQSTG
                     HGV"
     CDS             complement(join(115332..115577,115830..115868))
                     /codon_start=1
                     /gene="RvY_00053"
                     /gene_synonym="RvY_00053.2"
                     /locus_tag="RvY_00053-2"
                     /product="hypothetical protein"
                     /protein_id="GAU87160.1"
                     /transl_table=1
                     /translation="MGGEWLHRYLQAIIADTKALGGGNGANAIVLPIASLSQNTQARV
                     VFITVTMFTAVASQIAIVGCYRPEFNSLVQPLQEKEWQSNMCLPMDQYGT"
     CDS             complement(115703..>115993)
                     /codon_start=1
                     /gene="RvY_00053"
                     /gene_synonym="RvY_00053.1"
                     /locus_tag="RvY_00053-1"
                     /product="hypothetical protein"
                     /protein_id="GAU87161.1"
                     /transl_table=1
                     /translation="LTDKGKEHPQPRYILAGRCISFWSDALDSNDSMTVSSTSHRKWV
                     ESGFIVTFKPSYDGIWSKDRQGVRMPVDGSPDSLMTHPSSKTYGHGLRFSTV"
     CDS             117739..117972
                     /codon_start=1
                     /gene="RvY_00054-1"
                     /gene_synonym="RvY_00054.1"
                     /locus_tag="RvY_00054"
                     /product="hypothetical protein"
                     /protein_id="GAU87162.1"
                     /transl_table=1
                     /translation="MTEPLTGTLQGRQATGIDSPRQSDNPGKTRCSPTPKVNMTCIAS
                     LQTAKQRSEPAAHVRVRCKGIFCTQSCAVSVEQ"
     CDS             complement(126203..126634)
                     /codon_start=1
                     /gene="RvY_00055-1"
                     /gene_synonym="RvY_00055.1"
                     /locus_tag="RvY_00055"
                     /product="hypothetical protein"
                     /protein_id="GAU87163.1"
                     /transl_table=1
                     /translation="MLDTLFHETDLTVEAGRCQLATDLSNFERAPAFRRYGYLDAIYK
                     NRVNDKGYEWELRTLESFEICACETEFCNAQDLVPHSTPDGNPGQGQGTVLCVSFAAH
                     AFPRTVLPSSCVCLSISKFFLPDKISRIDCLTVARECVAPK"
     CDS             join(133096..133363,133495..133829)
                     /codon_start=1
                     /gene="RvY_00056-1"
                     /gene_synonym="RvY_00056.1"
                     /locus_tag="RvY_00056"
                     /product="hypothetical protein"
                     /protein_id="GAU87164.1"
                     /transl_table=1
                     /translation="MATEVKKKRLRPPKRLAAEEEAEKSEKEAAAKTAVDRQLQMDLE
                     LLRLTNKENPFHYTVNKREDSWSLIAVDVTTLFEGEIFDDRRCRENVETVSANESRSP
                     VPKKSSPKKPAAPFRKRKAEPVDEYLEGKKIQQLKELDMKIEMHRETMLDNAAERSIR
                     REFLEFDREKLRMEDADKARRFELEKEGREAIPAGKRRAG"
     CDS             complement(133905..134363)
                     /codon_start=1
                     /gene="RvY_00057-1"
                     /gene_synonym="RvY_00057.1"
                     /locus_tag="RvY_00057"
                     /product="hypothetical protein"
                     /protein_id="GAU87165.1"
                     /transl_table=1
                     /translation="MCGPEPGSFHDAKLLYKSKILNMMKEIRTWTPTPETGYYLYGDQ
                     AYKSTPQAVGPVRYNASPLETACNAAMKTLRISVEWGFGKIGNLFAYDNYPEDLKLGL
                     QPLGMYFRVAALLTNCHTCLNGSQTPNYFAVVPPTLTEHLENYPEDHIDN"
     CDS             complement(134479..134661)
                     /codon_start=1
                     /gene="RvY_00058-1"
                     /gene_synonym="RvY_00058.1"
                     /locus_tag="RvY_00058"
                     /product="hypothetical protein"
                     /protein_id="GAU87166.1"
                     /transl_table=1
                     /translation="MDKKLLVIMCEEGDIDEEELVILGRLTNQAKMRPGDFDLYKLSR
                     QDCLEDFRFSSHQLEI"
     CDS             complement(135359..135580)
                     /codon_start=1
                     /gene="RvY_00059-1"
                     /gene_synonym="RvY_00059.1"
                     /locus_tag="RvY_00059"
                     /product="hypothetical protein"
                     /protein_id="GAU87167.1"
                     /transl_table=1
                     /translation="MVKLPFFARFCTLGMSGKGTRAACCLEISSHDILREANIRKNDK
                     DPTVHIFTPLKPLDSRLSNNYFTVKYKLK"
     CDS             140201..140554
                     /codon_start=1
                     /gene="RvY_00060-1"
                     /gene_synonym="RvY_00060.1"
                     /locus_tag="RvY_00060"
                     /product="hypothetical protein"
                     /protein_id="GAU87168.1"
                     /transl_table=1
                     /translation="MKALPGTSPDIESLYQSAGSNSVTRALLRHPTQALGVLISHVLN
                     RLSKSEPKTSVLGKKYARWSSTKKNMACETDTEGTVPCPWLGYTPGMLDGSGSFSLHK
                     DVSHMQNSNSWTLPK"
     CDS             complement(join(147334..148377,148530..148949,
                     149074..149370))
                     /codon_start=1
                     /gene="RvY_00061-1"
                     /gene_synonym="RvY_00061.1"
                     /locus_tag="RvY_00061"
                     /note="ANK"
                     /product="hypothetical protein"
                     /protein_id="GAU87169.1"
                     /transl_table=1
                     /translation="MVHLKEIQTYQRSIRRLAPIQCIQDAGQKVQLKTLFQYIIDRDL
                     PNVHKFHNQGFPGIFQAHEDKTGNTVMHVAAYKNDLELIDWLLNEGSEIDARNRAGVT
                     PMMVAVHHGYFDLVRLLASKEGSDLNAEDRFGQNLLWYCFGGTERYGQIAAFCLNTKK
                     PVEPTSNLIGKPILVRACEKGNKARDIVELLIRSGCNVDEAAVRTGRTPLIEAARRGA
                     SGVIQLLLQEGADPDLVDHKQVHSTHEAVYHGHVEALQVLASAGAHLDSPAHHGNTPL
                     HLAVAAQQLPAVRFLTHRGANPNTKNSLGMTVKQLAKKYGLKAVSKEMKKAEKQRNGV
                     GNKFAIEFYDWFQENTDVLRNALQTVSTESESQDTENPILGNTDPDSVTKEQLSTVLQ
                     SLSVPVKEEELPELIEALDSKKTGALTIADIFKAAEKIVPKAFLKSAYSADSGKKGKG
                     KKGKGKKKRAKLKLPKGLKISICIAEEEESPMAFKNSLHVAKHVVFGDKVVSGLTRKE
                     QSTPFTSDNIWRMEQSAVETCPVNDLCRDGDWESVARACKKGLDVNQCDKLYKTPLMY
                     AAAAGRWDMVKMLLAYGYTT"
     CDS             join(149252..149340,149413..149545)
                     /codon_start=1
                     /gene="RvY_00062"
                     /gene_synonym="RvY_00062.1"
                     /locus_tag="RvY_00062-1"
                     /product="hypothetical protein"
                     /protein_id="GAU87170.1"
                     /transl_table=1
                     /translation="MIYWNSVLSWTFCPASWIHWMGASRRILRCVSRTEEEGILGSRT
                     VPCCHVESCPETKSSENSLRPRGDHFLSK"
     CDS             149394..149615
                     /codon_start=1
                     /gene="RvY_00062"
                     /gene_synonym="RvY_00062.2"
                     /locus_tag="RvY_00062-2"
                     /product="hypothetical protein"
                     /protein_id="GAU87171.1"
                     /transl_table=1
                     /translation="MGTLFTAYRVPKKRESWEAGLYLVAMSNPVPKQNLPRTPCVHEE
                     ITSFRSKVGKVRAGQEPRRIEKGKEAGSQ"
     CDS             complement(join(151044..151193,152850..153523,
                     153674..153794))
                     /codon_start=1
                     /gene="RvY_00063-1"
                     /gene_synonym="RvY_00063.1"
                     /locus_tag="RvY_00063"
                     /note="PRK08853"
                     /product="hypothetical protein"
                     /protein_id="GAU87172.1"
                     /transl_table=1
                     /translation="MAGSGKKARSAMFLTYPDGFKRLGIAQIVVGLLCIGMKIGVFVI
                     AGNEEHGLSYYFLSSGSRNLAYVPMGIFVGALSVIAGGLSFTIASHLTDKALRTIPVG
                     PKVRIYRYFSGGALVFAVFMGCFNAYLARLTSDWFSMCMTTNRFVASGQNIIAVQEDG
                     SRNVDFVCRMVPLTKYGLFVLHLFLALAGLAMIIMCIVALTRYPAIDGGFVMTQNSVA
                     ASVPQRTPPPQVVTAPVNPGNGTLAQPYQQPTQSYIQQYPPAQPYQQPPQPVYQQYLT
                     GPQVQYQAPPMLQHPPPPVHQVQYNEEAYGRTCGDTFV"
     assembly_gap    152470..152519
                     /estimated_length=50
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     CDS             complement(join(154585..154723,154825..154942,
                     155067..155127,155295..155378,155600..155749,
                     155822..156019))
                     /codon_start=1
                     /gene="RvY_00064-1"
                     /gene_synonym="RvY_00064.1"
                     /locus_tag="RvY_00064"
                     /note="RNA-binding protein PNO1; PNO1"
                     /product="hypothetical protein"
                     /protein_id="GAU87173.1"
                     /transl_table=1
                     /translation="MDMEDHDLPDLDPVVVDIKPSAVKSSGADGASEKQQKRKRRDTQ
                     SSAMVLDATEEEKTSSKKRPRWEGETDVRKIPVPANRYTPLKNAWPQLVQPVVEHLKL
                     QMRFNLKTRNVEIRPSPETADIGALQKGADLIKAYVLGFDVDDAMALIRLDDLFLESF
                     EVTDVKPLKGDHLGRAIGRLAGKGGRTKFTIENVTKTRIVLADKNIHILGSFQNIQIA
                     RTAICNLILGSPPSKVYGTMRAIAARSTQRM"
     assembly_gap    159689..159738
                     /estimated_length=50
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     CDS             160854..161060
                     /codon_start=1
                     /gene="RvY_00065-1"
                     /gene_synonym="RvY_00065.1"
                     /locus_tag="RvY_00065"
                     /product="hypothetical protein"
                     /protein_id="GAU87174.1"
                     /transl_table=1
                     /translation="MRGITKDHTGKDAALHLLRLGLKLPEHRYGNKGRWQSHDNSRAV
                     EHHNGLDLSPVEGPVDGGESVSDT"
     CDS             complement(join(164184..164334,164399..164488,
                     164559..164690,164964..165375,165542..165634,
                     165715..167511,167578..170059))
                     /codon_start=1
                     /gene="RvY_00066"
                     /gene_synonym="RvY_00066.1"
                     /locus_tag="RvY_00066-1"
                     /note="MDN1"
                     /product="hypothetical protein"
                     /protein_id="GAU87175.1"
                     /transl_table=1
                     /translation="MGSLHDDWVTSDGEESYVDESQIERLELVVQQYRDKVRHLEGQS
                     DQGASPSLDHHQGYSPGVSGRYYNVGDESVDNNRATPSHRLTDDEDSRDQNTDDYTED
                     RKRSQDDPRRDFREENIEDNFHPADTEKETFVRDHAVPQATRNYQPDDLTSPYILQDS
                     LDETPAKTSNEEKERSVGSNDSDWQRQESAEGGSTGRQEVDASGDSGNTDSNLWNYEE
                     LRFLSAPMLHYYDETAMMDYGYSAERRQGSSHSYGEDRMLTSPVRPVQDNAEDQPEPR
                     NNFYSDSLEDTINAFYGQEKNRLDDQPSYMGESDLSNETLADETKRAVAYQLLKAANL
                     QVGFVSEEPNEVKGQELNEEEYTPRNAEDGERNVDGVLLTPNEDYAEKDSLNSENLQQ
                     FNENLQKEFEADLPGDSQPERYRQDGTSNAYSELEYYPNQDGETESLQPFRQEQEVDQ
                     LMDDDGPKLKSQTEGDDRAQPSTEQHWPDDKVQLDKDDSESGERANESQPATADNIAR
                     DTLEGDVPRAFDNGELTSAPTVHLAKEDVDDVDQYTRPQSPYFEAAQSDRTDLHDQEN
                     TEINADNEYNPMTAGHSDTEFQPGSATPWEYDQHLNGNARGNGDRLGDHPTAQDGDYK
                     WSEGQDMSNRQSDDWPLKVQEKDNDHNHSNDNRYSYENTNDRGGDAACWRDGEVKELD
                     TGQSSFHQGMASQGTTFESGALLRDLASSKRTSLASEQSYGHAFETDESQNQDNAADD
                     ISEEVSHDKSEDEEGESTGSIKPSRYTDETGRVGDTDKDFHNEMDTSDGDISALTSFM
                     KSPSDALGDNRHQQGEAPTVEIRQGMSDEDLPTEMDESQPQEESATPQGGKMSAASGN
                     QMMTNGSIAYLDSNENDQRETLERADSKKAADGKGMVDNAPTSYTQSPHNDNEPANHR
                     QSANSDSRHTGGADQRFDQYNQDFERIEQFSHRPDEYFTRGISNYIQDNRYSDNSLYN
                     DDRPVDQERDMIDYGIDNRASPFRISSHNYQRNDSFNGDRHQASSRDYDQKDNYADQG
                     SQAAMYSRFQEAKDFDGMQQEYPRHFNQEAFQSTRSEFSSELHNNEFDDRRYQEDDCG
                     QPAYNLESGEHFEREQMYRAEPAEMNYGATACNAGPNGQDQWQEKATSGEVEAITEKL
                     LPADEEVDKAGESSKEGKGTSAVESTELFIREQAFNQPEDQDVRQPSFIYIGSEPDSE
                     GNEQGEETTNDQNEEEYLDHVEPYYVVQDVDYQLADLVVPSIEPPELVLMDDAISRRT
                     QWNLAEHVNLSDLQEHYIAKGASTDILHSALDRLFTQQSLKDLTSGHFASSLVHATEL
                     LESGMESQGGSLVSKGRRREDLDTQEDAADLSESDGGTSLTSGDTNSAKLRRKTLKPS
                     GQRSWYQLDNLPVNTLKLSGSNRPSQLALPMDDVTLSVQSSTVPSQVTGGYDTERTVM
                     TSITTAVGPPTLAALLATIPAPLLSRSVESSGFEAPEIPADPLSVDAPATPRPAVRSA
                     PPVPSARASRHIITRPHGDLPALPTTKSAALASQAELHQAGDHRTVSQIWHFDRSIIE
                     PYKNVLDTRPDEGTEPTAVLFYPCLLPDRSLNTYDRIMEHLHKFVMSRLEEIEDKPFR
                     IFVFNAAVPTGTEHAVTWIQHVHKSMDPAMKENMQSLLIVHPNLKTKTELKTIGRAVL
                     GKEFYSKIHFVKSLKDLSRMQSVQYAAIPKPVRDHDRRREWKLTSNTCGC"
     CDS             complement(join(165605..165634,165713..167511,
                     167578..170059))
                     /codon_start=1
                     /gene="RvY_00066"
                     /gene_synonym="RvY_00066.2"
                     /locus_tag="RvY_00066-2"
                     /note="MDN1"
                     /product="hypothetical protein"
                     /protein_id="GAU87176.1"
                     /transl_table=1
                     /translation="MGSLHDDWVTSDGEESYVDESQIERLELVVQQYRDKVRHLEGQS
                     DQGASPSLDHHQGYSPGVSGRYYNVGDESVDNNRATPSHRLTDDEDSRDQNTDDYTED
                     RKRSQDDPRRDFREENIEDNFHPADTEKETFVRDHAVPQATRNYQPDDLTSPYILQDS
                     LDETPAKTSNEEKERSVGSNDSDWQRQESAEGGSTGRQEVDASGDSGNTDSNLWNYEE
                     LRFLSAPMLHYYDETAMMDYGYSAERRQGSSHSYGEDRMLTSPVRPVQDNAEDQPEPR
                     NNFYSDSLEDTINAFYGQEKNRLDDQPSYMGESDLSNETLADETKRAVAYQLLKAANL
                     QVGFVSEEPNEVKGQELNEEEYTPRNAEDGERNVDGVLLTPNEDYAEKDSLNSENLQQ
                     FNENLQKEFEADLPGDSQPERYRQDGTSNAYSELEYYPNQDGETESLQPFRQEQEVDQ
                     LMDDDGPKLKSQTEGDDRAQPSTEQHWPDDKVQLDKDDSESGERANESQPATADNIAR
                     DTLEGDVPRAFDNGELTSAPTVHLAKEDVDDVDQYTRPQSPYFEAAQSDRTDLHDQEN
                     TEINADNEYNPMTAGHSDTEFQPGSATPWEYDQHLNGNARGNGDRLGDHPTAQDGDYK
                     WSEGQDMSNRQSDDWPLKVQEKDNDHNHSNDNRYSYENTNDRGGDAACWRDGEVKELD
                     TGQSSFHQGMASQGTTFESGALLRDLASSKRTSLASEQSYGHAFETDESQNQDNAADD
                     ISEEVSHDKSEDEEGESTGSIKPSRYTDETGRVGDTDKDFHNEMDTSDGDISALTSFM
                     KSPSDALGDNRHQQGEAPTVEIRQGMSDEDLPTEMDESQPQEESATPQGGKMSAASGN
                     QMMTNGSIAYLDSNENDQRETLERADSKKAADGKGMVDNAPTSYTQSPHNDNEPANHR
                     QSANSDSRHTGGADQRFDQYNQDFERIEQFSHRPDEYFTRGISNYIQDNRYSDNSLYN
                     DDRPVDQERDMIDYGIDNRASPFRISSHNYQRNDSFNGDRHQASSRDYDQKDNYADQG
                     SQAAMYSRFQEAKDFDGMQQEYPRHFNQEAFQSTRSEFSSELHNNEFDDRRYQEDDCG
                     QPAYNLESGEHFEREQMYRAEPAEMNYGATACNAGPNGQDQWQEKATSGEVEAITEKL
                     LPADEEVDKAGESSKEGKGTSAVESTELFIREQAFNQPEDQDVRQPSFIYIGSEPDSE
                     GNEQGEETTNDQNEEEYLDHVEPYYVVQDVDYQLADLVVPSIEPPELVLMDDAISRRT
                     QWNLAEHVNLSDLQEHYIAKGASTDILHSALDRLFTQQSLKDLTSGHFASSLVHATEL
                     LESGMESQGGSLVSKGRRREDLDTQEDAADLSESDGGTSLTSGDTNSAKLRRKTLKPS
                     GQRSWYQLDNLPVNTLKLSGSNRPSQLALPMDDVTLSVQSSTVPSQVTGVDMIPKGLL
                     "
     CDS             join(172795..172831,172924..173022,173170..173386,
                     173636..173708,173783..173805,173882..174168,
                     174282..174579,174657..175068,175145..175771)
                     /codon_start=1
                     /gene="RvY_00067-1"
                     /gene_synonym="RvY_00067.1"
                     /locus_tag="RvY_00067"
                     /note="putative beta-galactosidase"
                     /product="hypothetical protein"
                     /protein_id="GAU87177.1"
                     /transl_table=1
                     /translation="MVKLYLHGIIQLVTVVCVALTSAQAEPIKRYNYYKNLPTDGARR
                     TGVTAAGSNLTLNGKPLRLISGAMHYFRIVPQYWRNRLALLKAAGCNAVETYVPWNLH
                     EPSPGHFDFEGILDVRRYIEIAAELDLMVIFRPGPYICAEWEFGGMPSWLLADDNMKV
                     RSSYAPYVEASDRFLQELIPRIANLQFSQSGGPIIMVQIENEYGGFDQDRRFMDTLRD
                     SLKRFGVTEMLFTSDGPNDLAKGQASDVWLTVNEQTNMGDALDKLTAIQPNKPLMVME
                     YWSGWFDHWTEHHQTTSMEKFSSELTTILARGASVNFYMFHGGTNFAFMNGANMGLFN
                     VSAGYQPTITSYDYDALVSEDGRVTQKWHKTRELLAQFGLLPEELQDPTQNAAPKSLG
                     RMQVDGWLPLTTLNSFFPSFQLESPLWMEKLKYKPSGQSYGFIAYERILPESSGELLL
                     GEMHDRALILVEGQQHALIDFAASLKKAHTIKLTNSVAGQKVTILVENMGRVNYGNSA
                     DSQRKGLMGQVTLNGKPLTGWTVRPMEFTSVDVAAIFNPTTAWDGLSPSTSVPACFRF
                     TLNLDEEPTQDTFLGMEGWGRGVAFVNGFNLGRYWPTAGPTKTMYVPAPLLKKGRNTF
                     ILFELHTVDNVLQSVAQPNLGPVQPHQPATSMSPQPSSSPSSHHDYLFYNVLAAALMM
                     LATITYQH"
     CDS             complement(join(176215..176475,176531..176848))
                     /codon_start=1
                     /gene="RvY_00068-1"
                     /gene_synonym="RvY_00068.1"
                     /locus_tag="RvY_00068"
                     /product="hypothetical protein"
                     /protein_id="GAU87178.1"
                     /transl_table=1
                     /translation="MALLPHRPAPQRRRRLFFNNPDGDFHLREPPQYHSHELEDLPVQ
                     RAEHGQGDGDGAISNRGRYANNPVLFFQVMRQMALDFHLVEYHIRSKVIKAEEFRLQE
                     QLLEDVIKTTVMMMTSTVLWLGWFVMLPVKHFSPLAPIYTIFALSQCFLLRMFHIYNK
                     DNAVHKRMRVVRKRLAMERAELTRVIEAMFQT"
     CDS             complement(join(177789..178232,178571..178811,
                     178868..179090,179245..179326,179534..179653))
                     /codon_start=1
                     /gene="RvY_00069-1"
                     /gene_synonym="RvY_00069.1"
                     /locus_tag="RvY_00069"
                     /product="hypothetical protein"
                     /protein_id="GAU87179.1"
                     /transl_table=1
                     /translation="MSYFTKLPIDTALHDRLTRKRQTLEERGRKIFDADASKQAYHVE
                     DLQRQVHVRKAQEMAEKMRDLTFDQATCRQAIAHQLIDAQQKEVKKALAHEVDGYRRY
                     FQRKEDSSTYDLNDPNASKSFLPVGASGDYSIYGPSSILTFDSDKIRQPEDIKNSINK
                     QRDDLQRQMWEEAAKKDFERHLDNIAHKESMAKEAKMRGREDATKDLKHAMNKAVSHY
                     NESLAVNQEEGKRRLRELENQDKKVHINNTMNSDLLNEHPTNPRDRKGISPEEKKKIY
                     EMWERQKHDREIAKNQERAEGYTWDNYFRSMGVEYEAQMEKLKAERALLRAGMDEANR
                     KQVLEDQEREEIAKAVYGRANPTEEFFDQFQRDPR"
     CDS             join(181864..182332,183040..183213,183286..183543,
                     183748..184109,184183..184302)
                     /codon_start=1
                     /gene="RvY_00070-1"
                     /gene_synonym="RvY_00070.1"
                     /locus_tag="RvY_00070"
                     /product="hypothetical protein"
                     /protein_id="GAU87180.1"
                     /transl_table=1
                     /translation="MLTLFKPEKWTSVNDFEAAAFVLFQLSLVGHTDYQRVKILAHPY
                     CVREHWSELMTAVSEVHGTLWMHTLDRLVGEEHAEQREDFAKELLSRIKYALQHPMIN
                     MELWESGTNFNNDQDDVDKCQPEPPVQPQHNQPESSVLVSFLEQAFEFFQHNSQGDFA
                     RICHSMLKLVPTDQQAAFNSHHLVMFAEMFDKQTDSDRGVAHSLATVLAGLLYADDVD
                     KLACAGNFGPKLIRFLDKHLQAPDLLCMLATALSQIPLYMSRVGCLTQQLTDVPALFR
                     CAFAHFWEWPTLMPLVMCILQAVSTMPVTDVARTPLVPLLMLTIHCHVDFPCEINLAL
                     RMLRRLIQKSDLGACMVIRFPVGGALYSPVDTFLRILELHGNKNSLRREIALITVRLW
                     STERFFAILMQDGWLKIFAALMSASRQQKGITKLLKQCLADRNLVIIDNKIYRISKEP
                     FIKSAEYFDS"
     CDS             join(184567..185118,185157..185228)
                     /codon_start=1
                     /gene="RvY_00071-1"
                     /gene_synonym="RvY_00071.1"
                     /locus_tag="RvY_00071"
                     /product="hypothetical protein"
                     /protein_id="GAU87181.1"
                     /transl_table=1
                     /translation="MPPVFSGEKLHGVLNTTANTSDARSHEFSPWSPCTATCAPSYRV
                     RRLLDCPPGPDERCSEVMPCNTTLPECGSDSYPGIDVYLKVGDTENFTCPAHPREPAL
                     RPVWYHWSNDAWAQFYSSEDQRILIRDHTHLLELRSATETDQGSYKCVLRYPDGKVKA
                     AYYYHIKVSRHFTLLFEILMGVAALLFAKFERYPTVFYEKGTSEDTV"
     CDS             complement(join(188562..188675,188735..188860,
                     189143..189281,189341..189456))
                     /codon_start=1
                     /gene="RvY_00072-1"
                     /gene_synonym="RvY_00072.1"
                     /locus_tag="RvY_00072"
                     /product="hypothetical protein"
                     /protein_id="GAU87182.1"
                     /transl_table=1
                     /translation="MFSRESKYYEEKELMQMAKCLESAFATPPKPADSERLKFSQLPR
                     LQYETPAEWPKSPPHFLLPDIAKFYSGLTEELLFFDFYFQEGSLAQIMAARTLKKRNW
                     KFHKVYRIWFQRIGEASISNTEFERGNYRYWNYREWKEEVKYNFTFVISLMENVDLNG
                     WPVC"
     CDS             join(190082..190381,190444..190524,190709..191048,
                     191110..191132)
                     /codon_start=1
                     /gene="RvY_00073-1"
                     /gene_synonym="RvY_00073.1"
                     /locus_tag="RvY_00073"
                     /note="nascent polypeptide-associated complex subunit
                     alpha; EGD2"
                     /product="hypothetical protein"
                     /protein_id="GAU87183.1"
                     /transl_table=1
                     /translation="MKQGKARKTVTRPGATDKPKDAPSPTKEASDDDMPTLEKGDAVQ
                     QKDHSDDDDVPELEDNFTAPNAASKPSNDASPDKAGESGHGKQSKNEKKARALLLKLG
                     LKPVPGITRAAIKKTNLTFVINNPDVYKHPYSDHYIVFGEAKVEETDHNEALSHLKAM
                     ERIRQLNLSDPEASESGGISGGGDLGLAKSKIEEEPEEEEGEVDETGVDSADVNLVMA
                     QSGATRRQAVNALKKHSGDVVNAIMEMTS"
     CDS             join(194538..194567,194661..194837,194912..195043,
                     195116..195259,195325..195453,195540..195601,
                     195668..195796,195860..196048,196136..196313,
                     196639..196893,196969..197100,197171..197389,
                     197579..198136)
                     /codon_start=1
                     /gene="RvY_00074"
                     /gene_synonym="RvY_00074.1"
                     /locus_tag="RvY_00074-1"
                     /note="putative canalicular multispecific organic anion
                     transporter 1; MRP_assoc_pro"
                     /product="hypothetical protein"
                     /protein_id="GAU87184.1"
                     /transl_table=1
                     /translation="MTEVCHEPLWNNSRSWNNGHPELSNCFEQAVLIGVPNALLWLLI
                     PLQLYSLSRSGRRLGRWTKLTISKMALTGFLIAVEILDLIYTAHALVRYGGNSIPTIT
                     IVGPLIQIFTFILVLVYMDLDRRKGRLSNPLLFVYWFLLTISGIVLLRTRFWRSLGFF
                     QPSRIPDAMFRLFVHEVWFPIVLIQLLLSCWADSYPYQYVKKIENLSPEVNASFLNKL
                     CGVWIYDLIRRGSKRHLTNEDIYELIPREHAEHLEVILGRNWTKQFKGRDVMEDAVSV
                     HSGSNQPSILPDQGRGKKPSLVLAVYQLVWTQFWTAALWKFIYDMCIVVVIVLVGAII
                     SFTARPDEYAWRGYVYTLVILMASLLQTFAIVNFNFINSHQGMNTRAALSAMIFRKVL
                     RLSNTSRGSYAVGNITNMLTADMQRITGFFFHQCYLWVTPISVVIMLLVLWAYVGVAA
                     LAGLGTVGLLGVAQLFLVNRSRGQEAAAMRYKDIRQRTIGEIFNDIKILKMYAWEHHF
                     AERAIKMRRDEQDALYRASHYSNVNLAITFITPPLAALITYATYLYIDPNNVLNSRTA
                     FVTLLFLFSVRPSLHMMPQAASLFVQAKLAIDRMAAFLLARELDRSAVEHLAPSDLPR
                     PSHSPPPAVCITDGTFSWYPRSHAGQSAALRDITLRVEEGTLLAIVGGVGSGKSSLLA
                     AMLGLMEKVSGHVTIKGTVAYVTQNAWIQNLSLRDNILFGAEFNEGLYQRVVEACSLS
                     KDLEMLTDGDQVHQKLSFSLRPTSDQCLAGKNVFFVD"
     CDS             join(196696..196893,196969..197100,197171..197389,
                     197579..198055,198132..198150,198221..198288,
                     198375..198418,198495..198549,198693..199278,
                     199484..199725,199808..199967,200049..200161)
                     /codon_start=1
                     /gene="RvY_00074"
                     /gene_synonym="RvY_00074.3"
                     /locus_tag="RvY_00074-3"
                     /note="canalicular multispecific organic anion
                     transporter 1; MRP_assoc_pro"
                     /product="hypothetical protein"
                     /protein_id="GAU87185.1"
                     /transl_table=1
                     /translation="MLTADMQRITGFFFHQCYLWVTPISVVIMLLVLWAYVGVAALAG
                     LGTVGLLGVAQLFLVNRSRGQEAAAMRYKDIRQRTIGEIFNDIKILKMYAWEHHFAER
                     AIKMRRDEQDALYRASHYSNVNLAITFITPPLAALITYATYLYIDPNNVLNSRTAFVT
                     LLFLFSVRPSLHMMPQAASLFVQAKLAIDRMAAFLLARELDRSAVEHLAPSDLPRPSH
                     SPPPAVCITDGTFSWYPRSHAGQSAALRDITLRVEEGTLLAIVGGVGSGKSSLLAAML
                     GLMEKVSGHVTIKGTVAYVTQNAWIQNLSLRDNILFGAEFNEGLYQRVVEACSLSKDL
                     EMLTDGDQTEIGEKGINLSGGQKMRVTLARAVYADADIIILDDPLAAVDAHVGQHIFE
                     HVIGPNGMLQGKTRIFVTNAVNWLPQTDQVVHVEQGRICSIGRYEDLVETDELFRSYL
                     QDSQVDVSEAAGHHHHGANAALTQPTNHLAPYATEADADPRKATPIDGTELRTATKKR
                     HGKETTKLIGVEEFRDGGVTWQTYKLLARNMTYWMVAIVLVGYALGSAFFLVSNTWIG
                     TLTTHNYTLADGSVDQRYKGFGLAIYAVFILAQLIFVAFGLWGVSYGIIKAGRSLHNS
                     MLQRLIRSPMSYFDTTPLGRILNRFSKDIDTIDLTVPSYMRYFLNAFFLSMAFAFLIM
                     IEIPLTIVFVVPLMAALYLVKLFYQKTAMQLTRIDAMKRAPLISSLQQSFAGSNVIVA
                     TGNSNRFIAESHQKVDELTAVIHLSNGASQ"
     CDS             join(198187..198288,198375..198418,198495..198549,
                     198693..199278,199484..199725,199808..199967,
                     200049..200157,200234..200372,200470..200612,
                     200678..200783,200889..201047,201171..201452,
                     201523..201602,201678..201789)
                     /codon_start=1
                     /gene="RvY_00074"
                     /gene_synonym="RvY_00074.2"
                     /locus_tag="RvY_00074-2"
                     /note="putative ABC transporter C family member 7;
                     MRP_assoc_pro"
                     /product="hypothetical protein"
                     /protein_id="GAU87186.1"
                     /transl_table=1
                     /translation="MKTMVDFVFLKGINLSGGQKMRVTLARAVYADADIIILDDPLAA
                     VDAHVGQHIFEHVIGPNGMLQGKTRIFVTNAVNWLPQTDQVVHVEQGRICSIGRYEDL
                     VETDELFRSYLQDSQVDVSEAAGHHHHGANAALTQPTNHLAPYATEADADPRKATPID
                     GTELRTATKKRHGKETTKLIGVEEFRDGGVTWQTYKLLARNMTYWMVAIVLVGYALGS
                     AFFLVSNTWIGTLTTHNYTLADGSVDQRYKGFGLAIYAVFILAQLIFVAFGLWGVSYG
                     IIKAGRSLHNSMLQRLIRSPMSYFDTTPLGRILNRFSKDIDTIDLTVPSYMRYFLNAF
                     FLSMAFAFLIMIEIPLTIVFVVPLMAALYLVKLFYQKTAMQLTRIDAMKRAPLISSLQ
                     QSFAGSNVIVATGNSNRFIAESHQKVDELTAVIHLSNGASQWLAFNSLIITNILTTVV
                     GLLAVFGRDNLPFGKEAASVGLALTSTVAFNIIVQWLVQNLCDLEQSLLSTERIRDYS
                     DAPIEAPAVIPDNRPPPKWPYQGKITFTNYEARYRPGLDLVLRGVNVTIAPGEKIGVV
                     GRTASGKSSLTLALLRIIEPASGSISIDGTDISKIGLHDLRSRITIIPQESALFSGSL
                     RLNIDPTEEADDQQIWDALQSSRLKAFFQNSPHGLNTPISEGGSNLSVGQRQLMCLAR
                     ALLRRSKILILDEATAAIDFETDQFVQEVVRKEFADETVISIAHRIHTIMDCDRVLVM
                     DAGRIVEFDSPATLLDKHDSLFYQLAKTAGAI"
     CDS             join(198247..198288,198375..198418,198495..198549,
                     198693..199278,199484..199725,199808..199967,
                     200049..200157,200234..200372,200470..200612,
                     200678..200783,200889..201047,201171..201452,
                     201523..201602,201678..201789)
                     /codon_start=1
                     /gene="RvY_00074"
                     /gene_synonym="RvY_00074.4"
                     /locus_tag="RvY_00074-4"
                     /note="putative ABC transporter C family member 7;
                     MRP_assoc_pro"
                     /product="hypothetical protein"
                     /protein_id="GAU87187.1"
                     /transl_table=1
                     /translation="MRVTLARAVYADADIIILDDPLAAVDAHVGQHIFEHVIGPNGML
                     QGKTRIFVTNAVNWLPQTDQVVHVEQGRICSIGRYEDLVETDELFRSYLQDSQVDVSE
                     AAGHHHHGANAALTQPTNHLAPYATEADADPRKATPIDGTELRTATKKRHGKETTKLI
                     GVEEFRDGGVTWQTYKLLARNMTYWMVAIVLVGYALGSAFFLVSNTWIGTLTTHNYTL
                     ADGSVDQRYKGFGLAIYAVFILAQLIFVAFGLWGVSYGIIKAGRSLHNSMLQRLIRSP
                     MSYFDTTPLGRILNRFSKDIDTIDLTVPSYMRYFLNAFFLSMAFAFLIMIEIPLTIVF
                     VVPLMAALYLVKLFYQKTAMQLTRIDAMKRAPLISSLQQSFAGSNVIVATGNSNRFIA
                     ESHQKVDELTAVIHLSNGASQWLAFNSLIITNILTTVVGLLAVFGRDNLPFGKEAASV
                     GLALTSTVAFNIIVQWLVQNLCDLEQSLLSTERIRDYSDAPIEAPAVIPDNRPPPKWP
                     YQGKITFTNYEARYRPGLDLVLRGVNVTIAPGEKIGVVGRTASGKSSLTLALLRIIEP
                     ASGSISIDGTDISKIGLHDLRSRITIIPQESALFSGSLRLNIDPTEEADDQQIWDALQ
                     SSRLKAFFQNSPHGLNTPISEGGSNLSVGQRQLMCLARALLRRSKILILDEATAAIDF
                     ETDQFVQEVVRKEFADETVISIAHRIHTIMDCDRVLVMDAGRIVEFDSPATLLDKHDS
                     LFYQLAKTAGAI"
     CDS             complement(join(202295..202729,203230..203348,
                     204905..205096,205911..205944))
                     /codon_start=1
                     /gene="RvY_00075-1"
                     /gene_synonym="RvY_00075.1"
                     /locus_tag="RvY_00075"
                     /note="EGF_CA"
                     /product="hypothetical protein"
                     /protein_id="GAU87188.1"
                     /transl_table=1
                     /translation="MSSTPNSSQIVNCQGQEATVGPGGDAEAGPGGSAYGGPGGKAKA
                     GPNCVGVDGKGGTAIGGRPAGDDKVGGEARGAQDHTPDTVWTGVLTPVESLLPTKRIQ
                     KPLFSHLVPSYLMHGYACDCRRGYRGLWCNIDIDECAVEEPCANGATCINTIASYRCL
                     CQNGFRGPQCTELHFPCAENPCRKGGRCHPGSSVNVPHFCQCASGYSGSHCEANVDDC
                     VNHACQNGGICEDQVNGYTCDCARPYGGQYCVDDIGYEYIA"
     CDS             complement(206561..207184)
                     /codon_start=1
                     /gene="RvY_00076-1"
                     /gene_synonym="RvY_00076.1"
                     /locus_tag="RvY_00076"
                     /product="hypothetical protein"
                     /protein_id="GAU87189.1"
                     /transl_table=1
                     /translation="MAIFYGVRAFVFCLVVVATSAQNLLRCTYRENDRSTTCRGGTWP
                     AAGETPNIDAETTELGLWDIAFQKVNVAAIPSLPNLEKLSIAHSNWQAGEGTVKLPFK
                     ELIRNTNRPALLELGIESSRYGSVDEQEFAGFTSLRKLVMRNNTLSNSCEGLRGKSEF
                     LREPFCCFGNELDWQSGNDKLQLGVFAAAVLQASGKESSSTPAYITL"
     CDS             join(207563..207574,207766..208230)
                     /codon_start=1
                     /gene="RvY_00077-1"
                     /gene_synonym="RvY_00077.1"
                     /locus_tag="RvY_00077"
                     /product="hypothetical protein"
                     /protein_id="GAU87190.1"
                     /transl_table=1
                     /translation="MDEQVREEAVRIRLCQAKTDHFSHGYHLTLSAAGRSLCPLEATI
                     AYLQHLQATSQGQPFFVLGSGSFPTCQAVETTLRICLQDLRTSTGTPPSLRIGAGTTV
                     VRNGVSPQGTSHSADWPMDSDVTPASCYVFLNFLPPAKSVSIERENSPVSFCRFSL"
     CDS             complement(join(208474..210677,210816..211998))
                     /codon_start=1
                     /gene="RvY_00078-1"
                     /gene_synonym="RvY_00078.1"
                     /locus_tag="RvY_00078"
                     /product="hypothetical protein"
                     /protein_id="GAU87191.1"
                     /transl_table=1
                     /translation="MTKSPTKSAVIAASPTVIPPPTSVFKISLDLLILQLSNFNIFKI
                     REYGEWTIQVKVFLTPDKLVATSETLLLASLSAELDLHLPLSFDVLTFGDIDNLIHHP
                     LVVNFNEIEYIVKDAKKKTAPEEKVELIGQCFIDLLPFVTGETLVSKTLPIFPPSVDA
                     DSCTTFLPENAAVRLQVKSENGEPVIPKDYADSFNILRFRIDGCYSMPTAWLPTTPHT
                     GSHSLPTPTFTISTFLPTTVQHERYLILSNKVLQEDLSKEKFHHEGLIHWPVNPLFFA
                     KAVHMMEAPHQNGLGSGLNHTNKKKTEEGRGSGVIGQPSTVVRTEFRCVLAKDAEEAF
                     KTKAVAAKVWPVEVFSVTVPEKHTSTTKKKNAEVQNTAAEEAMITKHGVAFLDLSPLL
                     FPGAKHTEGRSPLLPYDVRSFTEKTGRKSVAQELFATPTAPSALPEFDKPTILSTSKQ
                     KPIDAHPSNISLRRSMAPSSATSHETPISPTASWREDVDQHLFITSQSYMSASITLLK
                     PLVPKKRIEKPEITVENIQSIHPKTLFPADNGLRAMQELRKEISSTCRLIYSLCEKES
                     RKHTDWAVVDSNVEAALHKAGETCYLRTHLKDFIVRIVRDRFYRTKSLDKEDPEQYND
                     FLSELYCDLVREISHSLTFHEEEKAKHPMKNKESQALHLRMLAIEAEIEEKLPKAEHY
                     LLLRIHKSTEAGKTSDEVAQYWVELGQFQLKHRKLREAVESFAESMKYDEQNVERMLL
                     IGYALFEEKKTDDALPFFEAAAVLSNSPIAYTALGLFYENLSVDSTGAIELIKERVYY
                     QANFLLGLPAERLKVYEKKIKDAESLMKGEVPSNLPRKTASLEKSQKILKDLLRPFCP
                     AKKSSSVKQETIRKNNGLFQPWKTLEYFDKKRRRKTFIKGGLLDNIFYVSLPAFASLG
                     LYRFATKCTAKLNGVCDVTSPTLWKAAMSSWISRKNFAEVRELMNELDKSDNGKNTRY
                     LVMKGHFSCRQKEYSQARECYDEALNQDVHSTEMYEVYCRYGLTTKEQKDWKKSKEMF
                     HLAAKLHGTALNWLGCGVASFHLEDFVNAEVALCQSNNLDNTVPETWAYLAMVYYRSC
                     QMSKAEKCLATALQCGLRECNEELMHEARTYIYSNKNKNW"
     CDS             212494..213231
                     /codon_start=1
                     /gene="RvY_00079-1"
                     /gene_synonym="RvY_00079.1"
                     /locus_tag="RvY_00079"
                     /product="hypothetical protein"
                     /protein_id="GAU87192.1"
                     /transl_table=1
                     /translation="MRRGRSYDPKGTPNPESSRAVDALLAKPMLLDLVSQFLHRSTRL
                     DSNSPISDVKFLSANDILDLLAPTIGCCYPLVEHTSVPTRERHRADHDKRHNGADQGR
                     SNSTRRGRPKVKKEKVATAKDVPSTSAQDSPPLDFAQLDKEGPTDGPSVKQLVELYGQ
                     TQEQNKRTAGEIVKLKQALLRDYAGVMTEHDLDLLIGNARHPLRKQTLVDSIQHLFAT
                     RRKNDYYNFQHHHNAFDTDSYKRMRNF"
     CDS             complement(214378..216534)
                     /codon_start=1
                     /gene="RvY_00080-1"
                     /gene_synonym="RvY_00080.1"
                     /locus_tag="RvY_00080"
                     /product="hypothetical protein"
                     /protein_id="GAU87193.1"
                     /transl_table=1
                     /translation="MSFDGLSDGTVNYNLPNVLSALCSSSPLGAQPDFGCSPLHRLFW
                     ILSQLYLSGNSLLNDSTTLGGADDLATWLEWNPLDLKWLSTSISQNASDMSLKFPAAE
                     TLQLKFGWNERVSVDTNSPLSTEHQPVVSEQQKVQIQIPAVGKALPTITIDGQSSPTI
                     FASISPSPLDGTVTSPNENSTKGILRTFADVVEFFGYLLRGFGLGWLFNIAVLLVTSM
                     VAVLALPHRATLSLASTVLYHTWNILTFAFQSFDIEFVLDGLQALTNSFLVLIRHLTS
                     FVVQVADISGLTLLLDMALSLLGWVSYFGADILHSVFSAGTVAVYKIAVVNGESFQSL
                     LDFITYFFRGIGLGWLIDGTSYVLKTFSTILSRASRNFFPLASDSDTVTPNFDFVNAV
                     KQQRGMKIVTSPTGATLNDDSELYVTNPSSLITIKYFAVLVISSIMLYWASTYKDSWQ
                     MITAQWNTIKDGMNKLIVKWKSERDRNAGNLADECEDSDSESLLDETGTMYDTDEELQ
                     VLRQDVLVSQPPDQTADINHYQPAQLEGRDTNEEMRLSVSNEVEHPSDRMQGFPFSQP
                     GPAVKQNEWRRFSRPSRTDSRSVPAAVPTDKPQTRSMILPVPDQQGGRTTDGQMPLVY
                     DSVSDLVHETSTFQQRLHEITDEELRSGSTEENPHRSAAEEILRGSFSSVLHDQVSKW
                     VTKLRFPSIADEDDSSTVWETSSYEIESSPRYSIPR"
     CDS             join(216901..217487,217789..218186,218728..219167)
                     /codon_start=1
                     /gene="RvY_00081"
                     /gene_synonym="RvY_00081.1"
                     /locus_tag="RvY_00081-1"
                     /product="hypothetical protein"
                     /protein_id="GAU87194.1"
                     /transl_table=1
                     /translation="MGNSFLCVFPRFISALFTTCDAPIAVPVAAKAAVGEAHDFFHLP
                     DMKLPDLNLQAIFGEYAKIIEQVWEKGPAMVSHYRKIVHDTWHTYTENHLKRFEMLPA
                     DDQRRFMNSGVDSAVVFLLLTTISRLILIRFLEPFLKQHFKPAAHHGFSLTYPQAKWL
                     FSTTLLFAIWHANSHYFFDLGAPVDLALLLGVGTALGAMVYRQSHSGKECLAFFALPV
                     LILLPVSITIAVMQHGPFVTQHRIFPFVMASVTAATALFFIFEAPPTPVHKGGTVQPF
                     GEALKQEIMHLVQNWRHAPVDLAASISPANIGKKAGRAGSKVSDFVHNQEDQGREVIR
                     VASPVVNSAVSGVYHFFENIFLFLLGLVYRFNKFLYYLYRLVVDGVLSGVKKIPGMGQ
                     YLQDHDVKGHHGQADGHGGAHHGGAAATAHAVEHTAGDGQTSEDQDESPKKRGKGGRS
                     RSGGLAKPNLSKRVSKSRSRSRNR"
     CDS             join(217775..218186,218728..219167)
                     /codon_start=1
                     /gene="RvY_00081"
                     /gene_synonym="RvY_00081.2"
                     /locus_tag="RvY_00081-2"
                     /product="hypothetical protein"
                     /protein_id="GAU87195.1"
                     /transl_table=1
                     /translation="MSFHRGAMVYRQSHSGKECLAFFALPVLILLPVSITIAVMQHGP
                     FVTQHRIFPFVMASVTAATALFFIFEAPPTPVHKGGTVQPFGEALKQEIMHLVQNWRH
                     APVDLAASISPANIGKKAGRAGSKVSDFVHNQEDQGREVIRVASPVVNSAVSGVYHFF
                     ENIFLFLLGLVYRFNKFLYYLYRLVVDGVLSGVKKIPGMGQYLQDHDVKGHHGQADGH
                     GGAHHGGAAATAHAVEHTAGDGQTSEDQDESPKKRGKGGRSRSGGLAKPNLSKRVSKS
                     RSRSRNR"
     CDS             join(217796..218186,218728..219167)
                     /codon_start=1
                     /gene="RvY_00081"
                     /gene_synonym="RvY_00081.3"
                     /locus_tag="RvY_00081-3"
                     /product="hypothetical protein"
                     /protein_id="GAU87196.1"
                     /transl_table=1
                     /translation="MVYRQSHSGKECLAFFALPVLILLPVSITIAVMQHGPFVTQHRI
                     FPFVMASVTAATALFFIFEAPPTPVHKGGTVQPFGEALKQEIMHLVQNWRHAPVDLAA
                     SISPANIGKKAGRAGSKVSDFVHNQEDQGREVIRVASPVVNSAVSGVYHFFENIFLFL
                     LGLVYRFNKFLYYLYRLVVDGVLSGVKKIPGMGQYLQDHDVKGHHGQADGHGGAHHGG
                     AAATAHAVEHTAGDGQTSEDQDESPKKRGKGGRSRSGGLAKPNLSKRVSKSRSRSRNR
                     "
     CDS             join(217892..218186,218728..219167)
                     /codon_start=1
                     /gene="RvY_00081"
                     /gene_synonym="RvY_00081.4"
                     /locus_tag="RvY_00081-4"
                     /product="hypothetical protein"
                     /protein_id="GAU87197.1"
                     /transl_table=1
                     /translation="MQHGPFVTQHRIFPFVMASVTAATALFFIFEAPPTPVHKGGTVQ
                     PFGEALKQEIMHLVQNWRHAPVDLAASISPANIGKKAGRAGSKVSDFVHNQEDQGREV
                     IRVASPVVNSAVSGVYHFFENIFLFLLGLVYRFNKFLYYLYRLVVDGVLSGVKKIPGM
                     GQYLQDHDVKGHHGQADGHGGAHHGGAAATAHAVEHTAGDGQTSEDQDESPKKRGKGG
                     RSRSGGLAKPNLSKRVSKSRSRSRNR"
     CDS             complement(join(219446..219570,219701..219937,
                     220157..220328,220400..220444,220510..220515))
                     /codon_start=1
                     /gene="RvY_00082-1"
                     /gene_synonym="RvY_00082.1"
                     /locus_tag="RvY_00082"
                     /note="putative dynein light chain 1, axonemal; DNAL1"
                     /product="hypothetical protein"
                     /protein_id="GAU87198.1"
                     /transl_table=1
                     /translation="MAKAGGGTSIKDALVKAEATAKEKNQEWSLKVIKLNGQMPPIDK
                     MDSTLNTLGECEYLSLSTNNIDRIASVGALKNLKILALGRNNIKSFSGIEALSETLEQ
                     LWISYNMIDKIKGLGGMKKLEILYMAYNLVKDWAEYSKLNEIQSLEEICFFGNPIHLT
                     FDNQDEWRTQASKRAPRLIKIDGKPTGAGPSTPE"
     CDS             complement(join(220824..220981,221089..221223,
                     221321..221438,221687..221962,222265..222366,
                     222466..222921,223437..223723,223994..224072))
                     /codon_start=1
                     /gene="RvY_00083-1"
                     /gene_synonym="RvY_00083.1"
                     /locus_tag="RvY_00083"
                     /note="putative 2,3-bisphosphoglycerate-independent
                     phosphoglycerate mutase; PRK05434"
                     /product="hypothetical protein"
                     /protein_id="GAU87199.1"
                     /transl_table=1
                     /translation="MAKNVKDDPRVCLIIIDGWGLSDEKNGNAIANAQTPVMTELSKD
                     KDRIVQLEASGLLVGLPRGLMGNSEVGHLNLGAGRVVYQDIVRINLDVENNRIDKNIE
                     FVKACERAKNAGGRLHLVGMVSDGGVHSHIEHLMSLIQACKTNQVPICYVQAFTDGRD
                     TSPTSAGRNERKERLIFVLCGNGFSPVDDPKTISTMTRRPNNGFDQEWSFPYVVGYLK
                     QLNDFMNKIEYGEIATVIGRYYAMDRDKRWERLKIAFDGLYKGVGELVDTPEDLFALI
                     EKRYALPDAQKQTDEFLTPIVLKGDNRIKGAHYIACMTQYNADWFFPLLYPPINTENT
                     LPEWLASKGATQFHCAETEKYAHVTFFLNGGKEKQVSGEVRALVDSPKVATYDLQPEM
                     SCNTVADKMVEAIGLEKYNLVLCNLAPPDMVGHTGIYLAAVKAVEATDAAIGKILEAC
                     KKHNYTILVTADHGNAEQMMDAEGKPHTAHTTNKVPFIIANSKRKFSLKAVKHPPALC
                     DVAPTLLDIMNMERPMEMGGQSLLDGGE"
     CDS             complement(join(224582..224732,224753..224828,
                     224898..225002,225059..225173,225273..225349,
                     225439..225586,225674..225789,225925..226055,
                     226149..226240,226372..226458,226550..226867,
                     226951..227060,227171..227241,227292..227478,
                     228050..228107))
                     /codon_start=1
                     /gene="RvY_00084-1"
                     /gene_synonym="RvY_00084.1"
                     /locus_tag="RvY_00084"
                     /product="hypothetical protein"
                     /protein_id="GAU87200.1"
                     /transl_table=1
                     /translation="MGGGAAGPTMDSQMPSSTEMAEIEERRMEAKQISRRLDEAYMRM
                     RKTDDTFELLVCHHGDLKHGECVVQYKSQVHLLKNNSIIRELTIENAKLLLIRDADQY
                     FIVGSYFNGRLRCPWHGACFNLVTGEIEEYPGIDGVPAFPVKVVKGSVIVEVDRRLLG
                     KAKVIPAMSKADKSNETIFVIVGGGKAFYMFPPTFTLQLRARPKQLTCILGPAALVAA
                     ETLRRKNFSGRIVIFAKEQIPTYDRPKLSKTLDVDQELLLLRDASHFKKYDIELMLDQ
                     EIVNIDTSDRTVTAKTKLMLRYDKLLICTGASPKKLDMQGRDLKDVCLLRTPDEANYI
                     AAAGKDKNIVIVGASFLALEVAAFMGYKAKSVAIVCRRNYPFENLLGRHIGKLLRQML
                     RDRGVTFYEASNVEMLEGSDKVQSVRIRNYKKNEVINVPADLVLVAIGTVPNTKCLLN
                     CGIELDEEGFINVDQFMRTNVERVFAAGDVATFPLSDSGLRAKVQHWSMAHSQGRIAA
                     LNMMSSGHLEPLRSVPYFWTTIFGKSIRYAGYCDNFDDVMISGDIQNGRWVAFYLNFL
                     TDEVDSACAVNRKDDVKAVATMNYDGVTSQFADLQMAGKFTTRADLL"
     CDS             join(231005..231089,231587..231969,232198..232501,
                     232563..232720,232780..232785)
                     /codon_start=1
                     /gene="RvY_00085-1"
                     /gene_synonym="RvY_00085.1"
                     /locus_tag="RvY_00085"
                     /note="LamG"
                     /product="hypothetical protein"
                     /protein_id="GAU87201.1"
                     /transl_table=1
                     /translation="MEKVDLDQQMYVGALSEAFSASTGINFPGFVGHIATIRVNYEEY
                     FLDDVEEPSVNPETNHPMYRHSVDMSEMDSLDLYPIFGGSDYTVFTCFNCKGQPDFQI
                     EVIIKPFDTSAGVIWSNFGHNPGSYVILYLYESTLILAVNLGAGKTWTTTEPIAIGAW
                     LTISVAILSKQVKLRINHERAYLLALEGDAFNASRAVHFAGGEANYWTLLYLATEQVK
                     GFRGILYSININKDDHNVLREVVTRETGRMVSLESSSIAARYDEFHEPPVSEVEFQCD
                     FSAHEEKLGVSGGIAFWLRESEMIQNFTGIAIQKA"
     CDS             complement(join(235087..235148,235231..235343,
                     235401..235638,236170..236272,236363..236524,
                     236659..236858,236920..237598))
                     /codon_start=1
                     /gene="RvY_00086"
                     /gene_synonym="RvY_00086.1"
                     /locus_tag="RvY_00086-1"
                     /note="protein inhibitor of activated STAT; PIAS"
                     /product="hypothetical protein"
                     /protein_id="GAU87202.1"
                     /transl_table=1
                     /translation="MLFRVAGMSEKSMSNAYRLLAGRGSGSTKSRSPMKAARPGRPKK
                     TKADPPASPVRRVRKPVARPRMVESESEEEKESDEEIPLAAALPPPPNRHLASLRPRQ
                     SSVPLQPQPPPAATKAGAEVRARASKEKTPDAVAEFRNRALAQKKENVKVEKLEKVVE
                     QVQKKKVARPAFNQAINDCDQRLYAVDPSAKVVLPSVIPRALIPQAALLPPLFYEPLK
                     VISPGVQTGTHPTMERRGVNRSILHSFSVDLEFPEATHVVLVRFARYAPMFTSPAVDV
                     NPDNLQITCNGNIVLKVENVNYGIAADKPLVAAPIELKKEFLRSSTNLATGRPISVNL
                     IVEYTVRQNDAEEDFIMHVELTRRRPTEELVREVQQRKLSIADGALRAFQILSPDDDD
                     GIMSGSSIVNLICPLSLKPLDIPVRGRECRHVECFSAASYLEANRFRKPKWTCPRCKI
                     SVPFEDLILDEFMTDVLAFTSKPTVDIVAEKDRLVVREKKVLKNMNTFVINDRPAAIN
                     RDHSIVILDD"
     CDS             complement(join(235087..235148,235231..235343,
                     235401..235638,236203..236272,236363..236524,
                     236659..236858,236920..237598))
                     /codon_start=1
                     /gene="RvY_00086"
                     /gene_synonym="RvY_00086.2"
                     /locus_tag="RvY_00086-2"
                     /note="zf-MIZ"
                     /product="hypothetical protein"
                     /protein_id="GAU87203.1"
                     /transl_table=1
                     /translation="MLFRVAGMSEKSMSNAYRLLAGRGSGSTKSRSPMKAARPGRPKK
                     TKADPPASPVRRVRKPVARPRMVESESEEEKESDEEIPLAAALPPPPNRHLASLRPRQ
                     SSVPLQPQPPPAATKAGAEVRARASKEKTPDAVAEFRNRALAQKKENVKVEKLEKVVE
                     QVQKKKVARPAFNQAINDCDQRLYAVDPSAKVVLPSVIPRALIPQAALLPPLFYEPLK
                     VISPGVQTGTHPTMERRGVNRSILHSFSVDLEFPEATHVVLVRFARYAPMFTSPAVDV
                     NPDNLQITCNGNIVLKVENVNYGIAADKPLVAAPIELKKEFLRSSTNLATGRPISVNL
                     IVEYTVRQNDAEEDFIMHVELTRRRPTEELVREVQQPFQILSPDDDDGIMSGSSIVNL
                     ICPLSLKPLDIPVRGRECRHVECFSAASYLEANRFRKPKWTCPRCKISVPFEDLILDE
                     FMTDVLAFTSKPTVDIVAEKDRLVVREKKVLKNMNTFVINDRPAAINRDHSIVILDD"
     CDS             join(238016..238694,238829..238956,239015..239311)
                     /codon_start=1
                     /gene="RvY_00087-1"
                     /gene_synonym="RvY_00087.1"
                     /locus_tag="RvY_00087"
                     /product="hypothetical protein"
                     /protein_id="GAU87204.1"
                     /transl_table=1
                     /translation="MMAKSEWEPEESFYDDSSNNGKIQTKSVKHLSTVDILPGTEFAK
                     GNPVLHSKTFQPTNELLQNQDYARKRDLIQHVVKSMVSRVQHHLDGSRISNVLTDMTA
                     HLRVALLLLVLLFCTDESKLQHIGDNIHRTLVLMRLQLALSNVIGSVQEKPNMPSEDA
                     SGKEISVGSFGSNSHLQHLGALKETFSTLCMYFRDTFDYRKFHTMEEIFAEKLAASKH
                     FIWIHRLEDRTDDTQHGIADKKAQAELEWTQRRFQEQMTKYQEIHGQLQAQVQTNQNI
                     IYRNLMEVKSLRHHFKQNADARQEDETKRHLAKMAKFTRIRGDTAAKMAKFTRIRGDT
                     DGKTADFEKVVAHFYSNDKSVICGISARICGGG"
     CDS             complement(239308..239589)
                     /codon_start=1
                     /gene="RvY_00088-1"
                     /gene_synonym="RvY_00088.1"
                     /locus_tag="RvY_00088"
                     /product="hypothetical protein"
                     /protein_id="GAU87205.1"
                     /transl_table=1
                     /translation="MESGICRLLAKTAFSASFSFSRNEDIVVAGYSDKQFHHVPGHVY
                     VHAQRTSASVAVPAANTCQHLCHLHPMCDYAQYLKQTNGALNMLCSLMN"
     CDS             complement(240873..241172)
                     /codon_start=1
                     /gene="RvY_00089-1"
                     /gene_synonym="RvY_00089.1"
                     /locus_tag="RvY_00089"
                     /product="hypothetical protein"
                     /protein_id="GAU87206.1"
                     /transl_table=1
                     /translation="MYDGRHFRNKSLCSAAEDVIQQVTYEAYAVRSTVLKVLIIAREL
                     SSFLYAAMKNEGRKCAGMLEEDILTVPSLASSSSSDCMWTYHKYYWIFVRAPMLR"
     CDS             complement(join(241712..241938,242187..242252,
                     242449..242761,243300..243578,244231..244764))
                     /codon_start=1
                     /gene="RvY_00090-1"
                     /gene_synonym="RvY_00090.1"
                     /locus_tag="RvY_00090"
                     /note="SMC_prok_B"
                     /product="hypothetical protein"
                     /protein_id="GAU87207.1"
                     /transl_table=1
                     /translation="MSVDPSVLRLTRGEVNLMRGMGWFESVHQNAATYLLRDVARRKN
                     FGYHGLFYFKDLLHHPRRHRFRNGVPGGQILHKRRNEDDSGDRWILTDWNENQLYMYD
                     SFVQKDPEIVGHLLVRVQGLIPGPRGTKITAFYPRVQQQSNGYDCGPHAIASAVEIVS
                     GNNNAASTNFNRDMIRSHICKIKNRLTDAKLELEERENKMEMEVQKAIGDLCRIQSEN
                     KELLHKRDCIRKEAPLIEQEWDQKLDAVRERREEANQRHRFNKDNKAYKVEEYHGRTA
                     KLKEAITAAQNEVDRAYCKLRAVDEVSESVKDIHRNVTHKHAKQAQIMEDMKAQTGNF
                     EKDATERNVRLNQKYRDKENEFEQAVRKAEKELAEAIEGLKKQETVYENFANEKATVE
                     RSADQVFIDAKNAEKLLIRVQNRLHDEKQKLADVEGRYKCVLKFKERLTAAGITPHLY
                     LDKIRQQIKDATMELEALRSGC"
     CDS             complement(244953..245237)
                     /codon_start=1
                     /gene="RvY_00091-1"
                     /gene_synonym="RvY_00091.1"
                     /locus_tag="RvY_00091"
                     /product="hypothetical protein"
                     /protein_id="GAU87208.1"
                     /transl_table=1
                     /translation="MSDLGPERFTRRLETFRTVTQQFIDDLENPTDDEEESAEGAENP
                     EEPNDAPEGQPLGSSGPSCLTGRLAQRKTGYGRKTLWLLCGETKLSRTSF"
     CDS             complement(join(246284..246376,246733..246963,
                     247034..247189,247427..247531))
                     /codon_start=1
                     /gene="RvY_00092-1"
                     /gene_synonym="RvY_00092.1"
                     /locus_tag="RvY_00092"
                     /product="hypothetical protein"
                     /protein_id="GAU87209.1"
                     /transl_table=1
                     /translation="MTKILDAKLYDKAKRIQNLGHLNDPVTDGNQQVIKISDEIDYMV
                     EKLSDLDALKQSKNKLTEEAATLQLQLDSLKSEDTWSKIRTDLDVAETLLKQTKEEHQ
                     GHLNNLDHRRTQLTDLYERLRDGQKEKEQVAQKIGENKMAIVEAFQESRDAHAAGLGI
                     KDKDQENITYEFVHMVVSVNTTTAANSLGDYADR"
     CDS             join(248201..248470,249009..249206,249390..249599,
                     249653..249868,250119..250748)
                     /codon_start=1
                     /gene="RvY_00093-1"
                     /gene_synonym="RvY_00093.1"
                     /locus_tag="RvY_00093"
                     /product="hypothetical protein"
                     /protein_id="GAU87210.1"
                     /transl_table=1
                     /translation="MNILTRLSSNSRAKEMENEEQCDLSECKPSITLVDSCGREFFTT
                     VTPRDMDLLIKYSILMRAKQEAAEESLYGPTKRKIREEKSKERKIKMEECSPEIPLPK
                     VRIAKKDLFFTYPTSKRVPKPNRKYLEIPGPIPIDEAGSPPHSSEWESVDLSTADIPP
                     RIRRTFLGTKIPDTSPAVKRGKYKTKKNGLRAERSSPEIPATSKPFTLLDSLRCDETL
                     DSPGNSQTLLAVFEDKELLDNGRHGMPPTSDDHNYATKISRTLKLSRRQAGHEDIPPP
                     LPNIRLPSIKIKIPKLKKMKLGKHPKVHPTDLTALLTQQNQKQKVVKEGRRGCRREYG
                     IEGFEQWCRHCQWKKACTRFGGRLGKIIHPEPGHVRIEEPVKPVTVADTKYPKRRMAD
                     ALSDRDRKKVRELKTSKVEQQRLETSPEAKPDVKPEVKPIMTICNTSLTPVPIAPNSA
                     ASKWLGFGMGYEVEEKEVIKTEMRPKEKQKIPLLIPLTLEPEVPTPSSISASSQDSS"
     CDS             complement(join(251862..252068,252147..252271,
                     252543..252614,252754..252817))
                     /codon_start=1
                     /gene="RvY_00094-1"
                     /gene_synonym="RvY_00094.1"
                     /locus_tag="RvY_00094"
                     /product="hypothetical protein"
                     /protein_id="GAU87211.1"
                     /transl_table=1
                     /translation="MPHLVIERKPSYPIAAKLTGPGPGGYMLPPSLGWDHHNLTLKRW
                     PEDTSCSPGPTAHVYPSKLINNGMAHVPGGPMGIRLPDLKKDGTPAPDAYDVIYHELH
                     SRYRAPAWEMGLAGLAAKINQNPAPNQYQIPKLTGARSPYIQNPPAYSMRQYV"
     CDS             complement(252842..253171)
                     /codon_start=1
                     /gene="RvY_00095-1"
                     /gene_synonym="RvY_00095.1"
                     /locus_tag="RvY_00095"
                     /product="hypothetical protein"
                     /protein_id="GAU87212.1"
                     /transl_table=1
                     /translation="MARLIVRLREVRFFDTSNISDSLSAEVRSPFSALQKLVEGHCWV
                     KKWMQSKECSMGCLVVRSTLFHHVNVVLASPIRINPSCWTRNVFGRRSIHISVGFLEL
                     VVLLTLH"
     CDS             complement(join(253341..253444,253528..253655,
                     253718..254061))
                     /codon_start=1
                     /gene="RvY_00096-1"
                     /gene_synonym="RvY_00096.1"
                     /locus_tag="RvY_00096"
                     /note="Sumo"
                     /product="hypothetical protein"
                     /protein_id="GAU87213.1"
                     /transl_table=1
                     /translation="MADTTMETPDMESIPLSLDTESMEKETAVGPKTPEPPTETESQP
                     ECRTPKKETEETRAVRKADVTASMDVEEQEDIKPDIENIKQEEPMDEEEMEEEAKPVR
                     KEKKPKKVIISVKVNSQENQQFIFKVTPQTPLEKIMDSYAQRTERPLKNLRFFYDGKR
                     LRTIDTPEMLEMEDNDSIDVTEEVLGGAGSF"
     CDS             join(254663..254975,255145..255326,255404..255542,
                     255925..256253,256316..256408,256689..256937)
                     /codon_start=1
                     /gene="RvY_00097-1"
                     /gene_synonym="RvY_00097.1"
                     /locus_tag="RvY_00097"
                     /product="hypothetical protein"
                     /protein_id="GAU87214.1"
                     /transl_table=1
                     /translation="MLSSAQPASHSTFTFWSLSDVLLFSLSSVFEMSHGSTEAESTSG
                     SEVSEMSEGRLQHVVEDGLVFNHTHRPAKPYPYVSEAEKNPDVGRGAVIIWDFDTASF
                     KAEHAEPVVSTLLRLCRDKVPRYIRHKPTILFCYTRKIRDLDYPGREQAITEVRRRIP
                     PHLAYVRTRTTEQKEGMEAYEARQELRAVIRFNIREFQNRSVPGPLMVIVSGDGDSVA
                     WHMKMKVTAAWETLFVIPHELLPFVWRATRQPTSSYTWDFHKGIVGENPKWGLAIGNG
                     SFLLPPPLYFSPDSWLTRGYQPTVFYIEEPWLEPVLWIPQPPVEQVSQKSSFVSYPYH
                     FLEYQPASSQPVHWTHAPSPSMMVMPAVPGFGQSSPMMVPTQGFSQSPPMVWASSPPC
                     PHWYEQPYQASLPSGDSSQQAPASWFGQSHQAPVLHHGGPAK"
     CDS             complement(join(257666..257940,258164..258487,
                     258936..259174,259235..259296,259396..259898,
                     260369..260783,261161..261460,261680..262358,
                     262645..263318))
                     /codon_start=1
                     /gene="RvY_00098-1"
                     /gene_synonym="RvY_00098.1"
                     /locus_tag="RvY_00098"
                     /note="putative RNA polymerase-associated protein CTR9
                     homolog; PEP_TPR_lipo"
                     /product="hypothetical protein"
                     /protein_id="GAU87215.1"
                     /transl_table=1
                     /translation="MAHNNTFDIQPPPDYWKKDFLSETMMAVPIKNSSDVVEIYLDNL
                     PHKNDLVEVIQNEEPPIKIANVLALHCHARGNEDIFIDILSEAYKQIQRYPNNETPDR
                     PDAAFCMDLMANYYTIELTKDKYSEKEKKEMFTKAMRLYSNVDQLMVTSLYHLIGRAY
                     FCLLDPEKLDQAATQFDYVLKSFPNDYLALQGRGLMAFQKADYKKALVCFKNILRAHP
                     DCSPEIRMAIGHCLFKLGRHERARLAYERALQLDSICTGAMVGLALIFLNENTDASVQ
                     TAMQHIVRVYKIDQMQPINLNLLAEHFFYRRETNKALPLAMMAIQKSKSEHLKAESVY
                     IAGKCHHYDGNYDQAFQFYYQATQFAKPSFVLPHYGLGQMYLQRNDIANAMLSFEKVL
                     AVSPNNVETLKILGILYLQTGTKEKKNQAKNYLKRVCEARPDDIDAHIKFAELQETLD
                     PEGALNTYRRVIEIYRERDTLNDVIPPELLNNVSVLDFQLGKIEESRKYLDWAIARAE
                     AEQEKLSAENEHHYKWIQTTMLYNKGRLAEAEKDHDEAQRCYKGIVVDHPNYVDCYLR
                     VGCLSRDRGNILEASDWFKEAGSVSPDHPDSHLLLGNLHMSKGEYGPAQKKYEKVLSN
                     QKSKNDTYALLSLANIWLETLYTPIDPEKKKRHSERAFQLYKQVLKIDPSNVYAVNGM
                     GAVLAHTRQLEEAKEMFSVVRESTADILDLWINIGNLYCDQRQFIAGIKMYENALKRF
                     PTAALDPQVFLYLARAQCLNGDLSAARKTLQQARVLAPQNQQLRFNLGLVLHKMAVNT
                     LKDFRSSKEVKGAKEDLQTAQAIFDFLSTEGDKAVVDMHRAAKLAKLCNDYLTQAQNA
                     EVRATQVDEEDRLLKEKIEQARLEYQQRQAEEQQMLMEEKMRQQEELRRKREEVLAKT
                     AEVKERIMKQETEPEVKVKSRAKKRAAMEDELFIDDEGNYTTEAVGPDGQPRAKRLRA
                     DGGSRRGEKKRARRERRERERESGMIYSSGGEEDGEAGAAETTRAPREPEYDRKGRKY
                     KTKAIISDTESSSSSDDEDGSGKSPDKDGDKSDNEGQRSRKPARKGLISSDEEDDKAE
                     KKDKSEDEEGEDQKQLPKKTKALRSDDEEDMEVDDDQKMKKKEGDEDDEEEATAGRRP
                     KLSINDSDDE"
     CDS             complement(join(264948..265182,265272..265468))
                     /codon_start=1
                     /gene="RvY_00099-1"
                     /gene_synonym="RvY_00099.1"
                     /locus_tag="RvY_00099"
                     /product="hypothetical protein"
                     /protein_id="GAU87216.1"
                     /transl_table=1
                     /translation="MAARMNIFAPYLGRMSLEVRDAPGLVECQETHLAAMASAKLQDI
                     LAALLEEILHSIDFIKLLKMRRVSSTWKAEISRESAPFLRQYCEEKESGFNVWQYAKQ
                     VRTIFLFEDPTNYGQSNEDHSRTMTRDRDCSLELESKFPPG"
     CDS             265792..265992
                     /codon_start=1
                     /gene="RvY_00100-1"
                     /gene_synonym="RvY_00100.1"
                     /locus_tag="RvY_00100"
                     /product="hypothetical protein"
                     /protein_id="GAU87217.1"
                     /transl_table=1
                     /translation="MAARMNIFAPYLGRMSLEVRDAPGLVECQETHLAAMASAKLQDI
                     LAALLEEILHSIDFIKLLKMRR"
     CDS             complement(join(266127..266257,266324..266441))
                     /codon_start=1
                     /gene="RvY_00101-1"
                     /gene_synonym="RvY_00101.1"
                     /locus_tag="RvY_00101"
                     /product="hypothetical protein"
                     /protein_id="GAU87218.1"
                     /transl_table=1
                     /translation="MDPVNPFSILKLLQSDYEQYFQLSDPPSEFNRMLKTFIKDVQID
                     LAGNTIPPKGTGHIQPLDVLRFDRRVAQLRMLLVVRLQ"
     CDS             join(267544..267705,267890..268178,268239..268447)
                     /codon_start=1
                     /gene="RvY_00102-1"
                     /gene_synonym="RvY_00102.1"
                     /locus_tag="RvY_00102"
                     /product="hypothetical protein"
                     /protein_id="GAU87219.1"
                     /transl_table=1
                     /translation="MLLLYALLLVFFAGTEQACPLKCSCQLEAVIDCRDMALTSLGGE
                     DGVIDGSIRTILARDNSLRHVSVSLLLMSYPKLKLLVLTTNADLECPSQQPEVAIVGC
                     LYSSTNVAQTTTAAPTTRSTTSIKTNAINPYINESGVDNVSQASEAPQNPTWKVTVYV
                     AVGVVASVIFVAAFVGAVYFACRKFRKDQPLEFYSPRSLVNPNAVYASRLDETDSIES
                     E"
     CDS             join(269392..269487,269964..270547,270635..270700,
                     270792..270915)
                     /codon_start=1
                     /gene="RvY_00103-1"
                     /gene_synonym="RvY_00103.1"
                     /locus_tag="RvY_00103"
                     /product="hypothetical protein"
                     /protein_id="GAU87220.1"
                     /transl_table=1
                     /translation="MAQTYNAIAVYNPEQPQVDRLKLCDTRNVLFTGLMAQLKLGESR
                     GRRLHYLCEAGNAETDIDGRGNVRFTKQGFKVTSFELDMHQMGAFMAGIIERRDFSES
                     TQGSLSPHRVWKRERDFFNQQQGFNQPQQRNFNQQLQQVNYQPTQQTFNRQPGNDERE
                     PPCVGRQVVQTYNQTQGFIQQHGQGFPAPPMLPPILFCSRKEDQRDKKTDMLIEIKKE
                     PLEIENISPPNTSKPQPPPATANANGIGDKKLVDEFELSGPRLIRTVGPKRKNGFDNE
                     NAEVKITAKKTKK"
     CDS             join(271679..271790,272070..272579,272682..272710)
                     /codon_start=1
                     /gene="RvY_00104-1"
                     /gene_synonym="RvY_00104.1"
                     /locus_tag="RvY_00104"
                     /product="hypothetical protein"
                     /protein_id="GAU87221.1"
                     /transl_table=1
                     /translation="MNNSPHFPKLAAFLYDAGHFDAVTKPHRIVGKDARCGVGFEFVN
                     NPAQHACARACSRCHQFECSSRQNPQPCTITCKDCRNKFSAEDCYQNHLRCIVRCDAK
                     KEAKSTCHAYERCADCYSFIRAPGRPRSDPYDCDAQYCSVCKKFVSHGHRCYMKTGSA
                     AIPKRTLVATSKKSYAAGEEHGVEDLVFGAEDFLPDGQAQPPAARTRGHHDQRTFT"
     CDS             join(272744..272892,273799..274066)
                     /codon_start=1
                     /gene="RvY_00105-1"
                     /gene_synonym="RvY_00105.1"
                     /locus_tag="RvY_00105"
                     /product="hypothetical protein"
                     /protein_id="GAU87222.1"
                     /transl_table=1
                     /translation="MHSPNCLDFICLEDPTITETFYGAECHMQFLDWVFENCTNCTFL
                     AHNTSRVAREIRLNAKYIIVFRGASDSEPLLRLGHQLFPRRPKYFEEAVDYCMAKDNG
                     YLIIQLYPNIADDERLMTDIFGENPYKSTVVFKAIN"
     CDS             complement(join(274652..274743,275256..275601))
                     /codon_start=1
                     /gene="RvY_00106-1"
                     /gene_synonym="RvY_00106.1"
                     /locus_tag="RvY_00106"
                     /product="hypothetical protein"
                     /protein_id="GAU87223.1"
                     /transl_table=1
                     /translation="MNTFELWDALHHDPHGKDKTAGVFPRDYLAKIRKRRYPFGVIIN
                     TSKASDRDGGTHWVAVWIQSGKEAEFFDSFGKTAIFYGAEIHDFITRMAPQCEGKYKE
                     DYTQLQHPSSDLCVDYIGQVGSGPHGFVDDWLHCVGNVHADLP"
     CDS             complement(join(275607..275700,275853..276583,
                     276979..277262,277898..278018))
                     /codon_start=1
                     /gene="RvY_00107-1"
                     /gene_synonym="RvY_00107.1"
                     /locus_tag="RvY_00107"
                     /product="hypothetical protein"
                     /protein_id="GAU87224.1"
                     /transl_table=1
                     /translation="MSLVSIQCPERIATFPKDGDERNVVFRMKDGKSYQKVTPQGKSA
                     LCDVVGGRDFAASAIHRTGKAVIRGLMGIARQTGSGRKRRAKKAKPVVVGITKRKRKR
                     KSVAEKAVSKKKPRKSSKKKASRKKKTNKKARGLANFANYAEALLGYGPPSKEQLELQ
                     GIHLDTAGSHDTTVTTPTNAAMTNSRLRNRYNQLKGDQTCKLRSRFPSELAKQPLLIR
                     NRMDIKLILHRAKAASYMMSEEEALGLKLILTSAQLKIRKIKMDPEFLVAHEILLAKR
                     NALIFFEGKNVLELTINAGVMSFARDDLFRGIISKKVILALVDSAAIAGHYKKNPLKV
                     ESVSLSQVGFIVNGENLPSRPLQFTPGNGFERDGYLSLLETTGLILARNHDAHLYRDS
                     ILEIDQRRNPFLPYKHV"
     CDS             complement(join(278392..278823,279726..279894,
                     279964..279977))
                     /codon_start=1
                     /gene="RvY_00108-1"
                     /gene_synonym="RvY_00108.1"
                     /locus_tag="RvY_00108"
                     /product="hypothetical protein"
                     /protein_id="GAU87225.1"
                     /transl_table=1
                     /translation="MANYLNSPAVIDCRDRGLHPLKLENATFDKRVYHILAAYNYLRQ
                     INYTDLLHHYPNLNILDSDQGTEFYNDRFQQYMRQKNIEHFSKLGSETKAAIVERFHR
                     AITERLYRYFLLVGNKRYVEVLQSFVDSYNETPHKTLSFVAPNNVTENNKEEIKNAVY
                     GTHKVTYAFRRSSKEKFVPEQLVRVSLQKKSFEKGFLRGWSSEV"
     CDS             join(280451..280812,280875..281148)
                     /codon_start=1
                     /gene="RvY_00109-1"
                     /gene_synonym="RvY_00109.1"
                     /locus_tag="RvY_00109"
                     /product="hypothetical protein"
                     /protein_id="GAU87226.1"
                     /transl_table=1
                     /translation="MDWNMQSLVEVASQRCSKQSKIGLVVSRLFEPDAEEATSIQCAD
                     TFGKSTAYVEIGKQDFFQVTEDDLLVGEASGKVFTSSLVDLFIRNASPLPGILIFNLC
                     NGIKSCYGLSTLLAQLLKRFDPDNKQALQDAKPENIRRFVASAHPVVALLRHYYDETM
                     KDHKASMQRILYAEDTAGYDSDGYHDYNYGYPQPWEEEYRSNYERAFAHKN"
     CDS             complement(283235..283516)
                     /codon_start=1
                     /gene="RvY_00110-1"
                     /gene_synonym="RvY_00110.1"
                     /locus_tag="RvY_00110"
                     /product="hypothetical protein"
                     /protein_id="GAU87227.1"
                     /transl_table=1
                     /translation="MRLQYNKQECTQNFEERSQTLNDEQREFVLSIQRKLDDEQGGLI
                     FLNRPAGRGKTYASNCLLNYVRGEGQTALAWASSAIAAMNYPSGRKNCT"
     CDS             complement(284503..284844)
                     /codon_start=1
                     /gene="RvY_00111-1"
                     /gene_synonym="RvY_00111.1"
                     /locus_tag="RvY_00111"
                     /product="hypothetical protein"
                     /protein_id="GAU87228.1"
                     /transl_table=1
                     /translation="MRICHRDLKPQNILLQIKRKTPPGRTPCRDIVLKLADLGWSKSF
                     QEMVRSTTAYVGTCTYMAPEVVRPPQQYTHKADIWSFGDTLYASLAGLKDMHNLASSH
                     KHWSIRKTGER"
     CDS             complement(286467..>287072)
                     /codon_start=1
                     /gene="RvY_00112-1"
                     /gene_synonym="RvY_00112.1"
                     /locus_tag="RvY_00112"
                     /product="hypothetical protein"
                     /protein_id="GAU87229.1"
                     /transl_table=1
                     /translation="LLYLAYAKTRTWTGLLDPRIWISPEFELGIWTAYPSIAEKQQEN
                     QISFFSFKDNLQRKTPHDLCDYIDIITNHESRSTADHTLDNAMAEWRPPGVVNHWLDD
                     IRPWTAVGFRGFLRCTYISIPLARYPPLQFSYQGKQMCEGLLPLFGDLRTSSPDTEYK
                     SKRNPDTVLQRLSCHCEMKVRLELEWAAASPITGAADCNFE"
     CDS             complement(289444..290079)
                     /codon_start=1
                     /gene="RvY_00113-1"
                     /gene_synonym="RvY_00113.1"
                     /locus_tag="RvY_00113"
                     /product="hypothetical protein"
                     /protein_id="GAU87230.1"
                     /transl_table=1
                     /translation="MKEVVFPRLKEFARLHGYDTVVIVLDNASYHSRLMLQFRRPKRV
                     KKETQQWLTDHRIEFGARELLAELWQKATDFLKNHVGDRYYMDDYLKTEEGIETVRLP
                     PYRCDFNPIEKGWARRKGYVAKQNTTSKLPDLIKLWEESADIFEPEDFSKLFAHCIKL
                     EDDYWDIDTKEDRIEAVGDEQADEDVAEEGGDLEPLDQDLDDDNDLALLPF"
     CDS             complement(join(290445..290684,290703..291257))
                     /codon_start=1
                     /gene="RvY_00114-1"
                     /gene_synonym="RvY_00114.1"
                     /locus_tag="RvY_00114"
                     /product="hypothetical protein"
                     /protein_id="GAU87231.1"
                     /transl_table=1
                     /translation="MSSSSSLYPVDVRHIAHLWKVLGPSFSGSNKYTLTTLAGRRKAI
                     AHLCQRSPRTIQNITTNWDLITGPPSGTAVESNTVPEDDVNETLDPVVEAEEMEGVAG
                     VGRHLLKESEYRKIRAKFTGSTRLHVTVESLLPLVEEEVGVKVAKSTIYRVLRRMGFR
                     YRDRSTKHLFGDPSLKVRRIRYIRAKTALIAFLDETWLNENYQFRKSWIELDKEKSTG
                     TAEILCEDCGQSHPSGSGKRRVIFDVVTNRGFVPGCGLIWEAHKAH"
     CDS             292923..293144
                     /codon_start=1
                     /gene="RvY_00115-1"
                     /gene_synonym="RvY_00115.1"
                     /locus_tag="RvY_00115"
                     /product="hypothetical protein"
                     /protein_id="GAU87232.1"
                     /transl_table=1
                     /translation="MRTLFAAAPEVLMVDVAYNIVSALLMGQEAAEYRGNRSRDEDCD
                     AVNIRLDLRRVTTEFTVVLANRPIVGWSA"
     CDS             join(293904..294098,294191..294631)
                     /codon_start=1
                     /gene="RvY_00116-1"
                     /gene_synonym="RvY_00116.1"
                     /locus_tag="RvY_00116"
                     /note="ras-related protein Rab-1A; Rab1_Ypt1"
                     /product="hypothetical protein"
                     /protein_id="GAU87233.1"
                     /transl_table=1
                     /translation="MSALASDDYDYLVKLLLIGDSGVGKSCLLLRFADDAYNESYIST
                     IGVDFKIRTIKLEDKTIKMQIWDTAGQERFRTIVSSYYRGAHGIIVVYDVTESLTFQN
                     IRHWFDEIDRYAYENVNKLIVGNKSDLFTRRTVDFQVAKDLTDTLRVPYIETSAKAST
                     NVEEAFILMAKEIERRVCSHQTDGLPRSLKMVEGTVLTPAVGKPASLGGCC"
     CDS             complement(join(294814..295065,295127..295527,
                     295666..295879,296644..296730))
                     /codon_start=1
                     /gene="RvY_00117-1"
                     /gene_synonym="RvY_00117.1"
                     /locus_tag="RvY_00117"
                     /note="connective tissue growth factor; CTGF"
                     /product="hypothetical protein"
                     /protein_id="GAU87234.1"
                     /transl_table=1
                     /translation="MDLFCFLFFCIVYPSAYGQSSNSLLKDSQSPSSENDKTLSCPKS
                     CHKVCRAYPEKCPDGVSLVEDLCGCGCYHCARQDGDECSALDSCEIGLHCSRGTCRAS
                     HPKSCEVNGNIYQDGESWKPDCQTVCQCVDGVYGCSDVCLPDKKPSECEYGRQLVVES
                     ECCSRWVCQQEVIPCSNITLDWTDCSCAVPISHQWTNRNPDCQWTVQQRSCPTKGCTD
                     LEKARFVQATVDDITNARRSCSNTMYHRYAFIEEDNCKSTHLVHQRTCARECRLPPPD
                     GRKLCCLPNEFESKSVRLRCANKKVVLRTIAMIAGCSCDLC"
     CDS             <296840..297223
                     /codon_start=1
                     /gene="RvY_00118-1"
                     /gene_synonym="RvY_00118.1"
                     /locus_tag="RvY_00118"
                     /product="hypothetical protein"
                     /protein_id="GAU87235.1"
                     /transl_table=1
                     /translation="LKIWPSSSRRKYVYTTPQGRSHSIFHARVISKNKFTLTSIISSS
                     NLASGQYQSIRRVAKPDMIPSIRKCDRSTVQPQGKCQSRWRKSSYINTGFHRGSHQQR
                     STAATGIEQITHCASAVHYAVPFRI"
     CDS             297582..297806
                     /codon_start=1
                     /gene="RvY_00119-1"
                     /gene_synonym="RvY_00119.1"
                     /locus_tag="RvY_00119"
                     /product="hypothetical protein"
                     /protein_id="GAU87236.1"
                     /transl_table=1
                     /translation="MDPRNKKRDNETFVVRMKCLVSIPSYSADFPVRKQVALEMWALF
                     WSHERQPAAQQDMLMYSGGNEIAAGIHKSF"
     CDS             complement(298798..299691)
                     /codon_start=1
                     /gene="RvY_00121-1"
                     /gene_synonym="RvY_00121.1"
                     /locus_tag="RvY_00121"
                     /product="hypothetical protein"
                     /protein_id="GAU87237.1"
                     /transl_table=1
                     /translation="MFRRRASSLLSPWIRTMKESQISSPEVVSCLSRQLSSFPFSRSS
                     MRFYSFSSSLWKGHSHWQNIQATKGKNDFERSLVMASISRQLRFAVRKNGSADPKKNS
                     DLAKIMEEAKKLNLPNDSIERVIAKMVGKKIELLTMEAKGPGGALMILEVMTDNPKRT
                     QGELRGILNRNMGAMVDGGGIMFNFDHKTVVTAVHDKGEDVEVDVDKAEEAAIEAGAE
                     EILGGAAPGIVRFVCDPMEASKVAKALEKLGYSVTSSESEYFPKMPVELPPEAAIQMA
                     KLKGKIEDHADFHNLFLNCVV"
     CDS             join(300667..300669,300729..300857,300920..301002,
                     301068..301131)
                     /codon_start=1
                     /gene="RvY_00120-2"
                     /gene_synonym="RvY_00120.2"
                     /locus_tag="RvY_00120"
                     /note="putative 60S ribosomal protein L37a; RP-L37Ae"
                     /product="hypothetical protein"
                     /protein_id="GAU87238.1"
                     /transl_table=1
                     /translation="MAKRTKKVGITGKWGTRYGASLRKTAKKLEITQHSKYTCLFCGK
                     DAMRRSCVGIWSCRRCRKTVAGGAYVYATTAAATVRSTIRRLRELKDI"
     CDS             complement(join(301694..302136,302352..302613,
                     302772..302843,302904..303071))
                     /codon_start=1
                     /gene="RvY_00122-1"
                     /gene_synonym="RvY_00122.1"
                     /locus_tag="RvY_00122"
                     /product="hypothetical protein"
                     /protein_id="GAU87239.1"
                     /transl_table=1
                     /translation="MAVVNDRAWNKKRKYDPEDEIAFLRKKLDEERAKRRSLEGDIYR
                     LKLERSDLCIKMSKLEASKISPNIPSSFIPLLSDAIGRGLDPSKFTAQTDQSLRVVQQ
                     AAQLQAQAAQRSLQLMQANEAKRTHSAAKPSISSAPRPVGRPPGSTSSPARKVTFTPD
                     RPGSRSIVMPKSAPAKAGTAVNVANVQTLPVGTIVTAVPAGSPAGTPGQQFMVQSKVE
                     NGKKVSFLVPVQQVNVAPEAAPKIIEPVVDLTAEEDDMMAKINSQASENLAVAEPEVS
                     TETPAEGETAKEEEHESPASPEERAVTEPTTSAAAAAE"
     CDS             302947..303348
                     /codon_start=1
                     /gene="RvY_00123"
                     /gene_synonym="RvY_00123.1"
                     /locus_tag="RvY_00123-1"
                     /product="hypothetical protein"
                     /protein_id="GAU87240.1"
                     /transl_table=1
                     /translation="MSPSNDRRFARSSSSFFRKKAISSSGSYLRFLFQARSFTTAILT
                     ILETRIGTSGMTGKEEIFDTAKWRILPVTAAHHAACRRGAGRYLPRSQPQKSFLQPRA
                     VFGGSDADGDVSQFGSSFSGCFPNFDLKSQS"
     CDS             join(303275..303503,303677..303750)
                     /codon_start=1
                     /gene="RvY_00123"
                     /gene_synonym="RvY_00123.2"
                     /locus_tag="RvY_00123-2"
                     /product="hypothetical protein"
                     /protein_id="GAU87241.1"
                     /transl_table=1
                     /translation="MVTSASSVRVFLAVFPTSISNLSPDSWKKLLFSCAANSEHSLAC
                     CGIWRKKIAVYDSIPDHCLLLLIRLIQLMKQAGVFGYILLRWSTSQNESRCSSLCP"
     CDS             join(305404..305773,306120..306263,306407..306660,
                     306957..307219,307285..307457,307727..308008,
                     308070..308243,308376..308501,308774..309114)
                     /codon_start=1
                     /gene="RvY_00124-1"
                     /gene_synonym="RvY_00124.1"
                     /locus_tag="RvY_00124"
                     /note="2A0113"
                     /product="hypothetical protein"
                     /protein_id="GAU87242.1"
                     /transl_table=1
                     /translation="MHVHGSNQVSPKAARRPSDVNRPISKSHDHLNVEAFESPTLGLR
                     HPSLSKSMHSVKAAASQLVAPDGGFGWVVVFGSFLVHVVMDGITYSFGALLPHLLDKF
                     QAGEASTGAVGSTLFGVTLVVGPAVAALVNRFGCRSVTVVGGLVATIGCVLSVFSPNI
                     TFMLVFFGIVTGLGAGLIYLPAIVSVTQWFEKRRSFATGIAVCGSGLGTFAFPPLTEM
                     LIEQYNWNGALLIIAGIVFNNCVFGMLFRPVEYDHTVTVVNATESPQDELGELPNLRI
                     DSHSRMKKISTGSMDDKYGTGSTDADRSLISAKSDTHIHVEQRRTSRSNSIKMGSRGK
                     LNGLHSSSIRLTEVKQDGSVTDVAKVGLQSPFTRKDTLYTGSLSTIPLYREDPTKYKS
                     SMLDLSKATVVDAKGSPSKLQIDETAAPRKTGVRGWCSRISTVFTEMMDPVLLTDWIF
                     LWFSISNFFTSIAFQVPYIFLIDRAEKEYHIEKSMAAWLVSAIGIGNIFGRLGFGLLS
                     DFKWVNRLALYNVAVTVAGVAMFVSVWCRTFVTLAIFAAVFGIFIGAFVTLTPVILVD
                     LFGLERLTNAFGILLLFQGIASFVGPPIAGYLKEVTGDYDSAFLVFGLMMAASGAMLF
                     FIPCLRTLQVKCTGRQPVTSAPTAVVYTAPKVASHNGKPLPEETRLLDEHGQVTLPDE
                     AMPDLVLPSIQINDRRASATPGAVVA"
     CDS             309768..309953
                     /codon_start=1
                     /gene="RvY_00125-1"
                     /gene_synonym="RvY_00125.1"
                     /locus_tag="RvY_00125"
                     /product="hypothetical protein"
                     /protein_id="GAU87243.1"
                     /transl_table=1
                     /translation="MRTRGEGVCGQALSVEQPVEDLFGYAQITAKQRKEGDESHLVLW
                     ITEYLGLADYWADKLEP"
     CDS             complement(join(311646..311681,312226..312549))
                     /codon_start=1
                     /gene="RvY_00126-1"
                     /gene_synonym="RvY_00126.1"
                     /locus_tag="RvY_00126"
                     /product="hypothetical protein"
                     /protein_id="GAU87244.1"
                     /transl_table=1
                     /translation="MDLTGLTAVVVVAGLSAVLSGFFQLLVIHSIVNMLFNMFVSAVF
                     VAENTSTAGTCILYLYLFQEEPPKKTPTSVVRAFPSAEFDRKGKEKEGSGFFATQYWP
                     MDASTDVIAFNIPVLPR"
     CDS             complement(312566..313258)
                     /codon_start=1
                     /gene="RvY_00127-1"
                     /gene_synonym="RvY_00127.1"
                     /locus_tag="RvY_00127"
                     /product="hypothetical protein"
                     /protein_id="GAU87245.1"
                     /transl_table=1
                     /translation="MPTACRNAYIVQKSGGAHECEDRSHLYCWHQCMLENSSVEGGLV
                     TEDCACNADFGQNITELSLPWQCYNPDGRDCSWYRDCLERKHPCSGDHASYAIDYGEK
                     FCLMYNDRFELFSAEAQQWIDGVRKCLQVALVPLIRPYYSGSCEDIKRQAFASHAPCY
                     LRPGYGAPSICGLSCSDWMTAFWTVKGSLVTDFFGTLTGMVKVARGCAGYALECGWRS
                     YKNTVSLALRFF"
     CDS             complement(316178..316924)
                     /codon_start=1
                     /gene="RvY_00128"
                     /gene_synonym="RvY_00128.1"
                     /locus_tag="RvY_00128-1"
                     /product="hypothetical protein"
                     /protein_id="GAU87246.1"
                     /transl_table=1
                     /translation="MWRTPFNSTYHYKIFPAMENEIGRIGRRVCAYNYTTKSIMADFR
                     VLAECSVLVENIMNKPGTSEQVVRCARNVLGLTNTIFYSKTSSGCCKLVGRPEENTKM
                     IRRFVEAIGVEIGQDWTSKDIYTFNKAVIENGIQVRTHKHNEKYCRNESIVMDSSGTV
                     IAVKHVVAAVDVEAEKVCGTFVFGEALTRTHTNISGNSSVKVNHIFKLERSRDLVLIN
                     TADITKHLVILEEQDNLFTVSPPSNIFRVT"
     CDS             complement(316863..317366)
                     /codon_start=1
                     /gene="RvY_00128"
                     /gene_synonym="RvY_00128.2"
                     /locus_tag="RvY_00128-2"
                     /product="hypothetical protein"
                     /protein_id="GAU87247.1"
                     /transl_table=1
                     /translation="MVDAFAIDVMHMMDEGVARWFLSQIVEGRGRLRLTAAEIKEIDR
                     RWIHIIVPGHESRSTRSISHFKMQAHELRFFLQHGAPYTTKDIVPEKFHSILYHASSI
                     AWLATRDVITEVDLSRIERHSDLFLRKFQRFFGEANMKFSIHLMQHVAHTIQLHVPLQ
                     NISCYGK"
     CDS             complement(join(317664..318565,318660..318894))
                     /codon_start=1
                     /gene="RvY_00129-1"
                     /gene_synonym="RvY_00129.1"
                     /locus_tag="RvY_00129"
                     /product="hypothetical protein"
                     /protein_id="GAU87248.1"
                     /transl_table=1
                     /translation="MDKDHRISRLKAKRGAAKKRNAMDDMVQVPAGSSKRPRFHQAEE
                     VSLQHDDQPDEEDLNLDASFIDTVCHDETEQPSAGTSLSEFFREDEAGWTMDQVASLL
                     LYVAKSTGTSNATLDKFLKVIALIADGKRSQADPKKHRKFPKSTKSLKTMLNLQKNGK
                     QQVVYICPYQRPVRNKRNEQWETDLCGYFLKEVGDGNYKSCHCDLCETVWTRKEVEKD
                     GNLFIINPVRRFIQETMDKYGCQIDPSDQERHGNLRDVADGMRSEQMGIPSDAIKLAI
                     HANSGDFSKSTNKKMYLVFVQVLNLPVRIRRCVWHLVAVWVGENLPSDRESFLLNLTT
                     QLRDLDENSESFQPVVWTDTFGTVHTSRFAGKNCVKWSPGALLL"
     CDS             join(322095..322413,322498..322561,322644..322801,
                     323029..323054)
                     /codon_start=1
                     /gene="RvY_00130-1"
                     /gene_synonym="RvY_00130.1"
                     /locus_tag="RvY_00130"
                     /product="hypothetical protein"
                     /protein_id="GAU87249.1"
                     /transl_table=1
                     /translation="MFQIVARVNFNGLLTLPLIFALRLDIAFPNYFGFDSFNSLSNIG
                     PALDSGLAYLQRKYPYINWTSTYLIARGDTCQDEKTEVSDLVAEWYYRRKQERANLRI
                     IVTGGCLAVNDVNYLAANWNILMITSGGTPVFDSLELRVAASPRYPTLLTTSFYATNY
                     AELYFELFRSFKWTTLYFITGFHHTKNF"
     CDS             complement(join(328270..328623,328981..329151,
                     329236..330084,330324..331028))
                     /codon_start=1
                     /gene="RvY_00131-1"
                     /gene_synonym="RvY_00131.1"
                     /locus_tag="RvY_00131"
                     /product="hypothetical protein"
                     /protein_id="GAU87250.1"
                     /transl_table=1
                     /translation="MFKFFSNLAHSASELLAPNLRPEEELFLQWHNLVKELKLRKGAN
                     IPVDDTDVPLRLQWIFNLIQQDTPDCIVSSISAPNDSLTISPCLEFVMRYKVFDWLVA
                     LAKTDKPAGIKSYVLFFLTNFVRTPSTIQIIPKSFMYKPLSRLIMACGRSSCSPWDRE
                     EMAFLRAVVDVLAKDQCLANLFLHNAPHDAVDRTESDVRSVDLPDCILPENEDQNRYI
                     NVENSRKERKRSSSSFTLNGENNTSDSFTFPLLTSLLRSVLNPDPVVSAQAREATIQL
                     LRCREPVVCHCIAQSRLLEDALLPHFSKLYSCIPATLEAVDVLLRHDFGDLQHVVKSF
                     VRWVVFLDQIITSAEPALTSSFLNSFYIELTSRTPCSFQQDWLCDIPARNDLSVAVFL
                     KMYRISESLSMLETLSNILLNDCFFQKYLIFIQDREMRVIAFDLLNAMVQKPTLVFVE
                     KTMLQFLDSRLYIRKDQRIHDTMWNTNMAEATDRADMFRILFPTSAKSCTVMEEDRDN
                     QNYLRESYYSIEWLNQRCTNLKWPTFGPIPACNVLLAEESAFFDGQPFNEGPLLRVLF
                     HYLSNLFVQPYLLNLRVTGILSKLCLIPHPTLGEYLLDPTVPLAPQSTSLYRSLVSLV
                     QKMDEYARHTPGFRDKIVTTRQLIRDNQWSQLEKDDENVMLCAVVTLEEFCKELAART
                     FVRFNSSLHV"
     CDS             join(332529..332616,332686..332751,332838..332935,
                     333001..333257,333516..334014)
                     /codon_start=1
                     /gene="RvY_00132-1"
                     /gene_synonym="RvY_00132.1"
                     /locus_tag="RvY_00132"
                     /note="astacin; K08076"
                     /product="hypothetical protein"
                     /protein_id="GAU87251.1"
                     /transl_table=1
                     /translation="MWHESLLYIFPLISYSYSLPIFPSPANYEENIQEFFPTRSKSSF
                     PFRSFYEESFSELFPTANDLILTDGDVTEGDILDLDLDALVSASAPAGPDVGKVSRGR
                     SRRKRNAVAFGFFRWPNGVIPFTLDEAYNRTERTHILQAMNEFHGKTCLHFVPREQQA
                     DYLSVIKFRGCASKIGRQGGRQPLFLNQECIDPKRPGIVMHELMHSLGFLHEQTRHDR
                     DDYIDVLWNNIAPDHQDNFAKVDKRLVSIYDAPYDYGSVMHYGPNFFAVNYTNPTIVP
                     KKPTKVLGQRVRLSDADAEKINKLYNCYRNDEGKANSDSLTAQINSQWSDVLRRLSAS
                     V"
     CDS             complement(join(334106..334424,334626..334723,
                     334905..334997))
                     /codon_start=1
                     /gene="RvY_00133-1"
                     /gene_synonym="RvY_00133.1"
                     /locus_tag="RvY_00133"
                     /product="hypothetical protein"
                     /protein_id="GAU87252.1"
                     /transl_table=1
                     /translation="MPEFKEEFHHGRFRLTIYFRRKSDERPVVFKSDGERFPQPLTVK
                     FQQEETYTVTLTTNPAVQIEYFTIHEQKVELTEEIKKSDIDQNTVTYHGEWKTESFPC
                     TKRCHREQLKLFIQFKNHRTFLTSLQSKFYALQDCNHSSWGESMTAVQYVCDLEPGYI
                     ITIVKQHVL"
     CDS             join(337469..337579,337844..337879)
                     /codon_start=1
                     /gene="RvY_00134-1"
                     /gene_synonym="RvY_00134.1"
                     /locus_tag="RvY_00134"
                     /product="hypothetical protein"
                     /protein_id="GAU87253.1"
                     /transl_table=1
                     /translation="MLGPDAERRADAVQVFGPNQFCLCGDTTCNTRPLILTISQLDKS
                     DREQ"
     CDS             complement(join(337934..338246,339030..339127,
                     339322..339396))
                     /codon_start=1
                     /gene="RvY_00135-1"
                     /gene_synonym="RvY_00135.1"
                     /locus_tag="RvY_00135"
                     /product="hypothetical protein"
                     /protein_id="GAU87254.1"
                     /transl_table=1
                     /translation="MAAGKSVRITLSFKRESDGLPVVFKSDGKRFESQLTVKFQQDET
                     YRVEITVRPPLPVDSLRIQEEKIDLEQITKFIDPNALSYGGLWKTTGMGQTEKNKRTF
                     LKLSVSLWKSGTFTTSLQTKFYPHADVQHARWGDKLNFVEYECIIGSDSTITTTKQQI
                     A"
     CDS             join(341488..341578,341844..342102,342180..342282,
                     342513..342845)
                     /codon_start=1
                     /gene="RvY_00136-1"
                     /gene_synonym="RvY_00136.1"
                     /locus_tag="RvY_00136"
                     /product="hypothetical protein"
                     /protein_id="GAU87255.1"
                     /transl_table=1
                     /translation="MCDPYVEGDVRIGIQRPRMGKNKAITARNVVISQWQTFDQKKQL
                     LKYKGEGRKRDAAATNRAALDAKITTAKAWNRFCMSHRESKLFFFMPEHTVYSFQERR
                     KVRIPDLPLKSPPSPDDVTRLLCHDYARQWLLKESADQQHRINVEQIDKRIVGAQQNA
                     QIESNYVADQSSLKEKQERVRQFGKMRPLGKITPPKYVQKATTHLATFRDGDTRKRGW
                     RPSIQQPPEGQSLEQWKSALQASAASKFGREKKEGPSVTFDDL"
     CDS             complement(342872..343282)
                     /codon_start=1
                     /gene="RvY_00137"
                     /gene_synonym="RvY_00137.2"
                     /locus_tag="RvY_00137-2"
                     /product="hypothetical protein"
                     /protein_id="GAU87256.1"
                     /transl_table=1
                     /translation="MLLGRKRTLVRTRRRKKASRTTRRTSLMAIPRRKVRGMRRRTRK
                     RIRRMTRRRAKETRRREVRRRKLDLDRRSSIRSRKPSKPPRKPSVENCRNPYNFFRLL
                     WAFFSVLSLLVEQFSLMFFELLRLFSFFCGVIFF"
     CDS             complement(join(343005..343361,343509..343708,
                     343837..344035))
                     /codon_start=1
                     /gene="RvY_00137"
                     /gene_synonym="RvY_00137.1"
                     /locus_tag="RvY_00137-1"
                     /product="hypothetical protein"
                     /protein_id="GAU87257.1"
                     /transl_table=1
                     /translation="MDLSSESYSAWKYPAISSFNAVNGHSTTLISILKLRVTFIGVSL
                     SLHPVSPRLLHGIVLIDLSVNAVFAVTFQRKMAQSKTVFVTLIVLGLVSGLLADVPET
                     IKETAKKVMEEAVKKAGQVVGGAQDAFDAAQETAKEHWTDAPHTVKDAADSIKNKVKD
                     AVGAEKDAGKDKKKEEGKSDDKKDKSDGDSKKKGQGDEKKDKKEDKKDDKKKGEGDEK
                     KGGQKEEAGFGQKVVDKVQETFEAAKKAVSGEL"
     CDS             343866..344015
                     /codon_start=1
                     /gene="RvY_00138-1"
                     /gene_synonym="RvY_00138.1"
                     /locus_tag="RvY_00138"
                     /product="hypothetical protein"
                     /protein_id="GAU87258.1"
                     /transl_table=1
                     /translation="MPWSNRGDTGCKLSDTPIKVTLNFKIDISVVEWPFTALKLEMAG
                     YFHAE"
     CDS             complement(join(344523..344695,345450..345754,
                     345962..346220,347344..347726,348097..348269))
                     /codon_start=1
                     /gene="RvY_00139-1"
                     /gene_synonym="RvY_00139.1"
                     /locus_tag="RvY_00139"
                     /product="hypothetical protein"
                     /protein_id="GAU87259.1"
                     /transl_table=1
                     /translation="MEFPLPEAKRRKTVGSGLTGNAVGESTEFTAQWADIHFDLALDI
                     FRHFTTLQRFGYRSQIQLVILDNLLYNRGHILRDIRDADCFSGSLGCGPKLGAGRSVI
                     LSNLQMDWDLYSYAWDPASHGTLIKTLPTTKLTCGLAGDFAFFDPTFDSWKKVAWPYP
                     SDQLQWVEDCLRRLMKRLRISEVSDGDDSGRNVTTDNFFTSLALGEALLKKNISLIGT
                     IRKSRPEIPSAFLPSKYREVHSSLFGHTSDFTLVSYVPKKGKAVTLLSSMHLDADIDE
                     SSKEEKPEIVMEYNRTKAGVDTLDQLTGNYSCRRKTSRWPMALFYDILDISALDAYII
                     WCEINPGWNSTLPTKRRMFLQDVSKKMMQRQLLRRSTTPTDDKQSISYSLLDGAHGIA
                     LMSQQEREAVKEGKLVLFEREVYCRLLGKIVTFHTLMM"
     assembly_gap    346351..346400
                     /estimated_length=50
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     CDS             join(349319..349618,349758..349955,350045..350261,
                     350566..350732)
                     /codon_start=1
                     /gene="RvY_00140-1"
                     /gene_synonym="RvY_00140.1"
                     /locus_tag="RvY_00140"
                     /product="hypothetical protein"
                     /protein_id="GAU87260.1"
                     /transl_table=1
                     /translation="MPGEAVVVVIDSDDSPEIEVESTKKVTAKELKKLADARVANDFF
                     TAFYNNPLTERSLKTGRKITLHKGRCKLCRKEKVVCSQEGYSNFKNHVINEHYKETKE
                     DSSTKTKIDGLLEPKKPAYPRNHPKQRLLDLNVARIQVETLICPDILGHSSFDRAIKG
                     ADSALNWPKRDTITGRLLPSIYKKLETKVLDLLKSATAIAINCDIWSSKRQRGYFGVS
                     AHYIDENFKPQHVLLACPRFNTDMEDVFHRVIYGDEELKLEPIDAEDLDTSSPLAEEV
                     AEKLIQRYELMPTEKSW"
     CDS             351031..351633
                     /codon_start=1
                     /gene="RvY_00141-1"
                     /gene_synonym="RvY_00141.1"
                     /locus_tag="RvY_00141"
                     /product="hypothetical protein"
                     /protein_id="GAU87261.1"
                     /transl_table=1
                     /translation="MAERAIKLDWTAAGLDLKHRLSREHQNILEDFVEMTRPFEEAFE
                     TLQRNGVPAICQVLPLIYGLRIFLQGMLDGDQFLILHGYAEELLKQLNVGFSSLENDD
                     LFLAAAFLDPAIKFSFTHGAENPEAVKSRTQAIVLEMMRRVELTRPPPEFRSEEPKVK
                     RSKLFSFMDKEPRSSVSSRRDYFGSQCRNGVSAVSGFQMG"
     CDS             join(352938..353111,353288..353710,353949..354342,
                     354569..355029)
                     /codon_start=1
                     /gene="RvY_00142-1"
                     /gene_synonym="RvY_00142.1"
                     /locus_tag="RvY_00142"
                     /product="hypothetical protein"
                     /protein_id="GAU87262.1"
                     /transl_table=1
                     /translation="MKKLLLSRNKASPEDIPAVERKPEPLPDFRQAAFSSCRHFLEDD
                     SLDSSSRFTPSRKPKLHEMFPSPCSMVDYDSDTFFPSSPSVAAVTPAKPAVLLPANPT
                     TPPAEPVQITPIPQKMKKVRRKKRSRILPDGVTLEQLAAFSASTSTPPEWAAHFKKAD
                     FGTDYTLRPRTERPRYDLQSEEAVVDTPGCQNRKKPKLKDGLVSPKPTTKRRAVYSRG
                     PGRKVQRTTSSERAEEDVRARLELPAKMQKLISAASLANGVHCICSSSLDIGPQIECE
                     KCGLWQHMFCMNMFGKDTDGYVCNHCNQSLAKKPYNPEEALKAFSAYASSLPVTKDEK
                     DEQEDKPKELKDQKVLINEAKVEKVDKVLISKAPKRALSNLRRKPGRPARTDSLLKTK
                     SIPSVLRGASVETAMTSEPETPPVMKERISYGRSDEAAPETFNQVFELKKQINLKIVQ
                     KRNKSPLLTANPLPEFNSIVIDKESSHPPKNVS"
     CDS             complement(join(355287..355509,355800..356727,
                     356878..357061,358134..358805,359276..359461))
                     /codon_start=1
                     /gene="RvY_00143-1"
                     /gene_synonym="RvY_00143.1"
                     /locus_tag="RvY_00143"
                     /product="hypothetical protein"
                     /protein_id="GAU87263.1"
                     /transl_table=1
                     /translation="MIKSLFAPHKAGLGASLNAGLRDDNAISLVEMVIIEGAFQQAVA
                     KLKWLLPFRHPDEGEWRRRKNLAPTHAITCACIRYSRNKLLDLICAGLVEYDLPESTR
                     FHTLRKFINDHAEQVQKEKEAVVFVNEKRTDAQDNLEEIKQAVDEASNQLQANMESYR
                     LHERQVDNEVYETDARVAVELEYTDDFTEHQLQYMAFCRDVEEKALYERRLTVSRKYE
                     FSKLMFKASKDLYKEMADEEQTLYQRRLAIVTEEAKKLQGQLDVELKNQEELENDVSR
                     VKNAIEHHLENVGFFNKLLRTNQCLGELVRIAPEESGKLLQEKVRVKWEQLQEVIRKK
                     MDDMQSEETHRIRVMQLLRRQRLEVAMRQLKIHYLKEQQKRGDDMETFKETLKTKFIH
                     EMEQKTKSIDDLRASIRLLHFEVEEKSRLDKRLRESSNVPEAERLDGLIAATEEKITA
                     LINETQVINDKNMVIQNEIEDEEATIFRLGLSKAEMEDWLKIEDISFEEQMVRLKYRI
                     VETKAQQEQAKVLLDAAWKEVAEKNKVKPVSAFMEQDLEHVASKCEQAVETVKNLRQD
                     AEAKAQQWNKKLKDLENAVKEIRKEMFQATYSLKISQQQALYKAKNPMILTGLITQGE
                     AKDSEKNPHRMLFQQSIPGKVRRSTIKPLREKPKTNFVSRAESIEEVIKLAQAAQEGP
                     DLDEGEVLAVLFSKESVIDKLVGEVESIEERIDDEVDPKESPEAIHGH"
     assembly_gap    357141..358094
                     /estimated_length=954
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     CDS             complement(join(359676..359967,360236..360387,
                     360467..360718,360906..361201,361264..361371,
                     361443..361525,361594..361883,362379..362564))
                     /codon_start=1
                     /gene="RvY_00144-1"
                     /gene_synonym="RvY_00144.1"
                     /locus_tag="RvY_00144"
                     /product="hypothetical protein"
                     /protein_id="GAU87264.1"
                     /transl_table=1
                     /translation="MPHRSVPACCCHVPATDGQAGKTHSPPKAKSSYASNNVLLNAME
                     LTRFSAQSGRVMVNCGRLMRDQDKEMRSVQGEFRYAADQVALKKQRTTESRLLAVQRK
                     HNKLKKSAHEAQYSVHNGMKERQVFHEAYKRVQAQYAHNAKILQDMLNQINDMNEKRA
                     DYLKKAAQNRNASNDMRDELVAKIRTAEQMANVERETRILSVHRAVDRTPYWKSESVN
                     QAIESFWQTPVAPQVTMEKTLHLEETMTRIRHICNVENMSDVIDLYKKREENNELLAE
                     RLRDLNKEAEALVDKLEHHHQALRALDDRAADFESTAERKMMLLLERTRTMEENGRNC
                     RESLEAFKAFYDQVGATMTAVHQVMFKLIPHSSDIKASAEPCNGQNYREYQRSFAILA
                     HHFHAAFDYWKQQEHERKSRTDPSYRGTDDDDNPLTIKEGRLAKSDYPVTAKLQLLPK
                     NLRVYSKRNEFENADGTAAVMSVRSMDEFAKREAIDLLQAQTEYLDALNQREGAGKFP
                     NQPDGGDEIDMSPTVEIPKMVASNEMTTQTDDELDINEDYTLTD"
     CDS             complement(join(364657..364867,364923..365101))
                     /codon_start=1
                     /gene="RvY_00145-1"
                     /gene_synonym="RvY_00145.1"
                     /locus_tag="RvY_00145"
                     /product="hypothetical protein"
                     /protein_id="GAU87265.1"
                     /transl_table=1
                     /translation="MNFEPLFDEEADIGQLNPYAPAEIQRMKDELKHNKARARMLRFE
                     LERKRRFRATEEAKQRKKEDELKAQVANLEKIRHNMETKANDVRRENEMREIGELLMQ
                     LTNMEEKVAAARKSTMGDVSKVSTNGT"
     CDS             complement(join(365435..365567,365642..365976,
                     366323..366558,366627..366807))
                     /codon_start=1
                     /gene="RvY_00146-1"
                     /gene_synonym="RvY_00146.1"
                     /locus_tag="RvY_00146"
                     /note="putative photoreceptor-specific nuclear receptor;
                     NR2E3"
                     /product="hypothetical protein"
                     /protein_id="GAU87266.1"
                     /transl_table=1
                     /translation="MYFLAVQNERQPRNSATIRYDMVEDRNLLDGTVAAAFYPVPPSS
                     NISSSTSAFRSTGIANCCKSPGSSSLASSYSAGQHSSTSSPAESSTSHLPTPSLVPFF
                     SVGMESVMYEAAARLLYQSVKWAKSLPYFVSLPFRDQITLLEESWSELFIMCAMQWSF
                     PLGGYHLMGHSPDRGGATSGPTELRALTDAYNRFKGLTVDPNEFAYLKAIVLLKPAAK
                     GLKEPQQVESLQDQAQVMLSQYEKLHHAAQPARFGKLLLLLHNLHEIPTERVESLFFA
                     RLIGNTPMEKILCDMYKS"
     CDS             join(371299..371646,371864..371980)
                     /codon_start=1
                     /gene="RvY_00147"
                     /gene_synonym="RvY_00147.1"
                     /locus_tag="RvY_00147-1"
                     /product="hypothetical protein"
                     /protein_id="GAU87267.1"
                     /transl_table=1
                     /translation="MNDLLIPLFSKLFAMVPDVALWSRGFLCQVPRNNLLWFYRKNVD
                     FVASNVVLSQLLKIPFNVDFSHGCCSGMGVRRSSCQWQDKHWTNPPARAEHVGCNQTR
                     STARYRNMDRNNSPESAIRKLHVLPEDRRTEDGRMSATVSVAIPSGSLHHTP"
     CDS             join(371480..371646,371864..372137)
                     /codon_start=1
                     /gene="RvY_00147"
                     /gene_synonym="RvY_00147.2"
                     /locus_tag="RvY_00147-2"
                     /product="hypothetical protein"
                     /protein_id="GAU87268.1"
                     /transl_table=1
                     /translation="MSISAMGVVQGWVFGAARVNGKINIGQIHRQGLNMLAVIKQGQQ
                     PDTGIWTATTVRNRRYESYMCYQKIEGRKTGGCQPLYPSRFHPVAYTTLRDMRMLIAS
                     SIDAADSTIDELKHYPQKYVDLVTVQADDLKNPTEQYRSSVTPV"
     CDS             join(373630..373931,374011..374238,375744..376209)
                     /codon_start=1
                     /gene="RvY_00148-1"
                     /gene_synonym="RvY_00148.1"
                     /locus_tag="RvY_00148"
                     /product="hypothetical protein"
                     /protein_id="GAU87269.1"
                     /transl_table=1
                     /translation="MKIFPRTWPEQDIVLEEVGYYSAYSELAGDNFEMRKDRSLLRQR
                     AIPSPPDGIVPIHRRLQHVPAAELEAPPAPFQGDEAMVCLNRWLGLRVPDLNLQSFWQ
                     EVELITTNRILSQIMKIPYSTDTHGSNEWAFGAASVRGKIFVGYISREGFCYLSQNVP
                     VQDQQAQDRAWTETSHRLGPLFNEYLVDMFNAIETDRLDFRHKQQKRVVRKSDLKRIR
                     RDETVSAEGSLQPGRTYLTSDFLGSPRHQQKLVADALAIVKSFGKPTYSITMSCNPKW
                     EEIIRELLPKQTAADRPDITARVFHGKLSQLFELLPRAGYLGMYATGQRSATTYY"
     CDS             complement(join(377555..377670,377877..377975,
                     378072..378134,378264..378468,378498..378695,
                     378827..379098,379179..379284,379549..379581))
                     /codon_start=1
                     /gene="RvY_00149-1"
                     /gene_synonym="RvY_00149.1"
                     /locus_tag="RvY_00149"
                     /product="hypothetical protein"
                     /protein_id="GAU87270.1"
                     /transl_table=1
                     /translation="MTINHVDTVNDARKRKRRDYRTSDPESSAVLPNYFKTVLKNTQD
                     GGYWGLCHYDDGSYYLLPPTSISADIILPQYRFIDAFKGKEIMAVGMKVRVDWDTAHP
                     VGKATVISVDTDQARMNMLFTTLEQTAKEQAAKNKKKNVKPKASHRMKHSARTENVRV
                     KRSALNRSRLNKAGAARLSDSEKDTAPDSDSDDEHAPGPKKAPSGMESFVNEESETEG
                     SQMSNLLTRVMFPAAQSTEREGVNESGEEEEQIDAADFDDDTYNIDKDPDNRKRGGFG
                     DVDDEGDSIDGSRSLQGGGTLSADDTPSYSEEELAEFRAKRDEHRKEFQMPSVNWSFL
                     PKDTRAVDRRVFQRMDIHGSKISSVFAAN"
     CDS             join(379615..379731,379748..379880,379957..380025,
                     380205..380533)
                     /codon_start=1
                     /gene="RvY_00150-1"
                     /gene_synonym="RvY_00150.1"
                     /locus_tag="RvY_00150"
                     /product="hypothetical protein"
                     /protein_id="GAU87271.1"
                     /transl_table=1
                     /translation="MEYQKNTRISRLKAKCAAAAKRQKNRPGQPRSQATAIERLSPAR
                     VDQELSEEGEEEEGNDAVNTTIDSSVGQLDMDRTIEGIKNIPELVSMVSDDPNDGWTL
                     NQVCMYICPYQRQVRKKTNETWETELCGYVLREVGEGKHCLYHCDLCDTDWERKIVEK
                     DGNHFVINPIRNIAEEALHKYGKLVDPRQERVPGILRDVTDGSRFQQMDIPSKWT"
     CDS             380702..380923
                     /codon_start=1
                     /gene="RvY_00151-1"
                     /gene_synonym="RvY_00151.1"
                     /locus_tag="RvY_00151"
                     /product="hypothetical protein"
                     /protein_id="GAU87272.1"
                     /transl_table=1
                     /translation="MNLTLQLQELDENSNTFLPIHWIDAFGEEHYSPGYVHGFLSDSP
                     ERTAINGHLSHSAARDVSRVCRLVTRPKK"
     CDS             join(381158..381464,381529..381939,382412..382506)
                     /codon_start=1
                     /gene="RvY_00152-1"
                     /gene_synonym="RvY_00152.1"
                     /locus_tag="RvY_00152"
                     /product="hypothetical protein"
                     /protein_id="GAU87273.1"
                     /transl_table=1
                     /translation="MDAVNAFFIDVMHMFDEGLSRWFLRQIVEGGEVLNLRKSEIKQI
                     DTLWLSIAVPGHESRKTRSIAQYKKMKAHEVRFFIQHGAPYVTKDIVPEDFHTILCLA
                     KCAVMVEELVSNESVPQLVTRTARSIMGMTESILYARGPSGICRLIVNPEKIPSKRIS
                     QAVMAYADHHGFIWADDKIHLFKRAVVEAEIPVRTRKHNEASCRNESIVFERTGKVIA
                     VKHIVAILSVDTGSVLQTLVFAITCALHEQDTGEPHSNTRHYAYWNFYQTDL"
     assembly_gap    384065..386127
                     /estimated_length=2063
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     CDS             join(389479..389637,390517..390835,390898..391322,
                     391395..391577)
                     /codon_start=1
                     /gene="RvY_00153-1"
                     /gene_synonym="RvY_00153.1"
                     /locus_tag="RvY_00153"
                     /product="hypothetical protein"
                     /protein_id="GAU87274.1"
                     /transl_table=1
                     /translation="MATQPKCDAACNKGVSPFVTTNGMEGDGGDGTSITLYHPPSPTG
                     DGGRSPSTRSVVVGDGGLLAGAINREIMVGLDLEGRQNTGEAFANSDGLLHLQEVQDS
                     GLPTCVLTLSKEQSVDYLYGPLTVKELRVLQGANVKEVRLRGYMRMLLVRRYNRLTPG
                     QVVRLHYNNEEYSGVVRWKCDLPENVYDIEPEWALVLIHLSSKYAGRGSNDGVIDKRR
                     YFACRKNSAMLIPLTCVITGNGDSPPSLFGKSPTVDGIESSSEVNPRALEECLDCVDP
                     SLLRALKKSYRHRHIPAEHLKRKRKELIKQTKARSGAQAVTRASYPVTFIPVPKELIQ
                     AYGMDRYQRNVARVQKVTGVCACSYDP"
     CDS             complement(join(393719..394042,394110..394394,
                     396851..397696))
                     /codon_start=1
                     /gene="RvY_00154-1"
                     /gene_synonym="RvY_00154.1"
                     /locus_tag="RvY_00154"
                     /product="hypothetical protein"
                     /protein_id="GAU87275.1"
                     /transl_table=1
                     /translation="MNTNDTFGSVVNNGTSTKDACEPISFSLSSSQRWAVFTLGIPQT
                     VLTITLNILILLTFVVNSSLRKAQHYNFLNLALCDLVIACVALPSRLTLDLYGCWPVP
                     QAFCRLYKLLDWIATSEAASTVILIAVTRYRMITRGAVYQTEETSRKVLGRIFLTWAV
                     NIFLYGPVQFVDIYTGVRITGTGQCNTEFFQFPWLGNLLVVTNNIIPPVVVIIIYLMM
                     FLALRQDIRMVANTAPSVAVTKGSRAAKRGKELMLLTAGFLLTSCPVGIISVVKFAVD
                     SLSVHRSKHSDSFAHRQFTSTNPRTGTGIQLLDWITTSEAAFPVILIAVTRYRMMTRG
                     TVYNQEEASRKVISQIILTWITNILLYGPVQFVDKYTRISITGNILPPVIVVVIYAFV
                     FHALRARTNKIAANPSNAQSAASSTRPKENRAAKEGRAMMLLTASFLLTSCPNGTISI
                     AMFADNSLTIFQSLPVSPLPALLQQPDEYNCLHQ"
     CDS             complement(join(398686..399026,399739..399784))
                     /codon_start=1
                     /gene="RvY_00155-1"
                     /gene_synonym="RvY_00155.1"
                     /locus_tag="RvY_00155"
                     /product="hypothetical protein"
                     /protein_id="GAU87276.1"
                     /transl_table=1
                     /translation="MFSDQIAARIHRAQTLRLPPYRCDFNPIEKGWARRKGYVAKQNT
                     TSKLPDLIKLWEESADIFEPEDFSKLFAHCIKLEDDYWDIDTKEDRIEAVGDEQADED
                     VAEEGGDLEPLDQDLDDDNDLALLPF"
     assembly_gap    399051..399100
                     /estimated_length=50
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     CDS             complement(join(401748..402149,402685..402780))
                     /codon_start=1
                     /gene="RvY_00156-1"
                     /gene_synonym="RvY_00156.1"
                     /locus_tag="RvY_00156"
                     /note="STKc_MAPKKK"
                     /product="hypothetical protein"
                     /protein_id="GAU87277.1"
                     /transl_table=1
                     /translation="MYEYARKLMWNILVPSEDVLALADKKVKGVGFGTDTPKRYIWSF
                     GCILVHMLTGRQLTYRAEKVNDSLSSRDDSGIIQSNFVHRVREMGLPVLPSGIGGEES
                     KDLVKIIKKCFVKDTLVRLSASQLLESSFFGGRSSTSSPDSDTADGNIADPYNETAFR
                     DFASL"
     assembly_gap    402435..402484
                     /estimated_length=50
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     CDS             complement(join(403237..403347,403613..404064,
                     404192..404639))
                     /codon_start=1
                     /gene="RvY_00157-1"
                     /gene_synonym="RvY_00157.1"
                     /locus_tag="RvY_00157"
                     /product="hypothetical protein"
                     /protein_id="GAU87278.1"
                     /transl_table=1
                     /translation="MGNPNKKSKKGNRNVATSDSERAKGNSALFKAMLKNTRDPGSKL
                     TVLSVAIRLLCSDSFQSAEYILLKYKDGFYQVRPPLEQNEEFMTERHSCSDELIEKQE
                     FEKGIHIRAKWDERYQISKAIIVEVESDVEKINALFDTLEGIRQSEVRRNKNAPAKRS
                     SRMVNTERAESDRNKRRELNNRRLFKSTDCRKRQHRTEDGEDEESDSDTAPGPIVKSA
                     VQYKPKISFRKSTKRSRSSSASSVVGSRSSNAPSNAAKDRHNKSDIDRDRSHSKSAEF
                     GEVENEDEWSENDWTREPEGKSTPRAKMSDTAQTPNWTQRKIVVGRRRGSLVNSILGV
                     GK"
     CDS             join(404987..405272,405334..405731,406387..407925)
                     /codon_start=1
                     /gene="RvY_00158-1"
                     /gene_synonym="RvY_00158.1"
                     /locus_tag="RvY_00158"
                     /product="hypothetical protein"
                     /protein_id="GAU87279.1"
                     /transl_table=1
                     /translation="MERQRLSKFYIKLNLANKRAAKDDGDGLNKGNAKRANRLPSIPD
                     LTNAPPVDRAVTPEPDDLEDVTDDRSTDFGNLQGNSDDEMESATESSDSSCGALSMNH
                     SCSPDPSVIKDAEWTILDVCAMMLYTAKSNGVTNATLDNFLKVVALVINGKRNVEDDR
                     ARSKFPASVRSVKTALKISHEEQQKVIHICPTKRLIRKKGEDIPTTEICGYTLHPHYN
                     PARKTSATSATAECIDHVMCYRYKKDPILKSHEKIAALSERWHTLTPAEQKKIHEDRT
                     VGGFKRPSLVRHWEKFDVVEGFAQDVMHQMDEGLSKGFLKAVVEGSSVMKLSKNQVNE
                     IDRRWLSITVPGHDNRKLRSIRTYKQWKAHELRFFLQHGGPFVTNGLVPDAFYKILCL
                     ASSIAWTCTRDSVTVHDVKTVEKACTTFLKNFQNFFGVRAMKYSVHLVQHIPMALRLF
                     GPLHLVSCYRPENEIGKISRRICGTNNTTKQIMNSFLTLTECSNYLSDVISLDSKKNS
                     LVMKTVLQVMDLPMPVFSATASEGRCRLLGKPELLMNKDELSLLGRHPEIQRARLEVG
                     IFPRTSAHNEKSLRNESIIMDKDQKAWKVFDIIAVMGTEASQVGRTFVYGEKMEKVDA
                     NRVGVDHVYAVQASGTKQVFPTAFVGHEGQKGLDTRILYHVKWYGYPKSKNTWEPEES
                     LLQSGDAIAEYWRMVNCLKEYDSRPKRGETYKSKKEASKEFQRLINELSSILKEDPCV
                     "
     CDS             complement(408810..409373)
                     /codon_start=1
                     /gene="RvY_00159-1"
                     /gene_synonym="RvY_00159.1"
                     /locus_tag="RvY_00159"
                     /product="hypothetical protein"
                     /protein_id="GAU87280.1"
                     /transl_table=1
                     /translation="MAGDMLRLPMKEDELDRLRKTCDDETYKKKIVEYIMDASRVAYA
                     FSRTASFPIAELLINCLDSDGQVRGLHLENYSIFSVKPAELQWNKGKIDAQYIELREL
                     RTRGRANMFIMRRSVGGSDEILVKTVRLHQGELHLNGALLSMRRKALVLLDLSHPNVV
                     RHCDFQFILDETPEYKRYMEYCAGGTL"
     CDS             complement(409433..409741)
                     /codon_start=1
                     /gene="RvY_00160-1"
                     /gene_synonym="RvY_00160.1"
                     /locus_tag="RvY_00160"
                     /product="hypothetical protein"
                     /protein_id="GAU87281.1"
                     /transl_table=1
                     /translation="MGPASLGGNSVPKFQVNVQRSRNHGFKAAPFMVAISAENGMLTS
                     DNANASNVKIDVGDFLKHPPAHEIRAIDPRKILHMAPEMLEIENYIPVTDPDRAQLST
                     "
     CDS             complement(join(412764..413066,413146..413286,
                     413570..413652,413719..413938))
                     /codon_start=1
                     /gene="RvY_00161-1"
                     /gene_synonym="RvY_00161.1"
                     /locus_tag="RvY_00161"
                     /note="PBP1_NPR_GC_like"
                     /product="hypothetical protein"
                     /protein_id="GAU87282.1"
                     /transl_table=1
                     /translation="MLMDKYKWQTISFTCDISTEFGEYTRDFYRGTCNEFAAALTSQQ
                     GYKIFSQGANLSKADERISALQDAKLYSRVIVVISHMDYVRQVLLTASQLNMTTPEYD
                     AAKVFESLFIVTLARLPATTKTLALFDAIEHVAKDSYNLSSPVTESGLLYGTSTYSAL
                     HVTAQTVGEAIQLNKSLSDGSRLVKLMHNRTFATPCGVCEMNHNGDLESIYAIVGMSQ
                     QTKNFEVYLYTHEGKVLAVKSLEQAEKTAN"
     CDS             complement(414483..414854)
                     /codon_start=1
                     /gene="RvY_00162-1"
                     /gene_synonym="RvY_00162.1"
                     /locus_tag="RvY_00162"
                     /product="hypothetical protein"
                     /protein_id="GAU87283.1"
                     /transl_table=1
                     /translation="MLAMNLTHVGLCSNQPGKEPKPHVHFVVLIAYNREAVAAATDIA
                     IREVQKLYASNITFTYSTYWNTQSFCDEFDSATTAYLADFYYVTRLLLSEWTHPIILA
                     TGKWLVPFEPLPLGKVTGLYL"
     CDS             complement(join(415802..415872,415991..416195,
                     416276..416356))
                     /codon_start=1
                     /gene="RvY_00163-1"
                     /gene_synonym="RvY_00163.1"
                     /locus_tag="RvY_00163"
                     /product="hypothetical protein"
                     /protein_id="GAU87284.1"
                     /transl_table=1
                     /translation="MTSSPYLTVLWFIVSSYCLCHAKAYSVVKKSGEARYGALLQAAK
                     SAMDFSGKRSKRDGYSGGSGGGGGGRGIQELLMLSMLQEMSSGGSAVKSDTEAASSPS
                     SGNSFGNMPYSQTSFS"
     CDS             416661..416873
                     /codon_start=1
                     /gene="RvY_00164-1"
                     /gene_synonym="RvY_00164.1"
                     /locus_tag="RvY_00164"
                     /product="hypothetical protein"
                     /protein_id="GAU87285.1"
                     /transl_table=1
                     /translation="MFGPPQGGQPFLRRRIGSIIPEEDTVKYLGLHLDSQPSWKTTRN
                     KSSPKSTRESGTPILSSLRLASVPAR"
     CDS             complement(join(417747..417922,418034..418162,
                     418240..418300))
                     /codon_start=1
                     /gene="RvY_00165-1"
                     /gene_synonym="RvY_00165.1"
                     /locus_tag="RvY_00165"
                     /product="hypothetical protein"
                     /protein_id="GAU87286.1"
                     /transl_table=1
                     /translation="MNHGLVFLVCMLTVACFFGAVDSIRCHQCTFEQQQCRDPLNKDM
                     FKPTACATGEVCKKTVRENGEMSRNCEVKPSNGKMECSGDKPRTCYCDRDDCNSSGIN
                     TPSVIAMGVAVIFMAANRF"
     CDS             complement(join(419426..419607,419708..419854,
                     420053..420113))
                     /codon_start=1
                     /gene="RvY_00166-1"
                     /gene_synonym="RvY_00166.1"
                     /locus_tag="RvY_00166"
                     /product="hypothetical protein"
                     /protein_id="GAU87287.1"
                     /transl_table=1
                     /translation="MQLASIVFLGAVAFTCFFHTVSSLKCHQCTASSIGNINTGCNDP
                     IDKKAFPSQECSIPGANVCRKNTIRGIVTRGCDVKGSSTLGCKNIADKAFDCLCEGEG
                     CNGGGNNAPQTIVLALTVAFVALYRSC"
     CDS             complement(join(422022..422199,422448..422812,
                     423289..423408,423491..423721))
                     /codon_start=1
                     /gene="RvY_00167-1"
                     /gene_synonym="RvY_00167.1"
                     /locus_tag="RvY_00167"
                     /product="hypothetical protein"
                     /protein_id="GAU87288.1"
                     /transl_table=1
                     /translation="MAVHSFTVRVSAKADIGNLRQDLLKEVQTVTADRKILTDMVDSA
                     MTDPSSEHKVKGEAFKDALIMLHQYLTNLDLIKNELAETEVVIGRNQSEFAKKVKELQ
                     DNCRNERVIAANVVFGCCVVTLVEYPGFLAAGNKSLGLIFYNGHYMCFREADAAERFA
                     QHPEKYMTDLLTITRKRSVLEKLLGLVVTETAEDNIEHLKRRIPYCEDSKKGAVKIDV
                     AIQPELHPVASHWDSNYEWNVDQEVQTNKESGTAAVKPLQYLAGLRGGPEAFNKIRFK
                     QIGLSSDQLEELAELSAAPSI"
     CDS             complement(join(423757..423923,424443..424631,
                     424744..424831,424918..425013,425052..425213))
                     /codon_start=1
                     /gene="RvY_00168-1"
                     /gene_synonym="RvY_00168.1"
                     /locus_tag="RvY_00168"
                     /product="hypothetical protein"
                     /protein_id="GAU87289.1"
                     /transl_table=1
                     /translation="MSGEDEAHAEVAAGNVLPLWVIVDGITKYCTRNGIAMSKPLAEH
                     LVLQAQTVALVNSVVANSVVANSVEETKLATLTKDNLQTLTEACIKKFQNEPFAIAAA
                     ELQIYLDVSFPTRECFLNELRHQQDKDCYVLLDDILNTTVASKWELEQLTKKIVTYVI
                     VRSFLGDLKDIAVFKDCAAALSSIWPEGTVNRFSNLSREKKKIELQDYLYLSSGVRLF
                     NREKQQGGVGISDGN"
     CDS             complement(join(426525..426742,427036..427236,
                     427323..427477,427590..427741))
                     /codon_start=1
                     /gene="RvY_00169-1"
                     /gene_synonym="RvY_00169.1"
                     /locus_tag="RvY_00169"
                     /product="hypothetical protein"
                     /protein_id="GAU87290.1"
                     /transl_table=1
                     /translation="MDVDDLEQNLLSAFSGLNTNDKDDLVVRFQNLIGQAISRPTCEF
                     FLDMSNWNLQQAVCSYYDLEANSENLPQMSFVQDVTIGEGESVPPKTKFVKTWKIQNP
                     GWETWPPGCVLKFTGNGAQMTHVDRISLPSLKSSETFDASIEMESPEMPGIYQGQWRM
                     CTPTGVYCGETIWVILQVDSNGLLSLTQQMSSLPLGMGDMNMSKPAAFGSTKNPFASS
                     SPAAFPGNNSPNDDNGNGMDEAW"
     CDS             join(429381..429515,429589..429696,429792..429926)
                     /codon_start=1
                     /gene="RvY_00170-1"
                     /gene_synonym="RvY_00170.1"
                     /locus_tag="RvY_00170"
                     /product="hypothetical protein"
                     /protein_id="GAU87291.1"
                     /transl_table=1
                     /translation="MAQHLGEPIMMTMEEPIMTVREPVICGGYSKDLEATPEVQEKAS
                     AVKDEILKGAGAGVKADEFVVEKYASQLVNGINHKMKIRLAPGSYIHATVYEPFGAKV
                     EDLRVHEVTTNHKKDEPLFSWAR"
     CDS             complement(join(431777..431898,431980..432338,
                     432631..432865,432951..433061,433145..433175,
                     433269..433354,433457..433487))
                     /codon_start=1
                     /gene="RvY_00171-1"
                     /gene_synonym="RvY_00171.1"
                     /locus_tag="RvY_00171"
                     /note="NR_DBD_ROR"
                     /product="hypothetical protein"
                     /protein_id="GAU87292.1"
                     /transl_table=1
                     /translation="MAHNGKLSWKSYIGHVPCKVCGDHSSGVHYGVTTCEGCKGFFRR
                     THASKVVYLCQRSNTCVLNARNRASCPACRLQKCQRVGMSRDAVKFGRMSKKEREKLD
                     AEVSYHYNAALCAQQLSVQPSAEEGAMNLTMPSYPFNMVWRNEETDVKPAIVNQYIQS
                     ATFQMQPGRYFISSPMQPHFMHFPPSQLGGQHWQNAQYSQTQFPMPEYDMNLQQFAVP
                     GQSQPRMFSETKQLQLPTSSMSATVDVSAQEAQTVYAQFATPPGPSPLNQHFVQHNLV
                     HSSTQDETPWGKNALDAVGPAQSPDDFQLNGTPFVDAAEDWKPAIDAY"
     CDS             complement(join(434467..434637,435003..435204,
                     435266..435405,435475..435742,435941..436254,
                     436471..436826,437041..437285,437351..437421))
                     /codon_start=1
                     /gene="RvY_00172"
                     /gene_synonym="RvY_00172.1"
                     /locus_tag="RvY_00172-1"
                     /product="hypothetical protein"
                     /protein_id="GAU87293.1"
                     /transl_table=1
                     /translation="MQRIGPLVCSSFVRQLRLNLLSWKPLGKQVKDWHFPQRMFVRNS
                     TANQNRRQRRDIEQNIPLDNVIVAPTDASPLTELSMMPNFRRWHAILVQLCGNADRYV
                     PSDEWDRTFKEFHDDGPARKQSFYGSMMTLACSFRYRKLGDSILDHFQTKQLPFNIAV
                     ASRYIKLLGRTAGKDSAEKILKMYESIRKHFPGDVYDVGTAENLIAGLYQTTKWKDCF
                     SLLKMMDFTGRAGPMAVSFTMAGAFLNKDCEAAMKLVGRLREQQFSPSAVGFAAWFQY
                     AKAVGYEAVKQMLSCIRDSEWYLPLEVVKDMKSYFESLPEYKWTGKFTTMTLKGECKA
                     CHEYMEAIVVKKQEFEELQKNFINAVIEGSDVFLHTNPQELQRYRDFVEQNKPFDVIV
                     DGLNVAYHQGGGGGGGRDAPKRLSRQLRVVVEHLLKRKQKKILVVGRKHMLSWPSYEM
                     GILRDKVHLFFAENTSQDDPFVLYAAMTSGLGCAFLSGDLMRDHRFKLALQDDELRKT
                     FLKWQRTHQMELLKVHPDHTVTVKSPMKYVTTVQWTDQSLHIPYSSGLPLGLHELPST
                     WLCLTKATKFPNNTSNPVLLDL"
     CDS             complement(join(435262..435405,435475..435742,
                     435941..436254,436471..436826,437041..437285,
                     437351..437421))
                     /codon_start=1
                     /gene="RvY_00172"
                     /gene_synonym="RvY_00172.2"
                     /locus_tag="RvY_00172-2"
                     /product="hypothetical protein"
                     /protein_id="GAU87294.1"
                     /transl_table=1
                     /translation="MQRIGPLVCSSFVRQLRLNLLSWKPLGKQVKDWHFPQRMFVRNS
                     TANQNRRQRRDIEQNIPLDNVIVAPTDASPLTELSMMPNFRRWHAILVQLCGNADRYV
                     PSDEWDRTFKEFHDDGPARKQSFYGSMMTLACSFRYRKLGDSILDHFQTKQLPFNIAV
                     ASRYIKLLGRTAGKDSAEKILKMYESIRKHFPGDVYDVGTAENLIAGLYQTTKWKDCF
                     SLLKMMDFTGRAGPMAVSFTMAGAFLNKDCEAAMKLVGRLREQQFSPSAVGFAAWFQY
                     AKAVGYEAVKQMLSCIRDSEWYLPLEVVKDMKSYFESLPEYKWTGKFTTMTLKGECKA
                     CHEYMEAIVVKKQEFEELQKNFINAVIEGSDVFLHTNPQELQRYRDFVEQNKPFDVIV
                     DGLNVAYHQGGGGGGGRDAPKRLSRQLRVVVEHLLKRKQKKILVVGRKHMLSWPSYEM
                     GILRDKVHLFFAENT"
     CDS             join(437782..437952,438026..438224,438287..438444,
                     438574..438953,439222..439557,439848..440082)
                     /codon_start=1
                     /gene="RvY_00173-1"
                     /gene_synonym="RvY_00173.1"
                     /locus_tag="RvY_00173"
                     /product="hypothetical protein"
                     /protein_id="GAU87295.1"
                     /transl_table=1
                     /translation="MLKTFIQSVTRQSGRFIKLGSPPLAVCPRCGSQSLSASTKSAAP
                     KKSKAKSPGQIAAARKKKEAEYKVEIDSRISELDFPLGDYNLQISGRNPYLTTSGAPK
                     KLFTSTRNFPGEMYIGNHEFANRVASLMSFSPSKPPLIVEGNPGMGLLTYAMLEKGAK
                     KIRAFEGRAIFVYRLQAMQKHYGYDRLELVCPYNVFDYFKKSTKKLDLQIIAAMAKAE
                     ESAPTDASADSPDFSPSTAPNKVGFSLEERLDLMLNPSKGEPQEWSDPVPALKFVGVV
                     PQRCESVFLRRLLDNVAKRKGFCSLGRAEFFLLVSPRTYTMLTTQPGPKTNLQVFRWM
                     SIAAQTFFDITALDTAPRSSLLPPVPKSKVEEASTQWTLVRLTAKPDLPDLIDWTLLP
                     EFIFFLKQAMTARLKPVVQWLEGWIPGYGKKYLDQGNNMYIRTGDLTAHQWTELFRDI
                     VTSGDYASSNLKIAFGTSGQSLDVLDADEDELEDDKIVSSMG"
     CDS             join(440485..440545,440721..440890,440949..441059,
                     441463..441576,441649..441846,441972..442118,
                     442187..442293,442655..442739)
                     /codon_start=1
                     /gene="RvY_00174-1"
                     /gene_synonym="RvY_00174.1"
                     /locus_tag="RvY_00174"
                     /note="replication factor A2; RFA2"
                     /product="hypothetical protein"
                     /protein_id="GAU87296.1"
                     /transl_table=1
                     /translation="MAGRSFNNYGRGGGGGGDFGGGGGGFNNTQYGDGGGYGGAGGGG
                     YGDNAGYGFTGGGGFLADGQNDNSMTQAGGDKKGAGRSPEVVPVTIAEIRQNMTGSTD
                     DRMRIGNVEVHRVVVVGQVKRITHSATAVTYELDDKTGQTIEAKMWLDSPEDLQNQLS
                     TVEVSKYVRVFGSLKTFQNTVNVVAFAIIEIQDMNEISMHILEVVHSHAVLRKMSGES
                     GGSAGANQATKYHNSTTVVGGVQSMGGGDDYNNGYGANIPQGFNACQAAVFQHILQNS
                     ADEQNDGTDVNELVNLMARQFPKHEILGAVDLLNQEGHIFSTITDHHFKAMGSN"
     tRNA            443104..443176
                     /gene="tRNA-Lys(CUU)"
                     /inference="ab initio
                     prediction:Aragorn:1.2.2865,tRNAscan-SE:1.2366"
                     /locus_tag="RvY_t0001"
                     /product="tRNA-Lys"
     CDS             complement(join(447079..447153,447538..447657))
                     /codon_start=1
                     /gene="RvY_00175-1"
                     /gene_synonym="RvY_00175.1"
                     /locus_tag="RvY_00175"
                     /product="hypothetical protein"
                     /protein_id="GAU87297.1"
                     /transl_table=1
                     /translation="MKTADTLIGPVANFCCTAFQYIFAGMANMLRPPLNLSGKGYRNN
                     YGTTVWLVLVLGQQINAVVK"
     CDS             complement(453976..454383)
                     /codon_start=1
                     /gene="RvY_00176-1"
                     /gene_synonym="RvY_00176.1"
                     /locus_tag="RvY_00176"
                     /product="hypothetical protein"
                     /protein_id="GAU87298.1"
                     /transl_table=1
                     /translation="MTKKLYLDWSEKVLFPHMEERCIFLADSWKTFTDQDLPVQVHHR
                     DVILRLHSLLYQQFRSPRFENLIAEAWHKSGYTDEGFMYVNPAKFMFDKLKGSCLHEN
                     YRDIVLLVCGWCKARLCFYHFYDAHHFCTIYLP"
     CDS             complement(join(454937..455440,455531..455641))
                     /codon_start=1
                     /gene="RvY_00177-1"
                     /gene_synonym="RvY_00177.1"
                     /locus_tag="RvY_00177"
                     /product="hypothetical protein"
                     /protein_id="GAU87299.1"
                     /transl_table=1
                     /translation="MESINLLNVIKLLEWDYKLHYRIDDFPSEADRQFKDIITQSVTP
                     VYAVEEDLQYDLQIRVESFADCEASVVQCNLLNGRSEADFDVTEPDRLLEPVSSGTEP
                     SSHELYIPRLPNPKLPVDQLVNLEYKKREATYWRNAVKKKRLTLTTVQRSFGKVTSIR
                     QLYDWEKQVVEGGSRLDKLKAPRLDIGNPFFLAKRKKQVVKDLD"
     CDS             join(456452..456776,456928..457526)
                     /codon_start=1
                     /gene="RvY_00178-1"
                     /gene_synonym="RvY_00178.1"
                     /locus_tag="RvY_00178"
                     /product="hypothetical protein"
                     /protein_id="GAU87300.1"
                     /transl_table=1
                     /translation="MYLIFSAFVLPLLFVWLLIWKKHRSRNLPPGPIVIPLFGTVTLF
                     RYSTPYLAWIEWAKACRSDTIRLRTGPLARVACHDIDTVKKLFAKEEATGREKLFSHP
                     VIAKGKGLIFSERPLWKHHRRFALTTLRNYGMGKTWLDDTILSEVDDLCKLLVDLDGR
                     PIDPRRLLSHSISNVICALVFGRRFPHDDARFTKLTSLFDNILIAQFTYGRLLAFPFL
                     KYIPGSGFHQKNAIIRKNFADVIAFIKELVNDHRCDDKSDEGTDHDYIDAYITEKAHQ
                     RTHQDGSNMFEDDQQLVGSLYDLFFAGTETT"
     CDS             complement(join(458080..458253,458462..458740,
                     459053..459202,459398..459607,459745..459960,
                     460146..460256,460380..460427))
                     /codon_start=1
                     /gene="RvY_00179-1"
                     /gene_synonym="RvY_00179.1"
                     /locus_tag="RvY_00179"
                     /note="actin-related protein 2; ACTIN"
                     /product="hypothetical protein"
                     /protein_id="GAU87301.1"
                     /transl_table=1
                     /translation="MDSQGRKVIVCDNGTGFVKCGFAGSNFPAHIFPSMVGRPIIRAD
                     TKVGNIEVKDLMVGEEASQLRHMLEISYPMDNGIVRNWDDMNHVWDHTFGEQCLNIDP
                     KGCRILLTEPPMNPLKNREKMIEVMFEKYQFDSCYIAIQAVLTLYAQGLLTGVVVDSG
                     DGVTHICPVYEGFSLPHLTKRLDIAGRDITKYLIKLLLLRGYAFNHTADFETVRMMKE
                     KLCYVAYNVQQEKKLALDTTVLVHPYMLPDGRVIKLSSERFEAPEALFEPHLINVEGM
                     GLAELLYDTIQSADMDIRSEFYKHIVLSGGSTMYPGLPSRLERELKQLYLERVLKGDA
                     ERLSRFKIRIEDPPRRKHMVFMGGAVLAEVMKNKDDFWMHRKDYEEKGLKGVMEKLGV
                     RPG"
     CDS             join(462326..462441,462470..462686)
                     /codon_start=1
                     /gene="RvY_00180-1"
                     /gene_synonym="RvY_00180.1"
                     /locus_tag="RvY_00180"
                     /product="hypothetical protein"
                     /protein_id="GAU87302.1"
                     /transl_table=1
                     /translation="MDLKVRHPAGHNIVSGQRCPDSSTGTGHGGQQQLRRMWSNGYGS
                     YGHGYNYGGNYGGGYDGGYGYEPLVVDTPNSQPYYPEYNVPLYGRYTYPAHSPHYDNS
                     YNSYGKSY"
     CDS             complement(462333..462647)
                     /codon_start=1
                     /gene="RvY_00181"
                     /gene_synonym="RvY_00181.2"
                     /locus_tag="RvY_00181-2"
                     /product="hypothetical protein"
                     /protein_id="GAU87303.1"
                     /transl_table=1
                     /translation="MGRVSRISVASIERDVVLGVVGLAVGCIDNKRLVSVSAVITTSV
                     IPSVVVSVSVASVPVAGIQNDHLSTSTSSVVVAGRRVQFRLSYRGTVDQRRYCDQQDG
                     AP"
     CDS             complement(462454..462774)
                     /codon_start=1
                     /gene="RvY_00181"
                     /gene_synonym="RvY_00181.1"
                     /locus_tag="RvY_00181-1"
                     /product="hypothetical protein"
                     /protein_id="GAU87304.1"
                     /transl_table=1
                     /translation="MTIATGKSSSLTRYGTASPRGVRKDFLFGSSSSFRKNCRSCRNG
                     ESEQDKCSVHREGRCTRGSRVGCWVYRQQEARIRIRRHNHLRNSLRSCIRVRSFRTRC
                     WHPE"
     CDS             join(463462..463592,463657..464176)
                     /codon_start=1
                     /gene="RvY_00182-1"
                     /gene_synonym="RvY_00182.1"
                     /locus_tag="RvY_00182"
                     /product="hypothetical protein"
                     /protein_id="GAU87305.1"
                     /transl_table=1
                     /translation="MSRQYVPKPDGFDHLKVFDAFNMAARNPEVDVVSYLDAFSELSR
                     FFDMMGMLFATMASDIRDQVEIMEKILRSEKGSYYQTVRSTMAYEKSEPSLLEPKRKD
                     QSGSRTLLHLNRTLDFFVQFLTTMETVPDEEKLPRICQPAYKATLGKHHSWLLSKAAG
                     AAIATLPTKVGLYEKVSKYPYQQTAENMTRMVKAMTEVFTKTDTLFTENNLQSLPF"
     CDS             complement(464468..466105)
                     /codon_start=1
                     /gene="RvY_00183-1"
                     /gene_synonym="RvY_00183.1"
                     /locus_tag="RvY_00183"
                     /product="hypothetical protein"
                     /protein_id="GAU87306.1"
                     /transl_table=1
                     /translation="MKVSNIQTAMALAYEAGMGYTQDMANRSAYSSLFMAIFVAAVAM
                     LLLEVLCIFIFVFCDKEAQDGSSEPDDTIAKYSFLIQGPRALHHGVFQVSNSLSNASL
                     QVKNVIAKTTERCRTLKLRKQKPKTDSAQVTDDVTEMTIKVCKETVPAHSSTFQPYRP
                     NEPCPWEPECAPQLPSGCAVDTDVTDLASRSIGLETLRDHLERKKLLVSATADLETIE
                     QTQTEDEHQPSLDVGVGTGRSEQRDSVPYSIGPQLMSKTSVPIDVTGQPELPGGTRTS
                     SAQSDVTAEIQADVQRQISSTTSAVQRNSLSRQSRDGKPPDRQPSWETPVSALRRPSQ
                     ELVNSVTREKEISLTRQSGAARTSGSAASPAGTEQVRQRNLPNENLNSKGEIQGTVPF
                     TQRERELSAASERRQREMSIAAAECRRVREREQSASNQPPKPGSSPGVPREGSQSSGR
                     TPEVNTNPFDRPDTPPPSGPPPDIRSSKTGEFFIAKPMSSAEQPVRQTSSPGNSAAET
                     AESAQPIVHRLSAPAAPRMSLSGPEGREGPPAPNPLL"
     CDS             complement(join(467275..467506,467573..467811,
                     467953..468036,468100..468212,468275..468358,
                     468434..468481,468573..468648))
                     /codon_start=1
                     /gene="RvY_00184-1"
                     /gene_synonym="RvY_00184.1"
                     /locus_tag="RvY_00184"
                     /note="GST_C_Metaxin2"
                     /product="hypothetical protein"
                     /protein_id="GAU87307.1"
                     /transl_table=1
                     /translation="MEFLLKPFMFTSDLVEDTVEVVISSGDLPWPQNVILCVPLLSSQ
                     VTLHEQAECLATQAFLRMHGLNFTLDERPNAEYMSVTAKLPLLKIDDHFVAGFDAITT
                     YARLRIRKQLTSEQESAIRPYVEMINVTVRNAELYAAWVDDTNFRSVTAPRYGSPYPF
                     PLNKILPLLKRVQIKAFLTENSPLASMDDVRESLNSDMKALSERLGPRPYFLDDLNTN
                     ELDALVYGHLTALLTSKLPEGNLTELVHRHQNLVQFCQRVDRKKEMGMNSELHTTTVV
                     TSMRRLPPVVLKSDV"
     tRNA            468837..468908
                     /gene="tRNA-Arg(CCG)"
                     /inference="ab initio
                     prediction:Aragorn:1.2.2865,tRNAscan-SE:1.2366"
                     /locus_tag="RvY_t0002"
                     /product="tRNA-Arg"
     CDS             join(469379..469385,469472..470289,470531..470748,
                     471047..471366,471626..472015,472161..472444,
                     472822..473337)
                     /codon_start=1
                     /gene="RvY_00185-1"
                     /gene_synonym="RvY_00185.1"
                     /locus_tag="RvY_00185"
                     /note="RhoGEF"
                     /product="hypothetical protein"
                     /protein_id="GAU87308.1"
                     /transl_table=1
                     /translation="MEGEHHSANGPLCRFVFLEDGLHTALMAEAVANLKGRLLQKEEK
                     KHWLALAERGEIPVGDRLVLIAADFSDAFFQKLRSKLKTPSARLSMIGPPVLLQCAGR
                     DEKIPKTVRPLYNNLMHGVVVIFSGFDEASALAELSDMVHYMGGKVTDKFHQTGTLKP
                     THLVARWLLSDKYQSAFNFGSCHIVKEEWIKVCWSRRDEMHLDKKKTQLTQDKDFLKQ
                     FRLKPFHGLKICLIGFDDSEKISIKELVQQNDGQVVDTIDHNTTHIVVEEKKDSEVQQ
                     TTEVHDTMRDGKNVKELYVTITLNGGEKASIVLEAGKQSLVRSDWFWTCLKLDHYANP
                     DAFSLLDPSRLASRFIPLKDEQSSGSRGRSRLSAVAEFDSPSSGCSGPPSNNSSFDIL
                     GSRLHFGKLSARSSSNLASLVAPVISKRQHTVLEMRDTEEKYVKSLGDILKLCDNATN
                     NIEGGSYLDEDAGSRLQEHMKGIREMIVIHRSVRGELTELTSHWTEGAPVGSIFLRCG
                     RSLEELYPPFVNNHDKIRKFISDCEKRFPRFRAFLKLAEKDPLYDRQHLMDLLTRPVQ
                     RLPSVKLLLKDLRKRTEDGNRDAHELDKAILEIERVLHLINDGKRNTEVQEMLNGIEN
                     IPHDLLSSSATSGYIAHLDCVELASHQFHEKYACVTLILFNDALEVAKKRSQAKKSQD
                     ENGAKKPHKHLQFLPLIRLKEIASIHDEEQVKGVFVLKLLVEASHENTSEHSYKFACV
                     PEYCELKAKFLSQLATQVSSSTCQSTEVKKAYADDFDIKSSDVPKNEWEKIGRKVRRE
                     VSIRFSTQGLKSSGQKLKRAVSTAFLTPAKLLDGERAEAEQDHSSPMKLFRR"
     CDS             complement(join(474671..474836,475154..475360,
                     475430..475500,475624..475626))
                     /codon_start=1
                     /gene="RvY_00186-1"
                     /gene_synonym="RvY_00186.1"
                     /locus_tag="RvY_00186"
                     /note="putative cofilin/actin-depolymerizing factor
                     homolog; CFL"
                     /product="hypothetical protein"
                     /protein_id="GAU87309.1"
                     /transl_table=1
                     /translation="MASGVTIADECKQQFEAIKRDKKARYIIFMIKDEKQIVVEKVGE
                     RNAKYQDFVQDLLAAGPDDCRYGVFDYEYDHLVQGASSESRKQKLILLSWCPDTAKIK
                     KKMLYSSSFDALKKALVGIAKYIQATDESEASKEAVEEKLRSTDRA"
     CDS             475625..475912
                     /codon_start=1
                     /gene="RvY_00187-1"
                     /gene_synonym="RvY_00187.1"
                     /locus_tag="RvY_00187"
                     /product="hypothetical protein"
                     /protein_id="GAU87310.1"
                     /transl_table=1
                     /translation="MAASELMNSWEIWGVSQKDPWEAASLWDLDGGRKEIKVSAEFDE
                     ENAATMMCSSDFNTQRHGHGSVIRHAVSVTHRRCIVCNVRRSASLAYCLTI"
     CDS             join(476453..476861,477014..477247,477314..477359,
                     477444..478068)
                     /codon_start=1
                     /gene="RvY_00188-1"
                     /gene_synonym="RvY_00188.1"
                     /locus_tag="RvY_00188"
                     /product="hypothetical protein"
                     /protein_id="GAU87311.1"
                     /transl_table=1
                     /translation="MADFPNWDDWNDVNDTSVDLAGPSTSAASVAAGNSISWSAKNIA
                     VLAAIVVFSLKGFLLNASIVVAITVGNMRKMVTTLTGMDVLIINHSVINVLIITLTIP
                     WMLSVRLISSDRWLFAHGFCQPWGFFRGWFYGASEMSLTVISVHQAIAFIVRLLPNLN
                     FFSGMEPRQRTFIRAGLIVLLAVLSWIIAFGVESIFLQLQPVIAHGFDICAFTHDDHE
                     VITSFTLAEELLIFWIPISVSIFLIINVGVLLVIFRGRVQLGSDRPTSVVTPPMRYSQ
                     LNSTSDGERLLEDRTRLLSSRNGRGNENPTYWQNHEQVYFNSSLLTLNTDEEGLDGQL
                     PPVTQLPLTEKAEVPTDEFTRSSFMTWLGLTLSNLFFVAPMHIFFLWRKNDESFAPSA
                     EQVSIYQSVLMILLSIRVLLVDPLAILLLTSRYRNLLFSIFKKRV"
     CDS             482112..482273
                     /codon_start=1
                     /gene="RvY_00189-1"
                     /gene_synonym="RvY_00189.1"
                     /locus_tag="RvY_00189"
                     /product="hypothetical protein"
                     /protein_id="GAU87312.1"
                     /transl_table=1
                     /translation="MDEPNVNKVDWIDVEYFDFNDERTMFDWSNFDIGQPFADLNNDD
                     DNRRQCCIQ"
     CDS             join(486015..486132,486201..486388,486499..486694,
                     487764..488290,488479..488724,488794..489096,
                     489232..489573,489647..489867,490528..490626,
                     490694..490976,491048..491173,491252..491458)
                     /codon_start=1
                     /gene="RvY_00190-1"
                     /gene_synonym="RvY_00190.1"
                     /locus_tag="RvY_00190"
                     /product="hypothetical protein"
                     /protein_id="GAU87313.1"
                     /transl_table=1
                     /translation="MLRQSLSYGNGGLLEAVSALKAASAGSSKHPLFLLGTSAGDVYY
                     LDQQGKVHQGPRLQGSVQAISFLEIFGSKYWTAYFVMDSLNVLGYQISHGFVFEETFN
                     AACPGKTPVPSVCWLNPEVLAIATGENHLRIWDCLKSANIDLPLHDFAGTEPAEALRT
                     VTLNQSSGVLMGQTNSGKLLFWSSWPSSSSQSFCRMMCSTLWSLISSFQVRLSAADIS
                     GPSFAIADTHTVYVLQQRPLSFAFTYPLLAIQTSTKSVSIIDEQRKKAAMQKVKFQIS
                     GVAVKDNLLVVWSEETVSVWQMSAQADDEGLTLTEISTFRRDYAKIAIYNGALVATKN
                     KSINFLTAQGVVKADIKVLANEGTVALMDIKGSTCVVAVSEGYLKTFNLDTSDPKSWN
                     KTKAIKEAVTSYASFKSLSINLDCLYIAFLTDRNDGVPEDKVYLWDLERNAISWYSFD
                     SAVPSQVTWQSDDPRQLAVNLTCSSTWKKAGNDRLAFFFASSDKGLVLANQLPLKTNG
                     SALLLGTHSPFAFVYANSVEQGGKLAVIKRFLPDCEGFVPEHKDDMMAIADFGYYAAL
                     GHFSRAINSVKTTSNGVWNHLARLCVKRGKLEYAKVCLGKLGHVAILADIRNFAETNH
                     NTKAQLGRLAALLHIKGTADEYFGMSGQTDLSDSLRKACGDFATDEKHGPIDGPQGDV
                     ISTSARLKQRGLLYEQAQHEKAFADVEMTVEKLKKAKCEKFDVPRFLLQKRPQELHDY
                     IDQANDTRLYGWYGHFLESQNLTDEAVEYYEKAHELKAQVRIFCGRDEQDAALALVRR
                     SHNRAAAFQLAHAMEVEGKTDATILVELYEMAGAYRNAIRICMDNELDEEVVKLALQS
                     QKSESIMAAKYLQSKGLIDKAITLYHSAGRINKATDLAFTQGYYGNIETISVDINENS
                     DPRLIERCVEYFAEHKQVDRAVNLLIKAKRVQHESMI"
     CDS             join(493642..493759,493828..493898,493982..494252,
                     495067..495125)
                     /codon_start=1
                     /gene="RvY_00191"
                     /gene_synonym="RvY_00191.1"
                     /locus_tag="RvY_00191-1"
                     /product="hypothetical protein"
                     /protein_id="GAU87314.1"
                     /transl_table=1
                     /translation="MGNVSTLKNRTVRYADLSGNKIKDLDGVALPNIARLRLDFNRIS
                     SLDILNGHDFRFLRKLELRGNRLKSTAGIKHASLEELYLVSNGAFSSTLKACRINVMH
                     KTFICRLRMTFERLKTLSFVPTSSDYTCETTRFWMWQASAKRTPSWNMLICGIISSHL
                     STMRWASPFSHD"
     CDS             495098..495595
                     /codon_start=1
                     /gene="RvY_00191"
                     /gene_synonym="RvY_00191.2"
                     /locus_tag="RvY_00191-2"
                     /product="hypothetical protein"
                     /protein_id="GAU87315.1"
                     /transl_table=1
                     /translation="MGITVLPRLKNLVMMDNPVQLEVDFRMVIIARMPTLAVLDKEAI
                     KPYDRDWSIMTLLDSLYHEQVDLKVAVEDLMDAIDPVEMADTATLPPSQTSLTSETDF
                     MEDEDWEDGEEADDEVNEVDVVERTNSKDLLETKSIEEDDLDREYYGEKEPKEDEEDQ
                     GEQET"
     CDS             complement(join(497469..497721,497802..498130,
                     498196..498299,498381..498435))
                     /codon_start=1
                     /gene="RvY_00192"
                     /gene_synonym="RvY_00192.2"
                     /locus_tag="RvY_00192-2"
                     /product="hypothetical protein"
                     /protein_id="GAU87316.1"
                     /transl_table=1
                     /translation="MLLCHRYIVEPDIPSFLSGLRRQGWIRWSDHHFGRTGRFHDSRH
                     CIGLEWQIQVGDCCSVRWLLPVDGAFQSDHALEGTVECLPFFHLPWALYDGLPAGRLR
                     VCSTINAACARRHFLWTAQLLCASLWPNLDPDNWSYHRTRPSQHRQRDSGRTAGLRFR
                     SNNPRQIQELAQRNLNSHRYDYRFCCLLIMMRLSNTQQRTMAICWRHPNTRIWLQLCP
                     RLRFCPYTSVMSYWQTLCATRYADGQRV"
     CDS             complement(join(497645..497721,497802..498130,
                     498196..498299,498381..498574,498636..498828,
                     499079..499585))
                     /codon_start=1
                     /gene="RvY_00192"
                     /gene_synonym="RvY_00192.1"
                     /locus_tag="RvY_00192-1"
                     /note="putative feline leukemia virus subgroup C
                     receptor-related protein 1"
                     /product="hypothetical protein"
                     /protein_id="GAU87317.1"
                     /transl_table=1
                     /translation="MRLSNMSSHFLFQGVIWKSFSSEGLLVVRRWTMLTVFALCSMIN
                     AFQWIAYSIISDRVRDFYSVSLIAVDWLSMIYMLVYIPLVFPATWILESGGLRITLLL
                     GSFGNFLGSLMKCGSAQRHLFGLTFFGQTVAAISQCFILGLPAQLAAVWFPANQVALA
                     TSVGVFGNQLGVALGFLIPPLIVHGGQQSGQHGIEDSHLPLTDETLELYGQQLLKVFV
                     GVAIISAILFVLVLLVFQSSPDGTSPTNFESKVPTNYSHSLWKLAMNGNFRLILLSYG
                     VNAGCFYAIGTLLNQIFLHFFQGFDDRAGYVGLTITLAGLVGSMIAGIVLAWSGKYKL
                     VTAALYGGSCLSMVLFSLTMHLKVLWSVFLSSTCLGLFMTGYLPVGFEFAAQLTRPVP
                     EGTSSGLLNCCAQVCGLILIPTIGATIGHGHPSIANGILVGLLAFGFALTILVKSKNL
                     PKETSTPTAMITDSAVY"
     CDS             join(500303..501441,501585..502224)
                     /codon_start=1
                     /gene="RvY_00193-1"
                     /gene_synonym="RvY_00193.1"
                     /locus_tag="RvY_00193"
                     /note="RhoGEF"
                     /product="hypothetical protein"
                     /protein_id="GAU87318.1"
                     /transl_table=1
                     /translation="MVTRKSRRNCYANSTCGADIFWLAELLSLLTKSDGGPRANKSSS
                     RSRRRKQKVLPQNRTDLLEYDFLTDGPVTHIPDAVASADTLNADLAQENGSSAVPAET
                     LVPLRNRLPTDGFAAQQTIAEENEDSVDFPGEALPFRSRLPTNGMGKRRRFSATPEQV
                     QQLINPPLKSKRYQRVVELLDTERNYVNIMSRMLEIIREVPIDASLPYTAMLHPDALA
                     EMNTTFSQLPQLLEVHQCIVKDLEKAVENWAEDICIGKIFTKYGPYLEAYVPFVNSFE
                     KIKAFLQEWGEKCTLFQSYLKICQMQPGCGRQHLQDLLIRPIQRVPSVVTLLRDIKSR
                     TDVDNPDCKELDKAITEVERVLEFINDQKREADISQMLTGIETDHGFRSPLATACHYI
                     THIECFELEDDQFSAKGDTVMIVVFDTVLEICKKMPLRVQRKRSVLDHKKGWEHIDYI
                     PLEQIRDMIDVPDEQDCIHAFALGLRTIDNEECYFKFAATDHYGMDKSLFLRQVYAQI
                     PRGNADRPVLRRMDPHEVRMRTTSVMAFQQPGLRRSLSLLVKRLRQVFGLHSLGMRRS
                     TTDRIFSHDAPISNLPGTVPMPANLS"
     CDS             complement(join(502451..502563,502646..502912,
                     503333..503443,503546..503838,504163..504253,
                     504351..504419,504489..504576,504646..504743,
                     504897..505022,505101..505164))
                     /codon_start=1
                     /gene="RvY_00194-1"
                     /gene_synonym="RvY_00194.1"
                     /locus_tag="RvY_00194"
                     /note="WW domain-binding protein 11; WBP11"
                     /product="hypothetical protein"
                     /protein_id="GAU87319.1"
                     /transl_table=1
                     /translation="MGKRSTTNTKSGRAMNPADQARKEARRRELKKNKKQRLIVREAV
                     IKSKDPKKIIEELERLDQMEYNVAAPPPLGEHILAERRKRLLGNFNRCIGLYDKDDKV
                     THGELKRMLAGYHRKHDELKRYFDSVKKAENVEVTDIPLPAPGFEEEVSSPTEAPPSG
                     QKQPQGPVVYGAPRYVSWEMFSDDLSDTNGKLPPGPPCCPPPSLSDDSDDEAAADTKE
                     EHESNDGAESDDEDDAEDRARADKDEEDPSGTAEETKPSTSSAHDTSSVDTPSPFSQP
                     GSAPPRPMFVPSQVQAGHFRQVPPPHMLAQRFRTSRPGPPGLPRPPPLMARPPPGFMG
                     GIGPVMPGMRPPCPPPPYGAVPAPVAEPKATFAAAPQLRTSTSEVTRLIPTSVKVKRE
                     EAPKPKPKVTGTLGPDAELIPYRPAAAPKVSADQAYDAFLKEMQGLL"
     CDS             join(507313..507334,507419..507483,507566..507724,
                     507794..508229,508329..508554,508634..508900,
                     508964..509014,509082..509112,509436..509493,
                     509569..509658,509743..509887,509963..510061,
                     510132..510272,510395..510567,511068..511207,
                     511305..511734,512001..512216,512282..512549,
                     512636..512686,512748..512769)
                     /codon_start=1
                     /gene="RvY_00195"
                     /gene_synonym="RvY_00195.1"
                     /locus_tag="RvY_00195-1"
                     /note="putative angiotensin-converting enzyme; ACE"
                     /product="hypothetical protein"
                     /protein_id="GAU87320.1"
                     /transl_table=1
                     /translation="MVSNFVWGVLLVLLFSTVCSRSALVRPREVDVRAGEPRNTVQAF
                     QRYIRLVYQPQAEDVIYNDQEASWAYNINITGYNEELMIAASEETALFDQETAQYVRS
                     SFSNIDFSSNMTLERLYDKLVLLGDANLNSTDFSELQEVQTRMQRIYNTAKICRNPSI
                     HADDVLSKCPKDQQLSLEPDVSQILATSRNETLLRHVWKSWRDATGKKMHGDYQRYVE
                     LKNKASSMDGYADTGAAWRSTYVDTYTNYTDQMFLDEAEAIWQQLKPLYEQLHAYIRH
                     KLKEQYPTVKALSNTNSPIPAHLLGNMWAQTWGNLQEFTRPHPEKQSLDVTEAMVEQN
                     YTADTMFRKSDDFFATLGLIRMPQKFWDKSMIERPADNSTKVVCHASAWDFYNRQDFR
                     IKQCTEVTMEDFLTVHHEMGHVEYYLQYKDLEVPFRRGANDGFHEAVGDTLALSVQTP
                     AHLKSLGLLMADFDINDPDLERNSLYSTALDKIAFLPFGYLMDKYRYDIFSGKIKPEQ
                     YNSKWWEHLVEYQGICSPVKRSDSDFDPGSKYHIPAGVPYMRYFVSFILQFQFHKAMC
                     QEAGYTGPLHRCDVSAPELGDGGKRAGALLAKTLKMGSSQPWTQAISAITNGNSSRMD
                     AGPLLEFFTPMQQWLTQKNAELGITPGWSKEPECSEETAFQAWLNLHNNESSVVKSAE
                     MFATWAYQTNITKANELAMLEASNVAAAFAKRKTEEMLGLFPNPDEITDPLLRRAYEK
                     LSKLGDAALSPEDFARLGAIRTEMEQVYSVAKVCNDTSIGIDMERCPQHQQMALSPEI
                     TDILHSSRDPEELLYYWSAWRDATGKKMRSNFTEYVGLKNKAAVADGYKDNAEAWRAP
                     YVEPSYNYTDADFLEDADRLWNQMKPLYQQLHAYIRYKLWELYGNKTVPSLNGPIPAH
                     LLSNQWAQTWVGLLDFTEPFPGKPQLDVTQEMQKQGWTARRMFNVSEEFFTDLGLIGM
                     PEEFWKISMIEKPSDREVVCHASAEDFYDGIHFGIKQCTAVTMSDLLTVHHEMGHVE"
     CDS             join(507313..507334,507419..507483,507566..507724,
                     507794..508229,508329..508554,508634..508900,
                     508964..509014,509082..509112,509436..509493,
                     509569..509658,509743..509887,509963..510061,
                     510132..510272,510395..510567,511068..511207,
                     511305..511734,512001..512216,512282..512549,
                     512636..512690)
                     /codon_start=1
                     /gene="RvY_00195"
                     /gene_synonym="RvY_00195.2"
                     /locus_tag="RvY_00195-2"
                     /note="putative angiotensin-converting enzyme; ACE"
                     /product="hypothetical protein"
                     /protein_id="GAU87321.1"
                     /transl_table=1
                     /translation="MVSNFVWGVLLVLLFSTVCSRSALVRPREVDVRAGEPRNTVQAF
                     QRYIRLVYQPQAEDVIYNDQEASWAYNINITGYNEELMIAASEETALFDQETAQYVRS
                     SFSNIDFSSNMTLERLYDKLVLLGDANLNSTDFSELQEVQTRMQRIYNTAKICRNPSI
                     HADDVLSKCPKDQQLSLEPDVSQILATSRNETLLRHVWKSWRDATGKKMHGDYQRYVE
                     LKNKASSMDGYADTGAAWRSTYVDTYTNYTDQMFLDEAEAIWQQLKPLYEQLHAYIRH
                     KLKEQYPTVKALSNTNSPIPAHLLGNMWAQTWGNLQEFTRPHPEKQSLDVTEAMVEQN
                     YTADTMFRKSDDFFATLGLIRMPQKFWDKSMIERPADNSTKVVCHASAWDFYNRQDFR
                     IKQCTEVTMEDFLTVHHEMGHVEYYLQYKDLEVPFRRGANDGFHEAVGDTLALSVQTP
                     AHLKSLGLLMADFDINDPDLERNSLYSTALDKIAFLPFGYLMDKYRYDIFSGKIKPEQ
                     YNSKWWEHLVEYQGICSPVKRSDSDFDPGSKYHIPAGVPYMRYFVSFILQFQFHKAMC
                     QEAGYTGPLHRCDVSAPELGDGGKRAGALLAKTLKMGSSQPWTQAISAITNGNSSRMD
                     AGPLLEFFTPMQQWLTQKNAELGITPGWSKEPECSEETAFQAWLNLHNNESSVVKSAE
                     MFATWAYQTNITKANELAMLEASNVAAAFAKRKTEEMLGLFPNPDEITDPLLRRAYEK
                     LSKLGDAALSPEDFARLGAIRTEMEQVYSVAKVCNDTSIGIDMERCPQHQQMALSPEI
                     TDILHSSRDPEELLYYWSAWRDATGKKMRSNFTEYVGLKNKAAVADGYKDNAEAWRAP
                     YVEPSYNYTDADFLEDADRLWNQMKPLYQQLHAYIRYKLWELYGNKTVPSLNGPIPAH
                     LLSNQWAQTWVGLLDFTEPFPGKPQLDVTQEMQKQGWTARRMFNVSEEFFTDLGLIGM
                     PEEFWKISMIEKPSDREVVCHASAEDFYDGIHFGIKQCTAVTMSDLLTVHQ"
     CDS             join(513165..513223,513286..513354,513440..513538,
                     513642..513764,513821..513987,514049..514377)
                     /codon_start=1
                     /gene="RvY_00196-1"
                     /gene_synonym="RvY_00196.1"
                     /locus_tag="RvY_00196"
                     /note="angiotensin-converting enzyme; M2_ACE"
                     /product="hypothetical protein"
                     /protein_id="GAU87322.1"
                     /transl_table=1
                     /translation="MYSTALKKIAFLPFGLVMDMYRYDVFNGKISMQELNRKWWEYVV
                     KYQGICHAVPRDESDFDPGAKFHTAADVPYMRYFVSFVIQFQFHEALCGVANHSGPLH
                     TCDIDGSKEAGAILGQALSLGSSKPWQEAMRIITGQDQMDAQPLLSYFKPLQDWLQAE
                     NRRLKQTVGWVEDASCIEDVTTMPTIPTVSTLSTVPSVSSSQTMFVSPITEPDAGGST
                     STDSSASRTTTPPPAATSPSAEVASTSTTNEPVESTTASAGSLSLPLLLHALALYALL
                     FCVRF"
     CDS             join(519354..519655,519964..520413,520481..520814)
                     /codon_start=1
                     /gene="RvY_00197-1"
                     /gene_synonym="RvY_00197.1"
                     /locus_tag="RvY_00197"
                     /product="hypothetical protein"
                     /protein_id="GAU87323.1"
                     /transl_table=1
                     /translation="MFSKNLAVFITVSLSFSAVCIYVLISFEQINDVFDFRLSGFASH
                     SHCGRTAKAEIICKEDAAQRTAPVCLGCNRLLEFGAESLDHKWQPFNCNMRTYSLTDL
                     RRAVEMLRSRTDRSHVGILLIGDSRMRQLQTGLHRFLLGQSNYKFTGFAEETPPSIFC
                     DRPDANQYHWFNETLQSCEFNRTFHSPNLSLARWWIPLLDAGTTKHRLQRLLDRGNGS
                     MPHVVVLSGGLWLIRDCWNRKIPFSDCMTQYRRNVTNLLPILGKVARHSVVLWTLEYP
                     VIWEPAAAQMNRKLEMLNDLLRKDLATSPVKIWESYSQAYDMGGDTPDGCHFGWKGLT
                     LLMQIFLNFLVDRVDTNDQHVCCSSQS"
     CDS             complement(join(520981..521119,521175..521296))
                     /codon_start=1
                     /gene="RvY_00198"
                     /gene_synonym="RvY_00198.3"
                     /locus_tag="RvY_00198-3"
                     /product="hypothetical protein"
                     /protein_id="GAU87324.1"
                     /transl_table=1
                     /translation="MVAPTSMALAVLYRELPHIYERLGRMDRCVEAYKVVIPTVENLM
                     DKYDQNTFDGLARLIVFHLERGEVGEAVPYIEKAWTRLQVIP"
     CDS             complement(join(521112..521119,521175..521535))
                     /codon_start=1
                     /gene="RvY_00198"
                     /gene_synonym="RvY_00198.2"
                     /locus_tag="RvY_00198-2"
                     /product="hypothetical protein"
                     /protein_id="GAU87325.1"
                     /transl_table=1
                     /translation="MKYSLCGYDCFRKGHETSLSYYELRCSPCNVKLKNPPICDLIGN
                     KTVKLTVRACPLSGLSEEQLIIKLDDVKSFVNESRRWSLQPAWPLRSFTVSCPISTKD
                     WAGWTDVSKRIKSLYLPLRI"
     CDS             complement(521149..521535)
                     /codon_start=1
                     /gene="RvY_00198"
                     /gene_synonym="RvY_00198.1"
                     /locus_tag="RvY_00198-1"
                     /product="hypothetical protein"
                     /protein_id="GAU87326.1"
                     /transl_table=1
                     /translation="MKYSLCGYDCFRKGHETSLSYYELRCSPCNVKLKNPPICDLIGN
                     KTVKLTVRACPLSGLSEEQLIIKLDDVKSFVNESRRWSLQPAWPLRSFTVSCPISTKD
                     WAGWTDVSKRIKSLYLPLSKLRDFTF"
     CDS             complement(521869..522240)
                     /codon_start=1
                     /gene="RvY_00199-1"
                     /gene_synonym="RvY_00199.1"
                     /locus_tag="RvY_00199"
                     /product="hypothetical protein"
                     /protein_id="GAU87327.1"
                     /transl_table=1
                     /translation="MSDAMATNLRQFGPFIDALADVARMTVCFYPEDASLSDAPVNVP
                     IAHANFLNKTTQPMCDRNAVFVPVTDPVNGLSLRIKTVKDIGAGEMVSRVTEGLEKKT
                     YKIVTVSGALFRSTTTKKCAT"
     CDS             complement(join(522360..522488,522666..522806))
                     /codon_start=1
                     /gene="RvY_00200-1"
                     /gene_synonym="RvY_00200.1"
                     /locus_tag="RvY_00200"
                     /product="hypothetical protein"
                     /protein_id="GAU87328.1"
                     /transl_table=1
                     /translation="MTSPGEDASLRKSFDEQGYMRERRAEGSTICTIKAAVAIVLDQY
                     LTTEKDWKAIHKDECPLLAILQKVCPDQPTDFARLFTRSCLHANV"
     CDS             join(524272..524318,524460..524854,524913..525362,
                     525715..525912,525973..526157,526236..526424,
                     526674..526961,527245..527359,527436..527556,
                     527646..527799,527949..528123,528408..528588,
                     528649..528767,529176..529632,530152..530389,
                     530540..530945,531131..531342,531409..531691,
                     531985..532405,532658..532924,533028..533226,
                     533428..533589,533814..533981,534168..534489,
                     534993..535189)
                     /codon_start=1
                     /gene="RvY_00201-1"
                     /gene_synonym="RvY_00201.1"
                     /locus_tag="RvY_00201"
                     /note="E3 ubiquitin-protein ligase TRIP12; TRIP12"
                     /product="hypothetical protein"
                     /protein_id="GAU87329.1"
                     /transl_table=1
                     /translation="MSSSSHRLKVFASSSGAASEQHADTFHRRRSQRLASKPCSTSRS
                     PSPADIVPKEAKKKKKKSEVVNQNQPSTSTVFSPRRTRSKGPRVQPVPSVKKLVLPSK
                     RAKEDTNSSSEASDEIPVVKSKKLARSTVTTKNQPSTSNQSSKPKVDSRKTRMGQNLV
                     KSKTVLSAEDSQEDNDTPSLEFPVPSTSGPVTRRQAKATTTKPKDSEEVEKGRTNPVA
                     KPGKEKEKDSSAKEEKRERPKQYAIRTGGPPGGHKNVARKSTASRPTTETSVNTTAPA
                     SLAAMAQNGGTGGRTGMSTDPSLATNIFTALGDIEALSAAGEDFDINRLQSLLEQRGI
                     SSSLFSSLGPRFQAMLGRIGSQGGGSTQCYNKSNQLIASLKNPDNSVQLAAAAEICQM
                     LVMGNEDTLHGFPIKQAVTALTAVISGESNYELVTQCIRALSSMMDSLPRSSAVVTTA
                     IPDLLTKLQSIEYIDVLEQTLVALEMLSRRHAKQILRANGVQSVLNYIEFFTDPAVQR
                     NALQITASCCSNLSVEEFEFVQPVLPLLSQRISLGTDKKCVEYTCVAFSRIAECFHND
                     ADKLREIASHGLLPNIQQLLMGYPAAISSQTFIMVLQMLTHICVSCPDLAAHLLDSNI
                     TDTLFYLLTGSSLHHNARVELSKSAKSPQEGYELIRLVGALLPSLPTDGIFAVDDLLK
                     KVGAGELTAKWFWKDDGNNWVAYTNAEAGIIENAFRTGQEDVMIDTPQAQYSIEFSGM
                     HQINEDTGTSREVKREDIKPSQRTSRGADVVIQSKDPNVATFISSIFSVLYEVYCTSA
                     GTAIRHKCSEALLKMVYHSSPELLYSVMINLPISSNIASNLATSDVKSVIYAVQLSDT
                     LMQKLPKIFSDHFRREGVVFQMNLCAKGESVLFKHQAEPSVLPAEERPAATMTLDNSS
                     ANSAPSSSSNVEPTASSNETSQNRKAAATTRRQSHRRQQLSQPPPATTRRRHNAGTGS
                     SSNPPSSSNNEGGSGDVASGESSGTSAASTLNKMASRIAVEGRAMLDRLSSLTGNGQG
                     GSASGPATPQSAAAGQAVYRQQAAEWIKTHAAKFLAEHFAALNSSQSGSSAQLMAAVD
                     KLKSEKEVSALKEIREVILDGHVSPFEVIHSNLIGTLLRYLTENEWLGEGETPSAGTV
                     VVKRAKRKARCEPKGTSRHLRLLRFMHIFFHCPAEHEVLNNFIDVFDVSNSIDSVPAF
                     KALVAKLNACVNQLEQFPVRLTDLTTSGLGGIGTSGGRHPIMRVFSQSQLKCQLSRHP
                     ECPGIRQWRGGMVRVEPLAPVYTIERYLVARGCARPATAEENALDTDEVSDEDELDAM
                     SMAAEAGRVNGRYRLELLYNNNVLPYNWSLYQCIRHFSRGAEEAEGDSDYHTGQLALF
                     TNTHTIHYRLNGEENVSHGSSEDTSQGVKGSVKTEKEEKQRSAYDTGVIPVVESTLDL
                     HLTSAIPDYVTVRDPSLEGLTLLRVLHGLNLHWSELYQPQAKVMPRLTDLDFHNAKLV
                     TKMNRQLQDPMMILTGQIPFWLQQVPVYAPFLFPFEPRLQLFFVTAFDKDRAMQRLLD
                     TNPELAANRTANQASQSSSQIDHMTPRIERKKETVTRKNLLMQTQSIMDMHAQSRKSL
                     EIQYHEEVGTGLGPTLEFYSMVSKEFQKRELGLWHSASDHKTTGAYVYAPCGLFPKPM
                     PSHTSKARVAEVEGKFRLLGKFMAKALTDFRMIDISCSPVFYKWLLGQESHLGLTDLA
                     HIDAEIFKQVEKLYRIARKKKWSDANSEVGDTKLECDDDEVLYDGVTVEDMCLTHVLP
                     GYEDIELCRGGRDKVVTLDNLESYINMVVYFYLRDGVHRQLEAFREAFDSVIRVKHLQ
                     LFRAEELDAVFCGHGDHLTEGWDVQTLRDTCRPDHGFTVESRAIQWLFSILSKYNAEE
                     RRNFVQFVTGSPKLPVGGFKALNPPFTVVKKVVGESQKPDQFLPSVMTCVNYLKLPDY
                     SSVEIMKKQIQMACKEGQHSFHLS"
     CDS             complement(join(536749..536873,536964..537138,
                     537239..537307,537400..537552,537626..537856))
                     /codon_start=1
                     /gene="RvY_00202"
                     /gene_synonym="RvY_00202.1"
                     /locus_tag="RvY_00202-1"
                     /product="hypothetical protein"
                     /protein_id="GAU87330.1"
                     /transl_table=1
                     /translation="MFRAIIHMIRHDGDPACMAFDGKVLPDVDTYLEFTDRPDAPIGT
                     RTVDKVKQQPRPRFYATHLGYEAVPKSILEKAKIIYVAGNPKDVIVSTYFFFSSLKPF
                     AFSGTLEDIAMSYINDKAPYTPFHKHVASFWKHRDRDNILFLTYEDTLMNCRATIDHV
                     AKFLGKNLTDEQLDNIVSLCSFDSMRKNKKVNKTTHAQLDHSASPFIRSGTYGNWKKH
                     FTIELNEAVDRWIKKEEHKVASDLEGFRFRCE"
     CDS             complement(join(537227..537307,537400..537552,
                     537626..537856))
                     /codon_start=1
                     /gene="RvY_00202"
                     /gene_synonym="RvY_00202.2"
                     /locus_tag="RvY_00202-2"
                     /product="hypothetical protein"
                     /protein_id="GAU87331.1"
                     /transl_table=1
                     /translation="MFRAIIHMIRHDGDPACMAFDGKVLPDVDTYLEFTDRPDAPIGT
                     RTVDKVKQQPRPRFYATHLGYEAVPKSILEKAKIIYVAGNPKDVIVSTYFFFSSLKPF
                     AFSGTLEDIAMSYINDKAPYTPFHKHVASFWKHRDRDNILFLTYEDTLMVRT"
     CDS             join(545366..545623,546930..547451)
                     /codon_start=1
                     /gene="RvY_00203-1"
                     /gene_synonym="RvY_00203.1"
                     /locus_tag="RvY_00203"
                     /note="putative transcription factor SOX-21; SOX1S"
                     /product="hypothetical protein"
                     /protein_id="GAU87332.1"
                     /transl_table=1
                     /translation="MDMTASPTSPKSSSGGSEKGEGHIKRPMNAFMVWSRGQRRKLAQ
                     ENPKMHNSEISKRLGAEWKMLSDAEKRPFIDEAKRLRALHMKEHPDYKYRPRRKPKTL
                     MKKDRPQFPYGVPFGVDPFRNFMAPQMHQVNDMDKARAAAFLPQMNGVNPYGNYYSAT
                     NEMAKLSEMAASSQASMMNGMNGVNPLYSSPFYHNAANSQMHPSMSAYLNHPSMQAAA
                     AVQNLTNVNQGNVMKAYEAVTQDSLRRPVPYSVFPGQYLRD"
     CDS             556041..556316
                     /codon_start=1
                     /gene="RvY_00204-1"
                     /gene_synonym="RvY_00204.1"
                     /locus_tag="RvY_00204"
                     /product="hypothetical protein"
                     /protein_id="GAU87333.1"
                     /transl_table=1
                     /translation="MKTIPRDAHPGQIPLPLNRLNNDPISSLQIHHMTDSTFGTKREY
                     RRGHAGYVLLVNQAYIASHYIIPIDVMHITNINLPNCVSGCLVQVCL"
     CDS             complement(558395..558703)
                     /codon_start=1
                     /gene="RvY_00205-1"
                     /gene_synonym="RvY_00205.1"
                     /locus_tag="RvY_00205"
                     /product="hypothetical protein"
                     /protein_id="GAU87334.1"
                     /transl_table=1
                     /translation="MAPRLRCVCSVLCWTEDQFFACLDIVAIYCQALVLSGFREVGRH
                     NRSVMSVYDRDRLMSASHLQSEPSARCHSSASSAQSTILEPSPKPHSVLSRPLGGTSR
                     "
     CDS             join(562181..562258,562490..563110)
                     /codon_start=1
                     /gene="RvY_00206"
                     /gene_synonym="RvY_00206.1"
                     /locus_tag="RvY_00206-1"
                     /note="twist; TWIST"
                     /product="hypothetical protein"
                     /protein_id="GAU87335.1"
                     /transl_table=1
                     /translation="MDMWNFNMDEKCESAYCAVPDVDDTDRQQCGVPDGHYLPEYSTS
                     SYETLSTCATPFSKPCKRRPSKKRKQPLSDNENGTASYQSTYPLSYKYSRSEGTPDVS
                     KASPSTQADLQEQRALANVRERQRTQSLNEAFTSLRKVVPTLPSDKLSKIQTLKLASR
                     YIDFLCHILQSPDGSLTYPAQSTPQDFEVMKHLLPPLPYGQSIGNASCFLVNDRLSYA
                     FSVWRMEGAWQSNM"
     CDS             join(562242..562258,562477..563110)
                     /codon_start=1
                     /gene="RvY_00206"
                     /gene_synonym="RvY_00206.2"
                     /locus_tag="RvY_00206-2"
                     /note="twist; TWIST"
                     /product="hypothetical protein"
                     /protein_id="GAU87336.1"
                     /transl_table=1
                     /translation="MWMILIAVFQRQQCGVPDGHYLPEYSTSSYETLSTCATPFSKPC
                     KRRPSKKRKQPLSDNENGTASYQSTYPLSYKYSRSEGTPDVSKASPSTQADLQEQRAL
                     ANVRERQRTQSLNEAFTSLRKVVPTLPSDKLSKIQTLKLASRYIDFLCHILQSPDGSL
                     TYPAQSTPQDFEVMKHLLPPLPYGQSIGNASCFLVNDRLSYAFSVWRMEGAWQSNM"
     CDS             join(564425..564449,565996..566498)
                     /codon_start=1
                     /gene="RvY_00207-1"
                     /gene_synonym="RvY_00207.1"
                     /locus_tag="RvY_00207"
                     /product="hypothetical protein"
                     /protein_id="GAU87337.1"
                     /transl_table=1
                     /translation="MDNMWASTIDIPQVCLNFSSVVASVNQIKAQTSALRVSLYSSGV
                     HWTIAQYQRHYGFPIYVLCILSAFVALIATLINCVWPPEDDMDSPPGSNYKVRKIRMR
                     VPQKHQRWSGYVYTHLESPRPGGDNVALVESSSGQSGMKNRRDDETMFDRGTMQFLQK
                     TITACEAQPQQPDYT"
     CDS             join(567345..567512,567584..567676,567878..568005,
                     568066..568156,568323..568748,569063..569125)
                     /codon_start=1
                     /gene="RvY_00208-1"
                     /gene_synonym="RvY_00208.1"
                     /locus_tag="RvY_00208"
                     /note="mitochondrial carnitine/acylcarnitine carrier
                     protein"
                     /product="hypothetical protein"
                     /protein_id="GAU87338.1"
                     /transl_table=1
                     /translation="MEEKPRMERIKWVDTASEPLEGHRAQRRVSPLKDFLAGGFGGTC
                     LVVVGHPLDTVKVRLQTMPKVAPGSVPLYTGTLDCFQKTIKQEGFRGLYKGMGAPLAG
                     VAPIFAVSFFGFGLGKKLLQKHPDEKLTALQLFQAGCLAGVFTTAIMAPGERIKSLLQ
                     VQHGQTQPKYSGPLDVVKKLYAEGGLKSVFRGTGATLLRDVPASGVYFMSYEWLKKAV
                     TPPGEDPSKINPLRSILAGGTAGILNWIVALPPDVLKSRLQTAAEGTYPNGMRDVFRE
                     LMREEGPRGLFKGITPVMLRAFPSNAACFLGYEVAMKFLNNAAPNL"
     CDS             complement(join(569178..569183,569253..569423,
                     569598..569805,569945..570063,570120..570122))
                     /codon_start=1
                     /gene="RvY_00209"
                     /gene_synonym="RvY_00209.2"
                     /locus_tag="RvY_00209-2"
                     /note="actin-related protein 2/3 complex subunit 4; ARPC4"
                     /product="hypothetical protein"
                     /protein_id="GAU87339.1"
                     /transl_table=1
                     /translation="MSATLRPYLNAVRATLTAALCVQNFDSQVVERHNKPEVEVRSSK
                     ELLLNPVVISRNEKERVLIEGSVNSVRVSIAIKQADEIEKLLCHKFMRFMAMRAENFS
                     IMRRKPIEGYDISFLITNFNTEQMYKHKLVDFVISFMEEIDKEISDMKLTLNARARIC
                     AEEFLKKF"
     CDS             complement(join(569178..569423,569598..569805,
                     569945..570063,570120..570122))
                     /codon_start=1
                     /gene="RvY_00209"
                     /gene_synonym="RvY_00209.1"
                     /locus_tag="RvY_00209-1"
                     /note="actin-related protein 2/3 complex subunit 4; ARPC4"
                     /product="hypothetical protein"
                     /protein_id="GAU87340.1"
                     /transl_table=1
                     /translation="MSATLRPYLNAVRATLTAALCVQNFDSQVVERHNKPEVEVRSSK
                     ELLLNPVVISRNEKERVLIEGSVNSVRVSIAIKQADEIEKLLCHKFMRFMAMRAENFS
                     IMRRKPIEGYDISFLITNFNTEQMYKHKLVDFVISFMEEIDKEISDMKLTLNARARIC
                     AEEFLKKASLIKQDKINQRIPVKISTSLLQF"
     CDS             join(571541..571759,571842..571964,572045..572476,
                     572552..572668,572874..573310,573402..573642)
                     /codon_start=1
                     /gene="RvY_00210-1"
                     /gene_synonym="RvY_00210.1"
                     /locus_tag="RvY_00210"
                     /product="hypothetical protein"
                     /protein_id="GAU87341.1"
                     /transl_table=1
                     /translation="MMDPSGPFDIFGLLKSSYPDGATTNTIPATVHVVLDEYLTSVCS
                     SCLKIHADDSKLLRCSRCSFLYYCSATCQKNDWTKSHRNECSILKIIQKTLTDQPTSL
                     ARLFVRMSLKVHEVASADRYRTPMPVSKFESNESWSPGVLKLFDSIANCKAVFLSWKP
                     FLEAVDHQFGCRASPSQSGQFMSALADMKGTAFPVYPPGNQKYNEKYNGNAPIGYGTF
                     QFKTAIPLCKRNIAFVTVVDPMLGPVLKTKAVRPLKAGDRQFFGNALDPLATPENQNL
                     HLIYPEDSHNQLQTTYPPHPMFNLSHRWELFCMYCKQATVKSLSDPWFGYSTMPVAGQ
                     EMLCTSCNRLFPCPQRFALFLSKLTELTTPSAREKMAPPKRPQTSLAYHMEMLQRMMP
                     LTHLMQESVPLVAKSSVAVGLIYRKMGQLAEESDDPDGMASAYRQLLPIVEKHLDKYD
                     QNVFDALARLIVYHLERREIAQGLVYLETAWDRLRFIPGEHSYDFYVVNKLLKAARCD
                     KKFSFERFCQVEPK"
     CDS             join(576700..576738,576843..577418)
                     /codon_start=1
                     /gene="RvY_00211"
                     /gene_synonym="RvY_00211.2"
                     /locus_tag="RvY_00211-2"
                     /product="hypothetical protein"
                     /protein_id="GAU87342.1"
                     /transl_table=1
                     /translation="MKMFDKAKKKIREEATWTLFWTSVIVGIGSGFYQGFNAAVINAP
                     QTTMGLWIRNIECAKHNQSKSPTVNDTERWCKVLSEKEQEKMFKENPTLNVIWTGIAS
                     IYTLGSVIGALSIIPICQRFGRFIEAILGPSTVYNIEPDLLNFQKGSVTLQRYTLYHF
                     LPSSRPVLRRTFLLDVSCWAIDQWFRCRSLCFHRHDLFDRNRTA"
     CDS             join(577327..577645,577721..577911,577992..578204,
                     578279..578542,578816..578971)
                     /codon_start=1
                     /gene="RvY_00211"
                     /gene_synonym="RvY_00211.1"
                     /locus_tag="RvY_00211-1"
                     /product="hypothetical protein"
                     /protein_id="GAU87343.1"
                     /transl_table=1
                     /translation="MLAAGRLINGFGAGVCASIATIYLTEIAPLSLRGLFGIIRGVCL
                     FGGQLCAQVLGHPSILGTSTLWPYLFGFGLLPALMQFVLLPFCPDSPCYLYLDRDSTK
                     KGTKALKRLRGDLVFEIELAELKNKQEFDAEANESVSVAGLFKDPFLRHCILIAVIMN
                     MGTELVGYSAILFYSTSVFLGSGMGQSAAVTATIGTGILMLVACIIVATFIDKVGRRI
                     VLLVGYVGMLVVTSAITVFIVLFETFVEKESEGKGDDEASKKNNPYIWTTYASAACVY
                     LFLVCYSVGPGIVPSVLASEMFTQGSRTAAVCFSIALSALAAFFVTVLFPLASSAIGG
                     YTFLVFVGLQVFYIFYAYFNVLETKGKESEEIVKDIRTQWERKKKS"
     CDS             join(579424..579453,579530..579861,581015..581418,
                     581478..581668,581751..581963,582502..582759,
                     582840..582995)
                     /codon_start=1
                     /gene="RvY_00212-1"
                     /gene_synonym="RvY_00212.1"
                     /locus_tag="RvY_00212"
                     /product="hypothetical protein"
                     /protein_id="GAU87344.1"
                     /transl_table=1
                     /translation="MFKAARKVFKETTWTLFWSSVVVSFGSGFFHGYNKEMVHAPQTA
                     MGLWIREIECRKRNASRSTNGSETELWCKVLSAKEQEKMFDKNPVLNVIWTGIASVYA
                     VGGVVGALAIFPVVQRYGRKRALLLNSIPCMAGSLTLSLAYMAKSYWMLVAGRLISGI
                     GAEICACVSEIYLTEISTVKQRGFFGTLRAVLLLGGQLTAQTMGHPDILGTATGWPIL
                     FAFSLIPAVLQLVFLLFCPDTPSYLFLDQKNEHKGKEALKRFRTASVYETELAELEYK
                     QKVDGDANKPVSLLGLWRDPFLRHCLLVSIVLNMGIELLGYTAILIYSTSIFIASGLN
                     LSAAVTATIGTTVLMLMASVLVALLIDRCGRRVLLLIGYTGMLVITSTVTVLAALLEK
                     YVQSDPQSGESSAKQNTPFIWTTYTSASCVYLFLVFYSLGPGEIPQVLASEMFTQGPR
                     AAAMCMSAAFTALAAFVISVVFPFVKSAIGGYAFVIFVVLQVNYVVFTYFKVPETKGK
                     QPEEIVKTLRDEWEKGKGE"
     CDS             complement(584030..584839)
                     /codon_start=1
                     /gene="RvY_00213-1"
                     /gene_synonym="RvY_00213.1"
                     /locus_tag="RvY_00213"
                     /product="hypothetical protein"
                     /protein_id="GAU87345.1"
                     /transl_table=1
                     /translation="MVVRRLPVLLPGGPMKEGFRKTGMYPFDAELLRGTVNPRLEVVE
                     HNEAQSEEYFADIAKILREKIRLSEDKTTSCLLEIRKIMTGESVGSVVAVQFCKNLLR
                     SAPQKKRCEKDCRLDVSNGRILTESAYISTKKAAMEKNKAKAKGLRNRKRNIQALEES
                     ATGCEDDSPATQEYPCQSPPKRQRKTAKQVAAEIANDVPAPQSLFDSPIDDPEVSPLK
                     TRAKRATARTKIAPAPRKKPSAPASKAKAKILLLPKTKPRASAVKSKAKNT"
     CDS             585106..585417
                     /codon_start=1
                     /gene="RvY_00214"
                     /gene_synonym="RvY_00214.2"
                     /locus_tag="RvY_00214-2"
                     /product="hypothetical protein"
                     /protein_id="GAU87346.1"
                     /transl_table=1
                     /translation="MGREVMTRYLEYNNHIAPFFFIGMKLRREDRFMPPHVDGCVNPG
                     ITKIHMPLLLNSPEHLFIQWLQESCLSRRENHYLDFLLMLHTCQEKGDTAQMRGMSVE
                     N"
     CDS             <585309..585629
                     /codon_start=1
                     /gene="RvY_00214"
                     /gene_synonym="RvY_00214.1"
                     /locus_tag="RvY_00214-1"
                     /product="hypothetical protein"
                     /protein_id="GAU87347.1"
                     /transl_table=1
                     /translation="LFVQKGEPLLGFPSHAPYMPGERRYSSDERNVRRKLIRSAKEQN
                     SQGLPWCHSGSAQWKVHETEGSIIATTVTRISLGQVMEDRNSFSRNSVSTSVSITPEE
                     FVPT"
     CDS             complement(join(585461..586032,586188..586587))
                     /codon_start=1
                     /gene="RvY_00215-1"
                     /gene_synonym="RvY_00215.1"
                     /locus_tag="RvY_00215"
                     /product="hypothetical protein"
                     /protein_id="GAU87348.1"
                     /transl_table=1
                     /translation="MSKFYLVFVMAANRSPVTSATSEDYPSAPAQLQSMDIPRKRRYV
                     QTHPDIEAAVTAVNDGMSIRMAAERYQIPHITLANKVNGKHGKKAGRPSTFTMEEEED
                     ITEILVRCSKIGVPLGKRTLIKIVKAIAIAKVYRPIAPEFSSEKPWSFCTGTERTELQ
                     EFEGMDRSALREWISLLQKLSNDGFLDDPNGIWNLDESGFRLAELYYKVYAERGVKEA
                     VGYLKSSESDRENISLLAMGSAAGKMLRPLILYKGKMHLESHFRETHDACYVGTNSSG
                     VMDTEVLTEFLEKEFLSSITCPKLILVTVVAIILPSVSCTFHCALPE"
     CDS             complement(join(587935..588068,588215..588518))
                     /codon_start=1
                     /gene="RvY_00216-1"
                     /gene_synonym="RvY_00216.1"
                     /locus_tag="RvY_00216"
                     /product="hypothetical protein"
                     /protein_id="GAU87349.1"
                     /transl_table=1
                     /translation="MSEGFKNKNRRTYTEESLKDTVRAMANRMTVRIASLTFGVPWMT
                     IVRYERSPMAQKQGRPTKLDETEEALLMDMLMAFGNSGFPMNKHDLRSFVDEIGFGED
                     RKKAREWTVEYAEDWINLLSHLQIEGYLSDPSAILWMYESEVE"
     CDS             complement(590009..590383)
                     /codon_start=1
                     /gene="RvY_00217"
                     /gene_synonym="RvY_00217.1"
                     /locus_tag="RvY_00217-1"
                     /product="hypothetical protein"
                     /protein_id="GAU87350.1"
                     /transl_table=1
                     /translation="MQVVLVQKSFQQKIKAWKMDFNVTFECNIEVTTKCMVTYDLLTS
                     VRPPIAPIVLCFRLNDLRRSIFFGISRGSSQLFSLRFQVTFTGSSDLALISRASVPFC
                     YAAARIREETSDIELHLYDVSV"
     CDS             complement(590009..590329)
                     /codon_start=1
                     /gene="RvY_00217"
                     /gene_synonym="RvY_00217.2"
                     /locus_tag="RvY_00217-2"
                     /product="hypothetical protein"
                     /protein_id="GAU87351.1"
                     /transl_table=1
                     /translation="MDFNVTFECNIEVTTKCMVTYDLLTSVRPPIAPIVLCFRLNDLR
                     RSIFFGISRGSSQLFSLRFQVTFTGSSDLALISRASVPFCYAAARIREETSDIELHLY
                     DVSV"
     CDS             593092..593268
                     /codon_start=1
                     /gene="RvY_00218-1"
                     /gene_synonym="RvY_00218.1"
                     /locus_tag="RvY_00218"
                     /product="hypothetical protein"
                     /protein_id="GAU87352.1"
                     /transl_table=1
                     /translation="MLEALRKKHPVDQPAIDEPMDDDVPAAAPVRAQEVRNAIFSFSL
                     GSAGEADGLRPQHL"
     CDS             join(593296..594067,594169..594362,594742..594930)
                     /codon_start=1
                     /gene="RvY_00219-1"
                     /gene_synonym="RvY_00219.1"
                     /locus_tag="RvY_00219"
                     /note="RT_nLTR_like"
                     /product="hypothetical protein"
                     /protein_id="GAU87353.1"
                     /transl_table=1
                     /translation="MSADLLEALAALTTHILNGKVPATICPFLYGASLTAFIKKDGGI
                     RSIAVGCTLRRLAGKVVSRVMAEMGAQLRPEQVGCGTRGSAEAAVHASRLFLSRINAE
                     CQVVLKLDFKNAFSTVFRGRLLAEVKKALPVYFNFVSHMYSQLSILVYGDQVLQSARG
                     VQQGDPLGPLLFCLVTEKLSKSRKSDFSCWYLDDATVGGDVDRVIVDFQRVVHHCEVL
                     GLELSMDKCEIFVFGGSRKEQLTTKSLAKAIFPTVTTLTTLRAFQHTWDLPIVEKNFS
                     EVLQASSSTEKARMLTVSTKESGAWLNSLPASCLGNLLDDDSLRISLVSRPTVLSVLR
                     LRACSKKSGRELRITREKEDPLNFSDSVLVWTYRGEMLPVFWEPFHSLAV"
     CDS             complement(596860..597072)
                     /codon_start=1
                     /gene="RvY_00220-1"
                     /gene_synonym="RvY_00220.1"
                     /locus_tag="RvY_00220"
                     /product="hypothetical protein"
                     /protein_id="GAU87354.1"
                     /transl_table=1
                     /translation="MKQALMTIHHVVQIIRATLTVCFIRSDTGKMTTVDSDEKVRKDG
                     SVQYGPAHVLKEDACVIPQCPSRVVA"
     CDS             complement(597610..597798)
                     /codon_start=1
                     /gene="RvY_00221-1"
                     /gene_synonym="RvY_00221.1"
                     /locus_tag="RvY_00221"
                     /product="hypothetical protein"
                     /protein_id="GAU87355.1"
                     /transl_table=1
                     /translation="MLASGKEASHVSPRTPFGRVFLSSGFASTTSSGSKIMVSDCMTL
                     TTSKRAVSSVFTTSNSVK"
     CDS             complement(join(598035..598163,598224..598301,
                     598377..598434,598505..598703,598791..599015,
                     599078..599133,599213..599417,599987..600614))
                     /codon_start=1
                     /gene="RvY_00222-1"
                     /gene_synonym="RvY_00222.1"
                     /locus_tag="RvY_00222"
                     /note="cAMP-dependent protein kinase catalytic subunit;
                     PKA"
                     /product="hypothetical protein"
                     /protein_id="GAU87356.1"
                     /transl_table=1
                     /translation="MVEEAVTSASLTIPSIKRPGSSRRTSSSFLPASASEEKDDAVES
                     TLQLGLRSKLKISQGNSTSGQPPGPAKLKLSAVKKPQPHVSWQSVEATSPQVVGQLVP
                     RLALSPVDNVTVQFAFVPKHAKTHAAAEASSTLTDIGVPEEISTVAAEALLFVPSHSS
                     KDKVGDVPVPATPRNRRRRDTTQLVGTSAEITQPKTAFSLDQFRWVKTIGTGTFGRVV
                     LCVRVADDDQDALTKKPKEKSYYAMKILRIADIFRLKQVEHIQNEKSILQSLIHPFIV
                     RLHWTHHDTCNLYMLMEFAAGGELFTYLRGVGRFNSATALFYASEILLALEYLHSLSI
                     VYRDLKPENVIFDQSGHVKITDFGFAKYLVDRAWTLCGTPEYLAPEIIQSRGYNKAVD
                     YWAFGILLYEMMAGHPPFFSENPIEIYQKILDGKVRWPKTFDLVAKDLIKKLLAADRT
                     KRLGNMKNGAEDIKAHRWFRSVNWTSCLNREIQPPNIPQVRHPGDASNFDDYDEGWLD
                     EEDLPVPAEQLDVFRDF"
     CDS             join(601702..601774,602608..602931,603006..603283)
                     /codon_start=1
                     /gene="RvY_00223-1"
                     /gene_synonym="RvY_00223.1"
                     /locus_tag="RvY_00223"
                     /product="hypothetical protein"
                     /protein_id="GAU87357.1"
                     /transl_table=1
                     /translation="MAANGSGELVHNYSTKSDSCLRPHLILFSLTSCKAFDETFPYGE
                     SYDYSIGPNYPWLADANRQGENFTWNATGNPAYECVAQTTKEMTAKLQNCFNTWIFQR
                     DQDHYSFGSFKRTVVCQPSSGVGLCSVQYGEVISPRRVKNRCESIIDDALGSREYLEN
                     CKELMLIKTAVDCVCTRRECKAPPARVQNASQISPTAALCGCSRITQSFITLLCAVLP
                     LMKFFG"
     CDS             complement(join(603932..603988,607520..607645,
                     607737..607991,608196..608228))
                     /codon_start=1
                     /gene="RvY_00224-1"
                     /gene_synonym="RvY_00224.1"
                     /locus_tag="RvY_00224"
                     /product="hypothetical protein"
                     /protein_id="GAU87358.1"
                     /transl_table=1
                     /translation="MAPGKPVDPDLASRELSGAKISVEVGLGRKTLLNRLRDFKARRS
                     KAVLDELTQEHKDNRVFWCLIQRELLLEKPTMFHEVIFSDEVRFNLHGGKIECWYLKG
                     ENRHDKDLQVPVATRIKGEIMLWGAITATGPVALIRLYCKNSGGRHSRHSALND"
     CDS             join(617682..617773,617897..618131,618599..618718)
                     /codon_start=1
                     /gene="RvY_00225-1"
                     /gene_synonym="RvY_00225.1"
                     /locus_tag="RvY_00225"
                     /product="hypothetical protein"
                     /protein_id="GAU87359.1"
                     /transl_table=1
                     /translation="MEYYMEYFLMSEPLFKMLLKLVTPLITYQSTILGTGITQTAAAH
                     SFAMSQTTISKIFKETTKAIYDALKDVYIGEPSKERWKKNAEKFEVMWNVPNFIGAID
                     GKHVQIKIVKGSSGGGECGKMGNLQGTNRPETYAGHLPDPSMLRAA"
     CDS             complement(join(619046..619224,621270..621339))
                     /codon_start=1
                     /gene="RvY_00226-1"
                     /gene_synonym="RvY_00226.1"
                     /locus_tag="RvY_00226"
                     /product="hypothetical protein"
                     /protein_id="GAU87360.1"
                     /transl_table=1
                     /translation="MSRGSDITSGNALGYNQTINSLHSSYITATLLNQDAAGHSTLRQ
                     KIDQAVAVFLYEEATRLGFPYRPDTPISTEEHNFDSIV"
     CDS             join(625774..625842,626762..626971)
                     /codon_start=1
                     /gene="RvY_00227-1"
                     /gene_synonym="RvY_00227.1"
                     /locus_tag="RvY_00227"
                     /product="hypothetical protein"
                     /protein_id="GAU87361.1"
                     /transl_table=1
                     /translation="MLENPKYLVHMDNAEVIQSFHSEDADEEASWRTFLCAPVKSSTS
                     AVFGAAFLVRHCRRRYQSTIRSVAFRGPDNYNITNTDRLWDVVAGVRR"
     CDS             complement(join(629736..629819,629900..630056,
                     630115..630594,630819..630890,630957..631098,
                     631176..631255,631312..631519,631703..631832))
                     /codon_start=1
                     /gene="RvY_00228-1"
                     /gene_synonym="RvY_00228.1"
                     /locus_tag="RvY_00228"
                     /product="hypothetical protein"
                     /protein_id="GAU87362.1"
                     /transl_table=1
                     /translation="MIPRSDLSLGQSMSSMDTSLTSGGSASNLSLAGKETGQLLSIKV
                     LRLLKPSFLENNNVFGQLHYLQDEFDAQGTSSEKFHLSDKGAELCPTKSLSSDWSFLL
                     SDQLVLPQSFGTMFLGQTLHCYICVSNGSNVTVRDITVRLEFQVQAAAAPRSELVLNE
                     GKQFTLEPNQTFDFVLNREIRDLGSHMMIASITFANPQNAVDRQNIKKCFRYNVVRPM
                     DFKNKFVSLPDGGYFGEFNIQNLTNCTIVLDSVKMITSPEYVAEELIPHNDLSLDEQL
                     ETRDFLGPNDSRQFVFRIPLKDRSRTGESMKSSASPGRVEILWRTKMGDLGKVTTSPL
                     TRAVPEPRDIFVTLSKRPARVKIHKVFAVTVTIFSLCNRPLDFILKMLDNPAERSFVW
                     CGVSGRPVGVLEPGGMLEVTLRVAPRSFGLHLFPRFCLLDKPTGQRYDSEDLAEIFVE
                     "
     CDS             complement(join(631945..632097,632381..632398))
                     /codon_start=1
                     /gene="RvY_00229-1"
                     /gene_synonym="RvY_00229.1"
                     /locus_tag="RvY_00229"
                     /product="hypothetical protein"
                     /protein_id="GAU87363.1"
                     /transl_table=1
                     /translation="MAEANKDGAEVAESYENVVVENPAALKRQSGFELGWTPESILAT
                     AHNSHPKLYVVK"
     CDS             join(632775..632795,632881..632979,633049..633107,
                     633206..633409,633619..633982)
                     /codon_start=1
                     /gene="RvY_00230-1"
                     /gene_synonym="RvY_00230.1"
                     /locus_tag="RvY_00230"
                     /note="N-terminal acetyltransferase complex ARD1 subunit
                     homolog A; K00670"
                     /product="hypothetical protein"
                     /protein_id="GAU87364.1"
                     /transl_table=1
                     /translation="MNIRCAKVSDLMNMQHCNLLCLPENYQLKYYMYHGLSWPQLSYI
                     AEDDNQRIVGYVLAKMEEDDDEPHGHITSLAVQREYRRLGLAQKLMNQTARAMVEVHN
                     CKYVSLHVRVSNRAAYHLYSVVLQFRTTETEPKYYADGEDAYAMRRDLVDWARQYGYK
                     PPHPEKFFAVEKKGRRQGKEKEPSGPPAVEAARTAMENLSVNAVASSENAKETGDQAV
                     ESTEKEVVKDDSAVNSDGQTATKKKNRRKK"
     CDS             complement(join(635348..635482,635845..636137,
                     636358..636507,636711..636871,637216..637327,
                     637625..637688,638003..638169,638321..638342))
                     /codon_start=1
                     /gene="RvY_00231-1"
                     /gene_synonym="RvY_00231.1"
                     /locus_tag="RvY_00231"
                     /note="AdhP"
                     /product="hypothetical protein"
                     /protein_id="GAU87365.1"
                     /transl_table=1
                     /translation="MSCASLTRQASTQSITSTSSMVGMRKISFSLSEERPFLDLAIPD
                     VPEDGVRIRVCYAGLCYVPGLNAAPFRKGSSGFRNGNVFDGFEVSGVIESMGSQVISH
                     DLAVGDPVTVFPDEEITQQGYADFLIVRKLNNIVKLPASISLAVGALLPTGGTLAMSA
                     VIHSQKQLERLVSVNGHCNILIFGAGSLTHWLVRLLRYSSSRIKDKIHIIVASDDWEG
                     LKIAQQLGAEEVVLLDERKHEERLIEKLQAILAKTIEMAVCLTHEERSQKRAARCLSQ
                     NGVLVIPEFSMAAESEMVTEKNLEVVEVPRGDVGILRTLVRIIDQGESLQANQPAYKV
                     YPMESAEKIYGEVELDEIKERPILDFEALENVF"
     CDS             join(641513..641569,643798..643848,643945..644001,
                     644324..644641,644892..645060,645160..645314,
                     645750..646161,646707..647015,647089..647240,
                     647509..647884,648095..648186,648245..648338,
                     648608..648775,649452..649707,649771..649894,
                     649959..650049,650940..651106)
                     /codon_start=1
                     /gene="RvY_00232"
                     /gene_synonym="RvY_00232.1"
                     /locus_tag="RvY_00232-1"
                     /note="vinculin; VCL"
                     /product="hypothetical protein"
                     /protein_id="GAU87366.1"
                     /transl_table=1
                     /translation="MPVFHTKTIESILEPVASQVSRLVILHEEAEDGGAMPDLEKPVR
                     AVSAAVENLVRVGHETINHSDDPILKQDMPSSLRRVTEASKTLEKASDMIKADPYSKQ
                     ARRFLIDGARGILQGTSSLLLCFDESEVRKIIRECKKVLDYLAVAEVIESMEDLVQFV
                     KDLSPSLTKVSHEVDARQKELTHQPHREILIRCLDSVKALAPILICSMKIFIQILQQG
                     GKGIEEAAENRNYLAQRMSDEINEIVRVLQLTTYDEDEWDADDISVMRKAFSAMESKM
                     QTAQDWLADPRALKGGVGEKALRQILDHALRVADRCLPADRDAIRKAVADISNMVDSL
                     AELRAEGKGTSPQAEALARGIAQRLTELSRTVGKAIQNAERSGIQQPAHTILGKLDQA
                     RRWLQAPWVDDKGLGQNAIKQITEEGRRIAKQCPEPHRTDLARLCDEVDQLSGQLADL
                     VRRGEGDSPQAKAIAQKLNEKLNELKNLIQSALLQRVVEDFVDVGTPLKQFTDAVLAP
                     EGTPNREGNFHDKARNLTEHALRAADTARMVAAGGSNQNKRAVEGLVNAANHIESLTP
                     QLVNAGKIRMEYPTNKAADEHFENLRKQFQDGMNNMRNLVDDQLDGAGHLKAIEEAMR
                     RHGRLCDDAIVQNNPQKMVDNTSAIARLANRALMVGKREADNSEDPHYVQKINGAADR
                     LQGAIAPMVQDAKAVAADTRNQPAANQWRSSNRNLLDAVGKLREAVTHEAQPPVPPMP
                     DMSQMNIGKHGYGGGHGDGANTAGYRGGHVGGPNAVGHMGPQIAPKPPGDFRGGYRSA
                     GEDDQAPPRPQPPNAQPAPPRPPPPGHRSEYETDDEDRDFDFPMPGENQPILAAAYGL
                     HQDVSQWSSKDNEIIAAAKRMALLMARLSQLVRGEGGNKKDLIDCAKQIAAASEDVTR
                     AAKKLARECTDKRMRTALLQVCERIPTIGTQLKILSTVKATMLGAQGSEEDQEATEML
                     VGNAQNLMQSVKDVVRVAEGASIKMRTDSGYKLRWARKRPWYT"
     CDS             join(641513..641569,643798..643848,643945..644001,
                     644324..644641,644892..645060,645160..645314,
                     645750..646161,646707..647015,647089..647240,
                     647509..647884,648095..648186,648245..648338,
                     649452..649707,649771..649894,649959..650049,
                     650283..650321,650940..651106)
                     /codon_start=1
                     /gene="RvY_00232"
                     /gene_synonym="RvY_00232.2"
                     /locus_tag="RvY_00232-2"
                     /note="vinculin; VCL"
                     /product="hypothetical protein"
                     /protein_id="GAU87367.1"
                     /transl_table=1
                     /translation="MPVFHTKTIESILEPVASQVSRLVILHEEAEDGGAMPDLEKPVR
                     AVSAAVENLVRVGHETINHSDDPILKQDMPSSLRRVTEASKTLEKASDMIKADPYSKQ
                     ARRFLIDGARGILQGTSSLLLCFDESEVRKIIRECKKVLDYLAVAEVIESMEDLVQFV
                     KDLSPSLTKVSHEVDARQKELTHQPHREILIRCLDSVKALAPILICSMKIFIQILQQG
                     GKGIEEAAENRNYLAQRMSDEINEIVRVLQLTTYDEDEWDADDISVMRKAFSAMESKM
                     QTAQDWLADPRALKGGVGEKALRQILDHALRVADRCLPADRDAIRKAVADISNMVDSL
                     AELRAEGKGTSPQAEALARGIAQRLTELSRTVGKAIQNAERSGIQQPAHTILGKLDQA
                     RRWLQAPWVDDKGLGQNAIKQITEEGRRIAKQCPEPHRTDLARLCDEVDQLSGQLADL
                     VRRGEGDSPQAKAIAQKLNEKLNELKNLIQSALLQRVVEDFVDVGTPLKQFTDAVLAP
                     EGTPNREGNFHDKARNLTEHALRAADTARMVAAGGSNQNKRAVEGLVNAANHIESLTP
                     QLVNAGKIRMEYPTNKAADEHFENLRKQFQDGMNNMRNLVDDQLDGAGHLKAIEEAMR
                     RHGRLCDDAIVQNNPQKMVDNTSAIARLANRALMVGKREADNSEDPHYVQKINGAADR
                     LQGAIAPMVQDAKAVAADTRNQPAANQWRSSNRNLLDAVGKLREAVTHEAQPPVPPMP
                     DMSQMNIAPPRPQPPNAQPAPPRPPPPGHRSEYETDDEDRDFDFPMPGENQPILAAAY
                     GLHQDVSQWSSKDNEIIAAAKRMALLMARLSQLVRGEGGNKKDLIDCAKQIAAASEDV
                     TRAAKKLARECTDKRMRTALLQVCERIPTIGTQLKILSTVKATMLGAQEPIPSPDGSE
                     IQCGSEEDQEATEMLVGNAQNLMQSVKDVVRVAEGASIKMRTDSGYKLRWARKRPWYT
                     "
     CDS             join(653924..653993,654286..654336,657551..657659,
                     658334..658556,658701..658883,659002..659082,
                     659467..659783,660042..660153,661037..661276,
                     661718..662296,662838..662998,663094..663196,
                     663476..663589)
                     /codon_start=1
                     /gene="RvY_00233-1"
                     /gene_synonym="RvY_00233.1"
                     /locus_tag="RvY_00233"
                     /note="SH3"
                     /product="hypothetical protein"
                     /protein_id="GAU87368.1"
                     /transl_table=1
                     /translation="MLPDKDRKMPVALNFLDLAEPRLADNLKHNGETLVKFIGVVADF
                     LQKSAAIYEQHGEELRSLVLQGRQQVDKLKQDGDFLIPSLLKTWDQMLNYTAITSDEN
                     IEMANKLSSDISIRLLNTTGHRKVQTQKLFEERSALESTVGQAEDQLYQAQKSYIEAY
                     GNFMLSNGNKAAEESQTKTRYLNSHNTYVLQLHRYNSIMEDYQTNVLPQWFQEVDSVC
                     TDVYSALCASLIDLNQRQGIKAVHESKRCEELIQMAKQVDSKTDLILFARGQDSVGSP
                     LGGRGKRLEFQPPAHSAQDGPKDEIVVDVNTSKVTRSTMDSLLADESNLEAQLKRQYQ
                     TLNDLLATQQKQLEMHLYSRVASIQEEISDVRKAIRLTKIRLSGLHGQLCILDCRYAS
                     RRASVNYLTPTELLPEPVMNPAGMKTRWRKAFFNLKRNGTLKREHEKLPADYSGSGNA
                     ATGSRTSSTQKSPKVKRNVFRTAMSSSELNVNGLKLNSSSSADKSAANNAAAIDVDPI
                     YLLLKQGGALNPRQKGGDTDSGLGSGSLTTSDRRPSRDSVVAGSSRHVMDRRNSSMSE
                     PESVEATTRTRGPMLNTRMKSISLDSPDQEVVMQGRPGRPVLERGQSTVGPLPKTASP
                     GNKRRILQMKGRGKSLDLGDGPGEVKSPETTAAPAQNVFVALQSYRCKGPDELELRPG
                     DRVVVVDSSKPDWWRGKCFSATGHFPSECVARVNPGERVCVVSHSLQLNENGTVLRLS
                     KNDIVMTTGPDEAGMVPIRCGGKRACCPLKYLQVLDYFEI"
     CDS             complement(join(664115..664276,664363..664547,
                     665082..665238,665315..665432,665776..666311))
                     /codon_start=1
                     /gene="RvY_00234-1"
                     /gene_synonym="RvY_00234.1"
                     /locus_tag="RvY_00234"
                     /product="hypothetical protein"
                     /protein_id="GAU87369.1"
                     /transl_table=1
                     /translation="MGRIQLPPEDYSHDNPLPLSTASDLGIEVSRSSCLSSEGLSPDY
                     TENYDGVSNHHFEPRHRRYSSSDLSALSSRSEPCCKINLLPLSADAATLEEGLVKKVY
                     PKEYGKTFQAFLFLLGGLLSSSLALAVVHDLQPMSLPLPDIVFRYVPQFDQGLELSEY
                     IIVFITYPTLIALLLHQHRSIIFRRVFLLTGILYFCRGITIFVTVLPQANLKYPCASR
                     ENSTSALMIVHRAVSLLSGLGMSINGRLVYCGDFIYSGHTCSLVLCCLVFNEYTPQNK
                     QIFRIAKRSLYLLATVGVLMISFSRTHYTVDIVIAYVITTMLFRIYHTIAAHAHLKEH
                     GENNYLSHAWWFRFVRHFEINVPEGKLPMRYNFPFECPTVIAQKWRAFRNR"
     CDS             complement(join(669348..669506,669784..669968,
                     670035..670191,670324..670441,670755..671341))
                     /codon_start=1
                     /gene="RvY_00235-1"
                     /gene_synonym="RvY_00235.1"
                     /locus_tag="RvY_00235"
                     /product="hypothetical protein"
                     /protein_id="GAU87370.1"
                     /transl_table=1
                     /translation="MGSCSGFHSRNSSRDNHVTSSALYIPLANLEDNATKLLHNSASS
                     PSLLVESENGSDSSEFLIKLEDNLSSCFRNVVIDFENEPSTRNDTPESKLVSLNGGHS
                     RQLSTSSTDDFRPSKLYPEERLKTLLAFVFLATCLFCTTLALATVHDRRPEGPPLPDV
                     IFSIVPQWDLGLAISEYLIMVCVYPVIAMAAFHRFRWILFRRIFTIVGILYLGRAVTM
                     LVTAVPVANTNYFCAPKMNITGPTTILFRAWTLMTGFGLSVNGKHIFCGDYIYSGHTC
                     MLVLCSLLYHEYLPRKGWLVKGLRAVFFTCAAMGVILVTISRGHYTVDVIIAYCVTTA
                     VFHTYHTIAAYSVLKTNSQNNHLARLWFFRLLAYFEENVPEGKLPVRFNWPLPWPQRY
                     LNWKLDFTE"
     CDS             complement(join(673696..673767,674164..674514,
                     674903..675061,675128..675385,675654..675881,
                     676081..676358,676468..676603,676677..677045,
                     677180..677372,677455..677535,677705..677877,
                     677950..678058,678127..678176))
                     /codon_start=1
                     /gene="RvY_00236"
                     /gene_synonym="RvY_00236.1"
                     /locus_tag="RvY_00236-1"
                     /note="transitional endoplasmic reticulum ATPase; CDC48"
                     /product="hypothetical protein"
                     /protein_id="GAU87371.1"
                     /transl_table=1
                     /translation="MASNNPPKEEPKAAPSQNPDDLATAILKQKDRPNRLLVEDAIND
                     DNSVVCMSQKKMDELQLFRGDTVLIKGKKRRDTVCIALTEDTVPDDKVRMNRVVRRNL
                     RVRLGDVVSVQSCPEVKYAKRVHILPIDDTIEGLTGNLFDVYLKPYFLEAYRPLRKGD
                     LFMVRGAMRSVEFKVVETDPSPYCIVAPDTVIHCEGEAIKREEEEESLNEVGYDDIGG
                     VRKQLAQIKEMVELPLRHPALFRTIGVKPPRGILLFGPPGTGKTLIARAVANETGAFF
                     FLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDSIAPKREKTHGEVERRI
                     VSQLLTLMDGLKQRSNVIIMAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEVLR
                     IHSKNMKLADDVDLERIAAETHGHVGADLAALCSEAALQQIREKMDLIDLEEETIDAQ
                     VLDSLAVTMENFRWALNKSSPSALRETVVEVPNVSWEDIGGLDNVKRELQELVQYPVE
                     HPEKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESE
                     ANVREIFDKARSAAPCVLFFDELDSIAKARGGNVGDAGGAADRVINQILTEMDGMNQK
                     KNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEGSRKAILTAALRKTPLAKDVDL
                     PYLAKVAHGFSGADLTEICQRACKMAIRECIEADMKAEKRRQENPDAMMDESDPVPEV
                     RKDHFEEAMRYARRSVSDADIRKYEMFAQTLQQSRGFGGQFKFPDGQGGPSQAGHGGA
                     GGGGGRGPNFQDVNDGDLYD"
     CDS             complement(join(674885..675061,675128..675385,
                     675654..675881,676081..676358,676468..676603,
                     676677..677045,677180..677372,677455..677535,
                     677705..677877,677950..678058,678127..678176))
                     /codon_start=1
                     /gene="RvY_00236"
                     /gene_synonym="RvY_00236.2"
                     /locus_tag="RvY_00236-2"
                     /note="transitional endoplasmic reticulum ATPase; CDC48"
                     /product="hypothetical protein"
                     /protein_id="GAU87372.1"
                     /transl_table=1
                     /translation="MASNNPPKEEPKAAPSQNPDDLATAILKQKDRPNRLLVEDAIND
                     DNSVVCMSQKKMDELQLFRGDTVLIKGKKRRDTVCIALTEDTVPDDKVRMNRVVRRNL
                     RVRLGDVVSVQSCPEVKYAKRVHILPIDDTIEGLTGNLFDVYLKPYFLEAYRPLRKGD
                     LFMVRGAMRSVEFKVVETDPSPYCIVAPDTVIHCEGEAIKREEEEESLNEVGYDDIGG
                     VRKQLAQIKEMVELPLRHPALFRTIGVKPPRGILLFGPPGTGKTLIARAVANETGAFF
                     FLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDSIAPKREKTHGEVERRI
                     VSQLLTLMDGLKQRSNVIIMAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEVLR
                     IHSKNMKLADDVDLERIAAETHGHVGADLAALCSEAALQQIREKMDLIDLEEETIDAQ
                     VLDSLAVTMENFRWALNKSSPSALRETVVEVPNVSWEDIGGLDNVKRELQELVQYPVE
                     HPEKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESE
                     ANVREIFDKARSAAPCVLFFDELDSIAKARGGNVGDAGGAADRVINQILTEMDGMNQK
                     KNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEGSRKAILTAALRKTPLAKASSK
                     Y"
     CDS             complement(join(679355..679887,680146..680783,
                     681031..681665))
                     /codon_start=1
                     /gene="RvY_00237-1"
                     /gene_synonym="RvY_00237.1"
                     /locus_tag="RvY_00237"
                     /product="hypothetical protein"
                     /protein_id="GAU87373.1"
                     /transl_table=1
                     /translation="MKASNICMMFSGLIFASFLVHIARADISYGILGCWRDHPSTKAT
                     FASVIATINRYVDGEPKRPGEVLQAVSQSVWPSHDVSAENMYCFDEEIHGQVAPEQRR
                     NFSNILSGFRPAIDIAINMTQFDAQSPQLGKSLHDIHLNVSYFFGTFLQVMDIEKGSL
                     YFREYTLILLGVQAELINFYRMVGDAREVSKWKDVLARDCYALSKYSYWFIRFMSKKM
                     ADNIVFDAYKLDNNQLGFSNQVNAKRLNEYDEPLSKCAANDNNNCIDYAFGFLKSARI
                     TARHKWQEYWRDVLQDFRKLLFKRYCLLDACQSDRYAEFLVHVGERVGLQFLASNGEN
                     AKFCSKDMCNTMWLSTAGNRDFLYYRPCFRDNPLELPGNQCAEDTWKICTRRGGCNPN
                     ILLTNNYYPLALRSMHNGLCVDCAETATWCKQGMCPVYVHNATRPFESADSCDDAPEN
                     CKGPQFQVHNFDRGVNEPLEILDEVHFTYASSKEGSPKFLSGDVYSGAFLRTQYYMRL
                     EERYTVSSKKTGITSGPYYCGIGKPWSMMNVEERAACGQSSYTLFRKIALENVISVMG
                     DGSITTDWNDDSSRRNERYRSRPSGNRVLTGDDAP"
     CDS             <683015..683260
                     /codon_start=1
                     /gene="RvY_00238-1"
                     /gene_synonym="RvY_00238.1"
                     /locus_tag="RvY_00238"
                     /product="hypothetical protein"
                     /protein_id="GAU87374.1"
                     /transl_table=1
                     /translation="LILINQVTIRVHVQTLQGGQLHHAILHGQVCYFYPVVPFAIFSE
                     MKNVELISEQGLKPAALPFPGFSQDKEDRVTDLRSVS"
     CDS             684939..685133
                     /codon_start=1
                     /gene="RvY_00239-1"
                     /gene_synonym="RvY_00239.1"
                     /locus_tag="RvY_00239"
                     /product="hypothetical protein"
                     /protein_id="GAU87375.1"
                     /transl_table=1
                     /translation="MAVYLRGRTRSVTVGGYYSADSEVRSGVPQGSVLSPRFFVVAVN
                     KLDLDKCELYQYADELVATS"
     CDS             join(686933..687173,687535..687812,687937..688266)
                     /codon_start=1
                     /gene="RvY_00240-1"
                     /gene_synonym="RvY_00240.1"
                     /locus_tag="RvY_00240"
                     /note="FN3"
                     /product="hypothetical protein"
                     /protein_id="GAU87376.1"
                     /transl_table=1
                     /translation="MCTELMATVESRNQLTKEPALHLRALNGSGVLHNGLGTHCDTLL
                     ESDNNFGFRLTLEHSVDSSTICALRGPTHLIKFPPEAVPSISEEDLTDKVVKAGSAIR
                     FDVRFNSGSLSEVIWSVSCAVLRNDSRTTIQPSDSLTKKAVMTIYPAQRADTGKYKLT
                     IRHVDTFIDEVTNVTSGVEVYVTSVPARPQGLLTVSHMSSTTARLKFKKPLDDGGQDI
                     SHYEFEKQEAGTGNWVPCGRTKDANETEGKVEGLTPGKKHLFRVRAVNGEGVGEPLES
                     STVCFC"
     CDS             689198..689380
                     /codon_start=1
                     /gene="RvY_00241-1"
                     /gene_synonym="RvY_00241.1"
                     /locus_tag="RvY_00241"
                     /product="hypothetical protein"
                     /protein_id="GAU87377.1"
                     /transl_table=1
                     /translation="MIGWKVVDTFPSKQGLPECRKMNTKLSKVAVASFGEVAGLPWLL
                     NALSLLPRDQKAQSVL"
     CDS             complement(join(690296..690415,690500..690578,
                     690655..690779,690853..690979,691053..691300,
                     691362..691505))
                     /codon_start=1
                     /gene="RvY_00242-1"
                     /gene_synonym="RvY_00242.1"
                     /locus_tag="RvY_00242"
                     /product="hypothetical protein"
                     /protein_id="GAU87378.1"
                     /transl_table=1
                     /translation="MPTFGQQGPAFKERMKLKQYGPNTSRFGMQYPPHRGTSRHPEFL
                     LGPDDLGFMDARKKIPGPRKGYQSLAHRKPRWIKTGFRRRAPTSVGPQLLLYELVKAM
                     PKRSPFGVTGERFPDAGEGAKESADVIPDPGFYDVTKVKIGRRIEAQHKLGHGASIPL
                     PFHVHCSHRRNERCHTCKSEVWCLPSYYTVPGRHLYLCPLCYFVERQMALTLKATTVA
                     KFKRVMDCASIHTHFPYSDKVLTHASTQEIKWLARKELYMHLHFPKRRDETAHAGVRH
                     FAAP"
     CDS             693093..693428
                     /codon_start=1
                     /gene="RvY_00243-1"
                     /gene_synonym="RvY_00243.1"
                     /locus_tag="RvY_00243"
                     /product="hypothetical protein"
                     /protein_id="GAU87379.1"
                     /transl_table=1
                     /translation="MANRREMFAPAFVFTPRLHQEGARVTVECQVRANPTPVARWYLN
                     DVDLAQSPHTAYLTCHPLDDNCFLLRMLIDHVSKEKSGLYRVTARNTVGEVTACINLD
                     FKSTLSKST"
     CDS             join(694916..694929,695526..695830,696742..697090,
                     697719..697920,698190..698607,698903..699132,
                     699210..699610,699865..700652,701004..702374,
                     702621..702912,703076..703210,703284..703450,
                     703532..703626,703932..704144,704238..704288,
                     705084..705118,705278..705381,705727..706155,
                     706541..707322,707384..707639,707879..708378,
                     708753..709176,709534..709871,710109..710385,
                     710595..710906,711287..711874,712185..712487,
                     712749..713345,713553..713852,714142..714729,
                     714953..715204,715436..716080,716332..717047,
                     717255..718011,718280..719255,719420..719868,
                     720063..720526,720770..721250,721525..722081,
                     722289..722925,723064..723722,723871..724489,
                     724546..725063,725146..725398,725639..726166,
                     726485..726986,727215..727367,727433..727556,
                     727918..728023,728155..728445,728725..729105,
                     729596..729993,730198..730786,731064..731180,
                     731253..731437)
                     /codon_start=1
                     /gene="RvY_00244"
                     /gene_synonym="RvY_00244.1"
                     /locus_tag="RvY_00244-1"
                     /note="putative myosin light chain kinase family member
                     4; S_TKc"
                     /product="hypothetical protein"
                     /protein_id="GAU87380.1"
                     /transl_table=1
                     /translation="MPPKVDVDGITPTFAQKPIIQQEDDGRRLMFECRVLADPLPTVT
                     WYHNEEEVHEGGRYTIIVDKDGNSYSICLEIDDVSVEDAGKYRVTAKNTLGEASANIA
                     LNFDSSAAPDAGRPVFTQKPVIRQSEDFSKILFECKVKGDPKPTLTWYQGSKALTAGA
                     KYAMIMSNMPSSDGTFDARLEIANAEAGDGGEYKVVASNSAGEGQATINLSFANADEE
                     AETGPSGVPRFTSKPAIRQEGTSLFMECNLSGDPKPDIKWFQGDSSVLASARHKMTLK
                     STGDNTYQAILTILDPEQSDAGQYRCNAKNSAGESNANIALNFGGPAEDPKDGKYAPK
                     FQEKPQILPGSDGSYVLLRVRVKANPAPTATWFLNMQPVDLDARRIAVVEPADAPEKY
                     TISLEIQEPDYRDGGTYRCIIANERGEITANLNLNIEAPPDEEEEGLFAPVFSGKPKI
                     IPSADGSKVTLEVRCRAEPEPKSLWKLGTTEIRKSSRHTIEDKIEYEEFVHRLIITNP
                     SKKDAGIYSCTLKNSVGESTAKLTLNIEGEDEPEGDKPKFIQQPKITMDGERVLVDFI
                     TESQEKPTVVWTFKNTEIRTSSTYSIRMETVKTSQYRGVLEISRITPELGGQYQVTIS
                     NAFGKLQGNVNLNVEPPKELIIEKPAVRTKKRTVVIQTTIVGASGQPDVAWYKGSQQI
                     RASGRYSSTVQQSSSEQTSYKCYLEITDASEQDVGEYKVVAKNGRKEVSETVRCTIND
                     VKQAQQMDEATMDVEETETTEMTETEVSESMEVEETPSKKRPADEEKASASKKKEVEA
                     DKKRSPEVSETEAAPAKRKTEETKAGGAAKKSDADQAVPKGKEASPEKRGGPSKEKSP
                     TPTPAKTATGKEADQKVPAGKAEDTAKPSARTPASDAKKPEDRTATETSSSSSARDTS
                     QSTQSKRTFDRSEPAKASQPETVVKPADDDYPSTKKPARRTSGGFDFGKSPSPPARTE
                     TRTSTQTTERTTTDSMRPDSLGSDKLQADIVRPTAGGLGRASQPEVASTTKPEVTSSQ
                     SEGTTNVRDAPGSRTEPSMLRNEISSTAKTDTGRTGPSTTTSTNKAEAGRAEPSMSKS
                     DTVTSRSDTSTSKTSTVPDRSEPSMSRAESSMGKPDTTPVAGRPEPAARGTPRRPESP
                     SPDARGMAPVRKEPSPPTARHSSRKESSPPFKMASNGTGAQPVAGPKPETLPASQSGT
                     ASSASTTTSTQKQPELPNTSSTNVRNVPSTTLSEPTASASASRKGSESVTSPAPTPAP
                     GSRRESAAAPTPAPAPAQTKPAGKTPEAVPAAGAPTTAKSSPTSTATPPKTEPGKTGA
                     TTAAPVADKPAAAKPGTTTTKPGETAKPADAAKPAAAKPGDLQPPKAVGPKLSLTPAQ
                     EDKMEAYPTLKPVAPGAKPAGEDKAGPKLAETTKPAATPALKPPAKKPEEPKPAAAKP
                     AAAKPAAAAKPSASPRPSIAEVPGANDPKPPYFSARIKPVAVKDGQSAEFTCKVKGNP
                     QPQVSWYKQDKLVEASDDFLITFDGQTATLKFVDCFPEDSGKITCTIKNEHGEESCSA
                     MLTVKAEEKRPEPKQEAKPSVPKTKKVSMAGIESDDEVSVSESGPRRPTSQPRKGSLG
                     PGGVRRDSADLSVSEDFGPGILKKLARPSVMVESPDTSRRASQANVQFIEPHASGGGK
                     LRPGEVADRRRRSSVDLRRQSVMEKLDIPSTPLVPKGPAGTAPTVDAPPNVQTTEDAT
                     AYFAVVVEGNPVPEIKWYKGTREVITEGRVMLKTDGTSNQAFLFIKKARHTDEGKYRV
                     VATNSVGSDEAEITLFVSAGGDAGMDFRALLQKRKYDKWGIEEEDPNWGDLKHLEQEK
                     IELKKRDAKKDHFMKELFDIRLKQGKDKLARFECVFSRPDQKPKWSKGKEEIFPGIKY
                     KIINEKDTHILELKDPKAEDSGQFICTIGDVSTKCYLQVDEPDPVVDFNPKLPKELHE
                     DKFKDGELMCKITVPKMSVKWLKNGTPIERGDKYDIQKDAVGRCILKIRKLNEGDSGE
                     YTCQYNDKIFTKCKFVVDQPIFKFTKPLKSIKATEKDDIVLECEVEDANAEVKWTKNG
                     KPIAPSDKHEIVIDGKKRKLIIKKADLTDEDKYQCKTNADTTESEVIVEPFNKVVKGL
                     KDQSLLTKETANFEVEFKDPKAPVHWFKDGVEIKPDARMEVKSTRGLHILTIKDLKIE
                     DAGRYEARVGALTSGCKLKVEEGETAPKINMAKTRMTAQVGQAHEFKVPYKVGGVKPS
                     KPIFHLLRNGKPVPAKDFDVVVDNDEIKVKLKTPQRGDEGDYTMKLLNSAGSDEVPIS
                     IKVEDVPAPPENLTVDAIHAEGCKLHWNPPKDDGGSPLTGYAVEVQEGKNGPWKPAGK
                     IEMIPPETMPAPTFAVTGLEPKKEYKFRIKALNAVGSSEPLTTPKGIIAKNPYDEPGE
                     PGKPEVTDWDKDHVDLQWAPPTNDGGAPIEKYIVEMKDKFSNNWVPAKEVPAGPAPVK
                     TTVDGLKEGGQYEFRVRAVNKAGPGNPSPPTKPILTKSRFIKPSIFVEDLGSIVVKAG
                     SVIRFDVRVGGEPFPEIIWYALGKPLKDNKRATIEISEQNKKTTIAIKAAERGDTGKY
                     KLTVRNINVRTGESAEVSAEGDVVVLGAPARPEGPLEVHDVTANNAKLKFKKPLDDGG
                     QDISHYEFEKQEAGTGNWVPCGRTKDANETEGKVEGLTPGKKYLFRVKAVNKEGAGEP
                     LETTTPILAKNPYDEPGKPGTPQVTDWDKDRVDLTWTAPTNDGGAPITSYIIEKKLKK
                     SKDWEKAIEVPVTPGSELKASVPDLKEKEEYEFRVRAVNKAGPGAPSDATKPVLVKTR
                     FLKPRIIRDKLVTTTIKVGQTFTFDVDIIGEPAPTTVWELNGKELLTDGMRTVKHEDY
                     KTHISNKKATRADAGKYIITATNSSGSDTAEVEVVVLGRPSRPEGPITIPETTDKSIK
                     MKWNPPKDDGGMPIDKYVIEKQDPKTGNWVPAGTVPGDTTEFTAEGLTPKQKYNFRIK
                     AVNKEGESEPLTTETAIVAKYPFDEPGKPGTPQVTDYDKDRVDLKWTAPESDGGSPIT
                     SYVIEKRLKGSKDWSKAAEVPAHKTEASVTDLPERQEFEFRVVAVNKAGPGEPSDASK
                     SVITKPKFLKPRIDRKNLKPITIKAGEAFAFECDVQGEPPPEKTWSLEPAKKGVKGGP
                     VGSRANVTNEDYKTKIAVKRAERADAGTYTITAKNDSGVDSATVEVVVLDKPLMPGGP
                     LEVNDIHAKHCDLKWNAPEDDGGSPIEAYEVEKYDVAAAKWVPIGRSKEPAFHVEGLE
                     PGHQYKFRVKAVNAQGPSEELVTDKPIVAKNPYDAPDAPNKPDITDWDKDHVDLKWTP
                     PKNDGGAPIEKYIIEKKEKNGEWEPAAEVPADQTTGTAPNLTEGKEYQFRVRAVNKGG
                     PGAPSEATEPKIAKPRHLAPKIDRKNLETLRVKAGQPIDFNVNVIGEPPPTTVWKLKG
                     KELRSDSRVKIDNKDYNTHLVIKSSKRGDTGKYVLTATNDSGTDSAEVEVVVLDAPAA
                     PEGPLKIEEIRKESCKLSWDKPVDDGGSDISHYAVEKMDMATGKWVKVGDAPGDATEF
                     AVEGLTPDHQYKFRVKAVNRQGESEPLTAETPITAKDPWVAPDAPGKPEVTDYDKDHV
                     DLKWAPPLNDGGAPVEKYLIEKKGKDGIWMPAAEVPGDQTTGTVPNLLDGQTYEFRVK
                     AVNKAGPGEPSTATQPFRVRPKHLAPSIDKTALREIKIKAGQPFNFDVPVIGEEPPKK
                     TWTLNDSPLNLDKDRNVTNEEYRTKLDVKNATRADSGTYTLTATNTSGTDTATVKVIV
                     LDKPTSPRGPLNVDDVTKDSCHLSWKAPEDDGGQDIHYVVEKQDQATGLWEPVTECKG
                     TNCDVGKLTPNHEYKFRVKAVNRQGESAPLVTQVPIEAKNPFDEPGKTSAPEVTDWAK
                     DHVDLKWNPPINDGGAPIEKYIIEKRKKNAPFWETAAEVPGDKTEGTAGGLKENDEYE
                     FRIVAVNKAGPGEPSDASRMVKCKPRNLAPTLDMSALKDIKVKAGQPIRFRVPISGEP
                     TPTSTWTVDGKPVKGDDRVEEEKKEDYVVLEIKNAKRSDKGKYTLTLENVNGTKAGSA
                     NVEVLDKPSAPEGPLKASDIHKEGCTLAWKAPEDDGGSEIVKYVVEKMDTSRGTWVDA
                     GETPDTKIKINKLTPNKEYAFRVKAVNAQGESIPLEIINPIVAKNPFDVPDAPGEPQI
                     VDFGPDHVDLSWIAPLNDGGAPITKYIIEKKAKYSPVWEKAAEIPGDKTSGTAPNLTE
                     GEEYEFRVIAVNEGGESEPSVVSKPVVAKHRRLPPKIKSNLRDIKLKAGQPLNIEVEF
                     VGAPMPEVTWVNGDKVLKVEPGKTMITTEEGRSRITIPMTERGDSGPWKLKLKNEFGV
                     DEANFTVTIMDKPQAPKGPLDVSEITKDSCKLKWNPPTDDGGVPLTGYVVEKRDTKRG
                     TWVPVATVAGTECRVPKLKEGEEYEFRVMAENSMGTSEPLLTTKPIVAKDPYSPPGEP
                     GQPEAVDTDRDHITIAWTPPETTGGSPITGYDVERKDEKGRWVKVNREPVRGTEFTDD
                     TVQPNKTYEYRVTAKNAAGPGKPSEVSKPIKAKPMKEAPKINLDGLLGKDIRVRAGEP
                     LTIDVPITGAPTPTCEWAKDGKVLTPGRGLELTSGEEQAKLYIPAAKKEDKGKYKLTV
                     FNIHGTADASINVIVLDKPDAPEGPLEYSDVTANSIKLAWKPPKENNGGEITGYVVEK
                     CPAGSTVWERVPGVAPGEKMTVKGLEEGKKYMFRVKAENLYGQSEPLVGGSVTAENPF
                     GAPDAPSAPEITDTTPKSIGLKWNKPKNDGGSPIQGYIVEKREPGVQDEWKPVNTKPI
                     IGTHYNVPNLDEGHGYEFRVIAVNDAGPGKPSKASELAIAQDTSRPDAPDTPKVDGTT
                     KDSVSLSWNKPINTGGSPIQGYIIEKKGPGDADFKPVNKSPVADTKFTVPGLTEGDEY
                     QFRVRAVNDAGESEPSKPVGPVKAENMPEKPHIDMGKIKDITVKAGQPFEIRVPYHGY
                     PQPTAEWIKVDALGNPKDVSDTDSRVLTKTSPDFTLLSVSPAKRSDTGVYKLTLKNRL
                     GQDTGSVRVTVLDRPAAPERLRADEIDIDNVTLRWNPPKDDGGEAVTNYVVEKRGPDG
                     VWTKVNNFVTGTTVKVRNLKTGTPYDFRVMAENSNGRSEPCLTEDAIIPKSPYGKPGA
                     PGTPVCVDSTPESISLQWSRPINDGGSPVQGYVVEKRDSPDGKWTKANVGLVTDNKFT
                     VTGLQENKPYEFRVAAVNEGGQGEYSNTSDEIYARPPPSAPKIDWDNFRMRDLVVREG
                     EPFKISIPFKGSPVPTVSWIVNGSPLFPSDRVVIETTDGKVAMLHNKSAKRADSGNYR
                     VSLVNDKGSDSASCTVTVVSAPQPPKGPLEPIETTPESIKLRWSPPEDDGGAPVSNYI
                     VEKCDAGSDKWVKVSSFVRSPEYDVRNLEENKKYKFRVRAENIYGISEPLETDKEITA
                     KHPFDTPGAPGTPDVTDIDSDSVSLQWTRPTTDGGSKILGYVVEGKHPGDRAWKPMGE
                     SKDTKFTVPHLHEGEEWEFRVRARNSAGPGAPSESTPAIIVRPRATVPSPPGMPEVVK
                     VGRSYIDLKWATPKNDGGSKIIGYRVERRDKNGYNWIRAHDYSTVQDTSVTVMNLIEG
                     SEYEFRVCAVNSVGESDFSLGTMPIKVKEPTDGTKPDIIKKFNNVTSSLGKPVTFTVE
                     AAGKPPVRVRWMRNGREITASPRVKMTEKDGVYTLHIAEVMETDAGDITCELSNAGGK
                     ESCTAQLRIIEPPKVVRYPDSVSLEEGESAKVKVFFQSETPCTARVFRDKQELKETDR
                     LKWTVFDDYVVILSKEMLVDDTGKYRVEIVNDSGSAECIFPLKVTGKPGAPTGPLRIT
                     DITQHQCTLFWRPPENDGGSKILNYVIERKDVSRENWVVASSYVKECTFTVQGLNENA
                     EYEFRVSAVNENGQGPPLNGDGPIVAKLPFDRPSAPGDPTVTEIGGDFVNLTWDKPSS
                     DGGGRLQGYYIEKREKGTDTWYRINPVPSLPTMFNVPNLIEDREYEFRVYAVNAAGLS
                     PPSSASKIIKVKDPNAPRAPEFIRPLRNVMATENKSATLECEIDGFPKPEVTWYKGSR
                     ELFDSGKYMQTVRGTTYQLIVSEVFGEDADEYSCRASNKGGNKTSRCDLVIKTAPKIF
                     LPLRFQDVAIFDKGEDIALKVPFTGYPHPEAIWRKDTEDIETQAHFKVETGERHAILT
                     IKGAAQEDNGNYRLIVRNELGEDTCVIKVQVNDKPDPPRFPVVENIWHDSITLSWKPP
                     HYDGGSPITNYVIEKKEHPGSSWIRASSTRVSYHTVTNLNPLTTYEFRVIAENLYGSS
                     GPSESTPPVETKEDEMKRRRRKRAEQKDGKKVRGKDEGKVGDYDKFVFNVHDKYGRKP
                     VDVKHDSVYQYYDILEEIGVGAFGVVHRCREKATGNIFAAKFVPVESQQEKQLIKKEI
                     DIMNQLHHQKLIHLHDAFEDDDEMVLIYEFMSGGELFERITAEDYTMSEAEVVNYMRQ
                     ICEAVRHMHDNNIVHLDLKPENIMCQTRKSTNVKVIDFGLATKLDPDSAVKITTGTAE
                     FAAPEIVDREPVGFYTDMWAVGVLAYVLLSGLSPFAGEDDVETLRNVKACDWNFEDEA
                     FAGVSEEGKDFIQKLLLKKKEARMTAAECLIHPWLLGETLNESNVVPRSRLIKMRNKM
                     RERYGDFWDKSVLPIGHIANYSALRKLYPDKYHVADTYFDRREAGPRFVIKPQSALAY
                     EGQSTKFYCRVVSLEPAVITWWQGTEELRQSVKYMKRYDGNDYYLIINRCKLDDKGEY
                     IVRAESAFGKREEVVFLNVQPLPHEELALPHMDIPKSKKNYDLVYDLVEQPKDTAPTF
                     SFGLRHRTIQRGIGVKLLCCFDGRPPATCVWSKDGREITKQNTSYNITTAHGVSTLEI
                     FACEPEDEGTYRCVASNSLGEFETSCKIFVQDRASGAGSSARRASAALTNGYDHSDSG
                     DALEKARKLRKDLAADVPVKPRSKDSSLPPASKDTSSKASTKSKELISDSAPAPAAGK
                     SSQPENTEPRFSQKLRSQKVKEGTSLMLEVKVNAVPTPKVQWFKDGNEEIVSGDIAQV
                     RYENGIASLAIAEILLEDGGEYICRASNSEGVDETSCVITVDAVRSKPQAAERQESAD
                     AVDDAGDVSASEPASTPAATPSSPKVPKAAPAEGESAPVFTRHLQSANCNDGDALTLE
                     CEISGEPAVDAVWLHNDREIKTGEDFKYVQEGNVFKLQIAEIFPEDFGTYTCEAFNAV
                     GEASSSCSVIVEVPGEEFLGPRFTTFPQSVTVEEGSPAVFEVNISSETPVRVEWCKVN
                     HLLEESERFKFRESGATFKLEMPTVLLTDIGLYMVKATNENGESSCVFTLHVKG"
     CDS             join(696449..696461,696742..697090,697719..697920,
                     698190..698607,698903..699132,699210..699610,
                     699865..700652,701004..702374,702621..702912,
                     703076..703210,703284..703450,703532..703626,
                     703932..704144,704238..704288,705084..705118,
                     705278..705381,705727..706155,706541..707322,
                     707384..707639,707879..708378,708753..709176,
                     709534..709871,710109..710385,710595..710906,
                     711287..711874,712185..712487,712749..713345,
                     713553..713852,714142..714729,714953..715204,
                     715436..716080,716332..717047,717255..718011,
                     718280..719255,719420..719868,720063..720526,
                     720770..721250,721525..722081,722289..722925,
                     723064..723722,723871..724489,724546..725063,
                     725146..725398,725639..726166,726485..726986,
                     727215..727367,727433..727556,727918..728023,
                     728155..728445,728725..729105,729596..729993,
                     730198..730786,731064..731180,731253..731437)
                     /codon_start=1
                     /gene="RvY_00244"
                     /gene_synonym="RvY_00244.2"
                     /locus_tag="RvY_00244-2"
                     /note="putative myosin light chain kinase family member
                     4; S_TKc"
                     /product="hypothetical protein"
                     /protein_id="GAU87381.1"
                     /transl_table=1
                     /translation="MSARGSAAPDAGRPVFTQKPVIRQSEDFSKILFECKVKGDPKPT
                     LTWYQGSKALTAGAKYAMIMSNMPSSDGTFDARLEIANAEAGDGGEYKVVASNSAGEG
                     QATINLSFANADEEAETGPSGVPRFTSKPAIRQEGTSLFMECNLSGDPKPDIKWFQGD
                     SSVLASARHKMTLKSTGDNTYQAILTILDPEQSDAGQYRCNAKNSAGESNANIALNFG
                     GPAEDPKDGKYAPKFQEKPQILPGSDGSYVLLRVRVKANPAPTATWFLNMQPVDLDAR
                     RIAVVEPADAPEKYTISLEIQEPDYRDGGTYRCIIANERGEITANLNLNIEAPPDEEE
                     EGLFAPVFSGKPKIIPSADGSKVTLEVRCRAEPEPKSLWKLGTTEIRKSSRHTIEDKI
                     EYEEFVHRLIITNPSKKDAGIYSCTLKNSVGESTAKLTLNIEGEDEPEGDKPKFIQQP
                     KITMDGERVLVDFITESQEKPTVVWTFKNTEIRTSSTYSIRMETVKTSQYRGVLEISR
                     ITPELGGQYQVTISNAFGKLQGNVNLNVEPPKELIIEKPAVRTKKRTVVIQTTIVGAS
                     GQPDVAWYKGSQQIRASGRYSSTVQQSSSEQTSYKCYLEITDASEQDVGEYKVVAKNG
                     RKEVSETVRCTINDVKQAQQMDEATMDVEETETTEMTETEVSESMEVEETPSKKRPAD
                     EEKASASKKKEVEADKKRSPEVSETEAAPAKRKTEETKAGGAAKKSDADQAVPKGKEA
                     SPEKRGGPSKEKSPTPTPAKTATGKEADQKVPAGKAEDTAKPSARTPASDAKKPEDRT
                     ATETSSSSSARDTSQSTQSKRTFDRSEPAKASQPETVVKPADDDYPSTKKPARRTSGG
                     FDFGKSPSPPARTETRTSTQTTERTTTDSMRPDSLGSDKLQADIVRPTAGGLGRASQP
                     EVASTTKPEVTSSQSEGTTNVRDAPGSRTEPSMLRNEISSTAKTDTGRTGPSTTTSTN
                     KAEAGRAEPSMSKSDTVTSRSDTSTSKTSTVPDRSEPSMSRAESSMGKPDTTPVAGRP
                     EPAARGTPRRPESPSPDARGMAPVRKEPSPPTARHSSRKESSPPFKMASNGTGAQPVA
                     GPKPETLPASQSGTASSASTTTSTQKQPELPNTSSTNVRNVPSTTLSEPTASASASRK
                     GSESVTSPAPTPAPGSRRESAAAPTPAPAPAQTKPAGKTPEAVPAAGAPTTAKSSPTS
                     TATPPKTEPGKTGATTAAPVADKPAAAKPGTTTTKPGETAKPADAAKPAAAKPGDLQP
                     PKAVGPKLSLTPAQEDKMEAYPTLKPVAPGAKPAGEDKAGPKLAETTKPAATPALKPP
                     AKKPEEPKPAAAKPAAAKPAAAAKPSASPRPSIAEVPGANDPKPPYFSARIKPVAVKD
                     GQSAEFTCKVKGNPQPQVSWYKQDKLVEASDDFLITFDGQTATLKFVDCFPEDSGKIT
                     CTIKNEHGEESCSAMLTVKAEEKRPEPKQEAKPSVPKTKKVSMAGIESDDEVSVSESG
                     PRRPTSQPRKGSLGPGGVRRDSADLSVSEDFGPGILKKLARPSVMVESPDTSRRASQA
                     NVQFIEPHASGGGKLRPGEVADRRRRSSVDLRRQSVMEKLDIPSTPLVPKGPAGTAPT
                     VDAPPNVQTTEDATAYFAVVVEGNPVPEIKWYKGTREVITEGRVMLKTDGTSNQAFLF
                     IKKARHTDEGKYRVVATNSVGSDEAEITLFVSAGGDAGMDFRALLQKRKYDKWGIEEE
                     DPNWGDLKHLEQEKIELKKRDAKKDHFMKELFDIRLKQGKDKLARFECVFSRPDQKPK
                     WSKGKEEIFPGIKYKIINEKDTHILELKDPKAEDSGQFICTIGDVSTKCYLQVDEPDP
                     VVDFNPKLPKELHEDKFKDGELMCKITVPKMSVKWLKNGTPIERGDKYDIQKDAVGRC
                     ILKIRKLNEGDSGEYTCQYNDKIFTKCKFVVDQPIFKFTKPLKSIKATEKDDIVLECE
                     VEDANAEVKWTKNGKPIAPSDKHEIVIDGKKRKLIIKKADLTDEDKYQCKTNADTTES
                     EVIVEPFNKVVKGLKDQSLLTKETANFEVEFKDPKAPVHWFKDGVEIKPDARMEVKST
                     RGLHILTIKDLKIEDAGRYEARVGALTSGCKLKVEEGETAPKINMAKTRMTAQVGQAH
                     EFKVPYKVGGVKPSKPIFHLLRNGKPVPAKDFDVVVDNDEIKVKLKTPQRGDEGDYTM
                     KLLNSAGSDEVPISIKVEDVPAPPENLTVDAIHAEGCKLHWNPPKDDGGSPLTGYAVE
                     VQEGKNGPWKPAGKIEMIPPETMPAPTFAVTGLEPKKEYKFRIKALNAVGSSEPLTTP
                     KGIIAKNPYDEPGEPGKPEVTDWDKDHVDLQWAPPTNDGGAPIEKYIVEMKDKFSNNW
                     VPAKEVPAGPAPVKTTVDGLKEGGQYEFRVRAVNKAGPGNPSPPTKPILTKSRFIKPS
                     IFVEDLGSIVVKAGSVIRFDVRVGGEPFPEIIWYALGKPLKDNKRATIEISEQNKKTT
                     IAIKAAERGDTGKYKLTVRNINVRTGESAEVSAEGDVVVLGAPARPEGPLEVHDVTAN
                     NAKLKFKKPLDDGGQDISHYEFEKQEAGTGNWVPCGRTKDANETEGKVEGLTPGKKYL
                     FRVKAVNKEGAGEPLETTTPILAKNPYDEPGKPGTPQVTDWDKDRVDLTWTAPTNDGG
                     APITSYIIEKKLKKSKDWEKAIEVPVTPGSELKASVPDLKEKEEYEFRVRAVNKAGPG
                     APSDATKPVLVKTRFLKPRIIRDKLVTTTIKVGQTFTFDVDIIGEPAPTTVWELNGKE
                     LLTDGMRTVKHEDYKTHISNKKATRADAGKYIITATNSSGSDTAEVEVVVLGRPSRPE
                     GPITIPETTDKSIKMKWNPPKDDGGMPIDKYVIEKQDPKTGNWVPAGTVPGDTTEFTA
                     EGLTPKQKYNFRIKAVNKEGESEPLTTETAIVAKYPFDEPGKPGTPQVTDYDKDRVDL
                     KWTAPESDGGSPITSYVIEKRLKGSKDWSKAAEVPAHKTEASVTDLPERQEFEFRVVA
                     VNKAGPGEPSDASKSVITKPKFLKPRIDRKNLKPITIKAGEAFAFECDVQGEPPPEKT
                     WSLEPAKKGVKGGPVGSRANVTNEDYKTKIAVKRAERADAGTYTITAKNDSGVDSATV
                     EVVVLDKPLMPGGPLEVNDIHAKHCDLKWNAPEDDGGSPIEAYEVEKYDVAAAKWVPI
                     GRSKEPAFHVEGLEPGHQYKFRVKAVNAQGPSEELVTDKPIVAKNPYDAPDAPNKPDI
                     TDWDKDHVDLKWTPPKNDGGAPIEKYIIEKKEKNGEWEPAAEVPADQTTGTAPNLTEG
                     KEYQFRVRAVNKGGPGAPSEATEPKIAKPRHLAPKIDRKNLETLRVKAGQPIDFNVNV
                     IGEPPPTTVWKLKGKELRSDSRVKIDNKDYNTHLVIKSSKRGDTGKYVLTATNDSGTD
                     SAEVEVVVLDAPAAPEGPLKIEEIRKESCKLSWDKPVDDGGSDISHYAVEKMDMATGK
                     WVKVGDAPGDATEFAVEGLTPDHQYKFRVKAVNRQGESEPLTAETPITAKDPWVAPDA
                     PGKPEVTDYDKDHVDLKWAPPLNDGGAPVEKYLIEKKGKDGIWMPAAEVPGDQTTGTV
                     PNLLDGQTYEFRVKAVNKAGPGEPSTATQPFRVRPKHLAPSIDKTALREIKIKAGQPF
                     NFDVPVIGEEPPKKTWTLNDSPLNLDKDRNVTNEEYRTKLDVKNATRADSGTYTLTAT
                     NTSGTDTATVKVIVLDKPTSPRGPLNVDDVTKDSCHLSWKAPEDDGGQDIHYVVEKQD
                     QATGLWEPVTECKGTNCDVGKLTPNHEYKFRVKAVNRQGESAPLVTQVPIEAKNPFDE
                     PGKTSAPEVTDWAKDHVDLKWNPPINDGGAPIEKYIIEKRKKNAPFWETAAEVPGDKT
                     EGTAGGLKENDEYEFRIVAVNKAGPGEPSDASRMVKCKPRNLAPTLDMSALKDIKVKA
                     GQPIRFRVPISGEPTPTSTWTVDGKPVKGDDRVEEEKKEDYVVLEIKNAKRSDKGKYT
                     LTLENVNGTKAGSANVEVLDKPSAPEGPLKASDIHKEGCTLAWKAPEDDGGSEIVKYV
                     VEKMDTSRGTWVDAGETPDTKIKINKLTPNKEYAFRVKAVNAQGESIPLEIINPIVAK
                     NPFDVPDAPGEPQIVDFGPDHVDLSWIAPLNDGGAPITKYIIEKKAKYSPVWEKAAEI
                     PGDKTSGTAPNLTEGEEYEFRVIAVNEGGESEPSVVSKPVVAKHRRLPPKIKSNLRDI
                     KLKAGQPLNIEVEFVGAPMPEVTWVNGDKVLKVEPGKTMITTEEGRSRITIPMTERGD
                     SGPWKLKLKNEFGVDEANFTVTIMDKPQAPKGPLDVSEITKDSCKLKWNPPTDDGGVP
                     LTGYVVEKRDTKRGTWVPVATVAGTECRVPKLKEGEEYEFRVMAENSMGTSEPLLTTK
                     PIVAKDPYSPPGEPGQPEAVDTDRDHITIAWTPPETTGGSPITGYDVERKDEKGRWVK
                     VNREPVRGTEFTDDTVQPNKTYEYRVTAKNAAGPGKPSEVSKPIKAKPMKEAPKINLD
                     GLLGKDIRVRAGEPLTIDVPITGAPTPTCEWAKDGKVLTPGRGLELTSGEEQAKLYIP
                     AAKKEDKGKYKLTVFNIHGTADASINVIVLDKPDAPEGPLEYSDVTANSIKLAWKPPK
                     ENNGGEITGYVVEKCPAGSTVWERVPGVAPGEKMTVKGLEEGKKYMFRVKAENLYGQS
                     EPLVGGSVTAENPFGAPDAPSAPEITDTTPKSIGLKWNKPKNDGGSPIQGYIVEKREP
                     GVQDEWKPVNTKPIIGTHYNVPNLDEGHGYEFRVIAVNDAGPGKPSKASELAIAQDTS
                     RPDAPDTPKVDGTTKDSVSLSWNKPINTGGSPIQGYIIEKKGPGDADFKPVNKSPVAD
                     TKFTVPGLTEGDEYQFRVRAVNDAGESEPSKPVGPVKAENMPEKPHIDMGKIKDITVK
                     AGQPFEIRVPYHGYPQPTAEWIKVDALGNPKDVSDTDSRVLTKTSPDFTLLSVSPAKR
                     SDTGVYKLTLKNRLGQDTGSVRVTVLDRPAAPERLRADEIDIDNVTLRWNPPKDDGGE
                     AVTNYVVEKRGPDGVWTKVNNFVTGTTVKVRNLKTGTPYDFRVMAENSNGRSEPCLTE
                     DAIIPKSPYGKPGAPGTPVCVDSTPESISLQWSRPINDGGSPVQGYVVEKRDSPDGKW
                     TKANVGLVTDNKFTVTGLQENKPYEFRVAAVNEGGQGEYSNTSDEIYARPPPSAPKID
                     WDNFRMRDLVVREGEPFKISIPFKGSPVPTVSWIVNGSPLFPSDRVVIETTDGKVAML
                     HNKSAKRADSGNYRVSLVNDKGSDSASCTVTVVSAPQPPKGPLEPIETTPESIKLRWS
                     PPEDDGGAPVSNYIVEKCDAGSDKWVKVSSFVRSPEYDVRNLEENKKYKFRVRAENIY
                     GISEPLETDKEITAKHPFDTPGAPGTPDVTDIDSDSVSLQWTRPTTDGGSKILGYVVE
                     GKHPGDRAWKPMGESKDTKFTVPHLHEGEEWEFRVRARNSAGPGAPSESTPAIIVRPR
                     ATVPSPPGMPEVVKVGRSYIDLKWATPKNDGGSKIIGYRVERRDKNGYNWIRAHDYST
                     VQDTSVTVMNLIEGSEYEFRVCAVNSVGESDFSLGTMPIKVKEPTDGTKPDIIKKFNN
                     VTSSLGKPVTFTVEAAGKPPVRVRWMRNGREITASPRVKMTEKDGVYTLHIAEVMETD
                     AGDITCELSNAGGKESCTAQLRIIEPPKVVRYPDSVSLEEGESAKVKVFFQSETPCTA
                     RVFRDKQELKETDRLKWTVFDDYVVILSKEMLVDDTGKYRVEIVNDSGSAECIFPLKV
                     TGKPGAPTGPLRITDITQHQCTLFWRPPENDGGSKILNYVIERKDVSRENWVVASSYV
                     KECTFTVQGLNENAEYEFRVSAVNENGQGPPLNGDGPIVAKLPFDRPSAPGDPTVTEI
                     GGDFVNLTWDKPSSDGGGRLQGYYIEKREKGTDTWYRINPVPSLPTMFNVPNLIEDRE
                     YEFRVYAVNAAGLSPPSSASKIIKVKDPNAPRAPEFIRPLRNVMATENKSATLECEID
                     GFPKPEVTWYKGSRELFDSGKYMQTVRGTTYQLIVSEVFGEDADEYSCRASNKGGNKT
                     SRCDLVIKTAPKIFLPLRFQDVAIFDKGEDIALKVPFTGYPHPEAIWRKDTEDIETQA
                     HFKVETGERHAILTIKGAAQEDNGNYRLIVRNELGEDTCVIKVQVNDKPDPPRFPVVE
                     NIWHDSITLSWKPPHYDGGSPITNYVIEKKEHPGSSWIRASSTRVSYHTVTNLNPLTT
                     YEFRVIAENLYGSSGPSESTPPVETKEDEMKRRRRKRAEQKDGKKVRGKDEGKVGDYD
                     KFVFNVHDKYGRKPVDVKHDSVYQYYDILEEIGVGAFGVVHRCREKATGNIFAAKFVP
                     VESQQEKQLIKKEIDIMNQLHHQKLIHLHDAFEDDDEMVLIYEFMSGGELFERITAED
                     YTMSEAEVVNYMRQICEAVRHMHDNNIVHLDLKPENIMCQTRKSTNVKVIDFGLATKL
                     DPDSAVKITTGTAEFAAPEIVDREPVGFYTDMWAVGVLAYVLLSGLSPFAGEDDVETL
                     RNVKACDWNFEDEAFAGVSEEGKDFIQKLLLKKKEARMTAAECLIHPWLLGETLNESN
                     VVPRSRLIKMRNKMRERYGDFWDKSVLPIGHIANYSALRKLYPDKYHVADTYFDRREA
                     GPRFVIKPQSALAYEGQSTKFYCRVVSLEPAVITWWQGTEELRQSVKYMKRYDGNDYY
                     LIINRCKLDDKGEYIVRAESAFGKREEVVFLNVQPLPHEELALPHMDIPKSKKNYDLV
                     YDLVEQPKDTAPTFSFGLRHRTIQRGIGVKLLCCFDGRPPATCVWSKDGREITKQNTS
                     YNITTAHGVSTLEIFACEPEDEGTYRCVASNSLGEFETSCKIFVQDRASGAGSSARRA
                     SAALTNGYDHSDSGDALEKARKLRKDLAADVPVKPRSKDSSLPPASKDTSSKASTKSK
                     ELISDSAPAPAAGKSSQPENTEPRFSQKLRSQKVKEGTSLMLEVKVNAVPTPKVQWFK
                     DGNEEIVSGDIAQVRYENGIASLAIAEILLEDGGEYICRASNSEGVDETSCVITVDAV
                     RSKPQAAERQESADAVDDAGDVSASEPASTPAATPSSPKVPKAAPAEGESAPVFTRHL
                     QSANCNDGDALTLECEISGEPAVDAVWLHNDREIKTGEDFKYVQEGNVFKLQIAEIFP
                     EDFGTYTCEAFNAVGEASSSCSVIVEVPGEEFLGPRFTTFPQSVTVEEGSPAVFEVNI
                     SSETPVRVEWCKVNHLLEESERFKFRESGATFKLEMPTVLLTDIGLYMVKATNENGES
                     SCVFTLHVKG"
     CDS             complement(730386..>731069)
                     /codon_start=1
                     /gene="RvY_00245-1"
                     /gene_synonym="RvY_00245.1"
                     /locus_tag="RvY_00245"
                     /product="hypothetical protein"
                     /protein_id="GAU87382.1"
                     /transl_table=1
                     /translation="LVLQSKIPCCFYRSHGSSANKLDMLIFPCGARLRVSSIKMCATW
                     KKTKRTRRDRFPKWRTFPVLLAGSVRHWGLKTARVSFVVFPTSFMACGGLPSTMTEQL
                     LLASPTALNASQVYVPKSSGKISAICSLKTLPSWTYLKSSPVLISLSLCSQTASTAGS
                     PLISHSNVRASPSLQLALCRWRVKTGADSPSAGAALGTLGEDGVAAGVEAGSEAETSP
                     ASSTASADS"
     CDS             complement(734828..735025)
                     /codon_start=1
                     /gene="RvY_00246-1"
                     /gene_synonym="RvY_00246.1"
                     /locus_tag="RvY_00246"
                     /product="hypothetical protein"
                     /protein_id="GAU87383.1"
                     /transl_table=1
                     /translation="MEVLKCKITEGKVPFDTPKSPSGGQVCVMKCRNVATVSVPTNAR
                     KWFSVSRHNKRLPTKRNTRNI"
     CDS             join(736987..736991,737058..737129,737198..737281,
                     737384..737455,737557..737625,737876..737947,
                     738053..738124,738192..738555)
                     /codon_start=1
                     /gene="RvY_00247"
                     /gene_synonym="RvY_00247.4"
                     /locus_tag="RvY_00247-4"
                     /product="hypothetical protein"
                     /protein_id="GAU87384.1"
                     /transl_table=1
                     /translation="MLYFSDNQLVDWEPEAFKGNNDLYWVDVRKNQLQLQKKNMLLYL
                     ATHCSSKCHLEFDHNNITSVTQSTFLNFTTFYLLSLADNKISEIHENSLSHLVLHGLI
                     LKGNRIEQFPPRLLAGQTKLVDLYMGHNPIQYLAENFFDGLSHLKLLNLSGLTIWNIS
                     SRMFGDKDLNIDHMWETSKKCLIFTCTTIAFLTAYFQRCTTVGMHLTSKTVTHDTMAS
                     PARRTYWTTRLCGYSAGPLPSLQSPSTSSSYLPDATSGKDPANCTRFSPCV"
     CDS             join(738339..738567,738686..738814,738904..739047,
                     740048..740424)
                     /codon_start=1
                     /gene="RvY_00247"
                     /gene_synonym="RvY_00247.3"
                     /locus_tag="RvY_00247-3"
                     /product="hypothetical protein"
                     /protein_id="GAU87385.1"
                     /transl_table=1
                     /translation="MYYCGYASHIQDCYPRHDGISSTKNLLDNSALRIFSWSIAVLAI
                     SFNLFVIFARCYLWQGSSELHKVQSLCITALAVADLIMGLYMLIISVTDQIYKGRYHL
                     YSHLWSRSILCRFSGLLAVVSSEVSALLLVFMALERYTLLVWNPFHRSEASIRNTMTW
                     IAGCWIIGSNGSSTTLSSRYTITNFNGQSVTFSRQNSSQMQLTARIRKEPLQGRRSNP
                     VTQRQAPLLAPPLSALLTTGPIMTDSNVKESSFSVPKLNDTQTADLDTDEDQGIVVLN
                     TSNAEEPLTSSPKWDW"
     CDS             join(738945..739047,739287..739649,739734..739973,
                     740048..740424)
                     /codon_start=1
                     /gene="RvY_00247"
                     /gene_synonym="RvY_00247.1"
                     /locus_tag="RvY_00247-1"
                     /product="hypothetical protein"
                     /protein_id="GAU87386.1"
                     /transl_table=1
                     /translation="MALERYTLLVWNPFHRSEASIRNTMTWIAGCWIIGGAAALFPLV
                     LDYGNIDAGYQPFYGQNGVCLPLYIHEPYMDQGWIFSLITFVIMPFTASVITIGLYFA
                     IFHHLRKSRPQAYRSHSESCYLRKVLVITISNNISWATIIVTKVLALSMVSIPGEVYA
                     FMAIFILPVNCCLNPLIYTMMTPKFKSFWSFTRWCPSIEFSKSRAEAAALRRAVTYPA
                     GVNGLNSRYGSYSVPLRRSNGSSTTLSSRYTITNFNGQSVTFSRQNSSQMQLTARIRK
                     EPLQGRRSNPVTQRQAPLLAPPLSALLTTGPIMTDSNVKESSFSVPKLNDTQTADLDT
                     DEDQGIVVLNTSNAEEPLTSSPKWDW"
     CDS             join(739017..739047,739287..739649,739734..739973,
                     740048..740424)
                     /codon_start=1
                     /gene="RvY_00247"
                     /gene_synonym="RvY_00247.2"
                     /locus_tag="RvY_00247-2"
                     /product="hypothetical protein"
                     /protein_id="GAU87387.1"
                     /transl_table=1
                     /translation="MTWIAGCWIIGGAAALFPLVLDYGNIDAGYQPFYGQNGVCLPLY
                     IHEPYMDQGWIFSLITFVIMPFTASVITIGLYFAIFHHLRKSRPQAYRSHSESCYLRK
                     VLVITISNNISWATIIVTKVLALSMVSIPGEVYAFMAIFILPVNCCLNPLIYTMMTPK
                     FKSFWSFTRWCPSIEFSKSRAEAAALRRAVTYPAGVNGLNSRYGSYSVPLRRSNGSST
                     TLSSRYTITNFNGQSVTFSRQNSSQMQLTARIRKEPLQGRRSNPVTQRQAPLLAPPLS
                     ALLTTGPIMTDSNVKESSFSVPKLNDTQTADLDTDEDQGIVVLNTSNAEEPLTSSPKW
                     DW"
     CDS             join(741580..741688,741783..741902,741988..742029,
                     742234..742344,742536..742653,742716..742787,
                     742863..742934,743009..743080,743284..743499,
                     743561..743629,743850..743921,744032..744110)
                     /codon_start=1
                     /gene="RvY_00248"
                     /gene_synonym="RvY_00248.2"
                     /locus_tag="RvY_00248-2"
                     /note="COG4886"
                     /product="hypothetical protein"
                     /protein_id="GAU87388.1"
                     /transl_table=1
                     /translation="MLKNLSEDSFSLQHCRMRLFVCSVAVLLSSYCLMFSKTSKVTRL
                     NTEFPCVGDDHERMCDEAKRTCVHWSHWCDGNYDCANKADEDVTSCSHESSLFNEFAI
                     DNEPPGLQAGVCLPNKQNHEEEGSCVLDDYPLDCTCHKGTWLTCNNIGLTAVPTHIRP
                     SEILTKLVLRNNEITRIPTNAFSVYPNLTLIDLTGNKIHTVEPNAFAGLSLLKGLFLQ
                     NNQLDALPNGTFSTTTNLAQLYLSYNKFTDWNPDLFAGVRCLNQLYMIGSHIRLASDG
                     LFQHLNTLRYLELAHNDIAEIKENTFNGLSLLKLLNLSDNAIHFISSTAFQKLKLSDL
                     SLSRNKLSFLYPTTFADQQKLSDLDLSHNPLLNNLPEKWLYGMDNLVKL"
     CDS             join(744087..744106,744167..744241,744324..744565,
                     745233..745477,745649..746030,746215..746436,
                     746508..746857)
                     /codon_start=1
                     /gene="RvY_00248"
                     /gene_synonym="RvY_00248.1"
                     /locus_tag="RvY_00248-1"
                     /product="hypothetical protein"
                     /protein_id="GAU87389.1"
                     /transl_table=1
                     /translation="MDNLVKLNLEGLQINNITKSMFSDPNSKLKFVQFGKFHYCNYAP
                     HVQICTPKTDGISSRANLLDSQWLTIFSWIIGIVALVANLFVIGVRLFLWKGNNQMTK
                     VHSLSIMNLAAADLVMGFYMFIISSADATYKADYSKHSYQWVHSHLCRFSGAISVVSF
                     DSSALLLAYMAIERYIRLVYKPFAQKGLSLRTATECIVACWAFGLIAGILPLFAQLDV
                     DGVQVFYGQNGVCLPLFIHEPFFKGWWMSTLIFIVVPSTAMLVVVCCYVSVFRHIEES
                     RQATDRVSADKPHLKRVLTITISNLLCWVPIIILKAMAMAMFAIPGQVYSWMAVFILP
                     LNCCINPIMYTLMTPECISAMKNCKWCNHTRNSSINSNSCCNTAFSVSTNGRVRSCAS
                     LTLRHAQSSATSISKTSASRMHSSRKPYKGLRRTSSLYAFRTNRSSRTSGTASYWLPP
                     KSASTTCGNPQSTSDYESESLVHSPDGNTVPITTVSESVAIDMTAPGDVFKVGPFRWT
                     LGD"
     CDS             complement(join(744351..744506,752690..753004))
                     /codon_start=1
                     /gene="RvY_00249"
                     /gene_synonym="RvY_00249.2"
                     /locus_tag="RvY_00249-2"
                     /product="hypothetical protein"
                     /protein_id="GAU87390.1"
                     /transl_table=1
                     /translation="MTWYILKTDIIAFSYCAADRSRTFETRRRRSKTFLPLASRRHIP
                     DLIHIVAFIATNIQGWTVIAHGSHTAVFLTPGFSVLPSRYQTNVKNGEVCAFELDSAS
                     CHTRKSRTPMTKRLATRATIPMIQLKIVSHWLSSKLALDEMPSVLGVQIWTCGA"
     CDS             join(745577..746030,746215..746801)
                     /codon_start=1
                     /gene="RvY_00248"
                     /gene_synonym="RvY_00248.3"
                     /locus_tag="RvY_00248-3"
                     /product="hypothetical protein"
                     /protein_id="GAU87391.1"
                     /transl_table=1
                     /translation="MRNRNFLCAPFLMWTILLIACCSQECIVACWAFGLIAGILPLFA
                     QLDVDGVQVFYGQNGVCLPLFIHEPFFKGWWMSTLIFIVVPSTAMLVVVCCYVSVFRH
                     IEESRQATDRVSADKPHLKRVLTITISNLLCWVPIIILKAMAMAMFAIPGQVYSWMAV
                     FILPLNCCINPIMYTLMTPECISAMKNCKWCNHTRNSSINSNSCCNTAFSVSTNGRVR
                     SCASLTLRKIWPHKVNDPLFQIYNKRRFVLQATLSRLPHRSQRPQPVECTVLESLTRD
                     CAVRAPSTLSAPTAVHALQEQHPTGSHQSLLRLRAATRSLLRIMRASLWSTVPTGTQF
                     RSPLFRKALLLT"
     CDS             complement(join(749079..749087,752690..753004))
                     /codon_start=1
                     /gene="RvY_00249"
                     /gene_synonym="RvY_00249.1"
                     /locus_tag="RvY_00249-1"
                     /product="hypothetical protein"
                     /protein_id="GAU87392.1"
                     /transl_table=1
                     /translation="MTWYILKTDIIAFSYCAADRSRTFETRRRRSKTFLPLASRRHIP
                     DLIHIVAFIATNIQGWTVIAHGSHTAVFLTPGFSVLPSRYQTNVKNGEVCAFELDSAS
                     CHTVS"
     CDS             complement(join(752509..752610,752690..753004))
                     /codon_start=1
                     /gene="RvY_00249"
                     /gene_synonym="RvY_00249.3"
                     /locus_tag="RvY_00249-3"
                     /product="hypothetical protein"
                     /protein_id="GAU87393.1"
                     /transl_table=1
                     /translation="MTWYILKTDIIAFSYCAADRSRTFETRRRRSKTFLPLASRRHIP
                     DLIHIVAFIATNIQGWTVIAHGSHTAVFLTPGFSVLPSRYQTNVKNGEVCAFELDSAS
                     CHTCDTISSKRGNLTEIPVILENDLWRRWPPTVHVQ"
     assembly_gap    752623..752672
                     /estimated_length=50
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     CDS             complement(join(755714..755765,755879..756031,
                     756111..756189,756267..756405,756636..756786,
                     756869..756952,757043..757114,757204..757324,
                     757400..757466,757533..757578,757739..757807,
                     758368..758420))
                     /codon_start=1
                     /gene="RvY_00250"
                     /gene_synonym="RvY_00250.2"
                     /locus_tag="RvY_00250-2"
                     /note="LIM and senescent cell antigen-like-containing
                     domain protein 1"
                     /product="hypothetical protein"
                     /protein_id="GAU87394.1"
                     /transl_table=1
                     /translation="MVVDMFYPGSVSNSEIEREGFDRDEPILNSQGEAYHDDCLVCAQ
                     CFRPFPEGTYYEFEGRKYCEYDFQVLYAPCCAKCKEFIVGRVIKAMNTSWHPDHFQCE
                     LCGRVLSDIGFMRNQGRALCHPCNERVKAEAAGKYICYRCKAIIDDKPLKYKNEPYHP
                     YHFNCSNPECGRELDSDAREIREELYCLRCHDKMGIPICGACRRPVEDRVVTALGKHW
                     HVEHFVCAKCEKPFLGTKHFEKKGLAYCELHYHQLFGNIDFVSGEVIEDICVTALNKT
                     WKPENFVCWCCETPLDERSKFLEMDMLPVCKKCYERFPGELRRRLTRHYESAQRIRPL
                     AAESSVAQISAEEHEFHAACFPRICRP"
     CDS             complement(join(755714..755765,755879..756031,
                     756111..756189,756267..756405,756636..756786,
                     756869..756952,757043..757114,757204..757324,
                     757400..757466,757533..757578,757739..757878))
                     /codon_start=1
                     /gene="RvY_00250"
                     /gene_synonym="RvY_00250.1"
                     /locus_tag="RvY_00250-1"
                     /note="LIM and senescent cell antigen-like-containing
                     domain protein 1"
                     /product="hypothetical protein"
                     /protein_id="GAU87395.1"
                     /transl_table=1
                     /translation="MARISTTNQYTSRIANGMVCHVCREGFDRDEPILNSQGEAYHDD
                     CLVCAQCFRPFPEGTYYEFEGRKYCEYDFQVLYAPCCAKCKEFIVGRVIKAMNTSWHP
                     DHFQCELCGRVLSDIGFMRNQGRALCHPCNERVKAEAAGKYICYRCKAIIDDKPLKYK
                     NEPYHPYHFNCSNPECGRELDSDAREIREELYCLRCHDKMGIPICGACRRPVEDRVVT
                     ALGKHWHVEHFVCAKCEKPFLGTKHFEKKGLAYCELHYHQLFGNIDFVSGEVIEDICV
                     TALNKTWKPENFVCWCCETPLDERSKFLEMDMLPVCKKCYERFPGELRRRLTRHYESA
                     QRIRPLAAESSVAQISAEEHEFHAACFPRICRP"
     CDS             complement(join(755875..756031,756111..756189,
                     756267..756405,756636..756786,756869..756952,
                     757043..757114,757204..757324,757400..757466,
                     757533..757578,757739..757807,758368..758420))
                     /codon_start=1
                     /gene="RvY_00250"
                     /gene_synonym="RvY_00250.4"
                     /locus_tag="RvY_00250-4"
                     /note="LIM and senescent cell antigen-like-containing
                     domain protein 1"
                     /product="hypothetical protein"
                     /protein_id="GAU87396.1"
                     /transl_table=1
                     /translation="MVVDMFYPGSVSNSEIEREGFDRDEPILNSQGEAYHDDCLVCAQ
                     CFRPFPEGTYYEFEGRKYCEYDFQVLYAPCCAKCKEFIVGRVIKAMNTSWHPDHFQCE
                     LCGRVLSDIGFMRNQGRALCHPCNERVKAEAAGKYICYRCKAIIDDKPLKYKNEPYHP
                     YHFNCSNPECGRELDSDAREIREELYCLRCHDKMGIPICGACRRPVEDRVVTALGKHW
                     HVEHFVCAKCEKPFLGTKHFEKKGLAYCELHYHQLFGNIDFVSGEVIEDICVTALNKT
                     WKPENFVCWCCETPLDERSKFLEMDMLPVCKKCYERFPGELRRRLTRHYESAQRIRPL
                     AAESSVAQISA"
     CDS             complement(join(755875..756031,756111..756189,
                     756267..756405,756636..756786,756869..756952,
                     757043..757114,757204..757324,757400..757466,
                     757533..757578,757739..757878))
                     /codon_start=1
                     /gene="RvY_00250"
                     /gene_synonym="RvY_00250.3"
                     /locus_tag="RvY_00250-3"
                     /note="LIM and senescent cell antigen-like-containing
                     domain protein 1"
                     /product="hypothetical protein"
                     /protein_id="GAU87397.1"
                     /transl_table=1
                     /translation="MARISTTNQYTSRIANGMVCHVCREGFDRDEPILNSQGEAYHDD
                     CLVCAQCFRPFPEGTYYEFEGRKYCEYDFQVLYAPCCAKCKEFIVGRVIKAMNTSWHP
                     DHFQCELCGRVLSDIGFMRNQGRALCHPCNERVKAEAAGKYICYRCKAIIDDKPLKYK
                     NEPYHPYHFNCSNPECGRELDSDAREIREELYCLRCHDKMGIPICGACRRPVEDRVVT
                     ALGKHWHVEHFVCAKCEKPFLGTKHFEKKGLAYCELHYHQLFGNIDFVSGEVIEDICV
                     TALNKTWKPENFVCWCCETPLDERSKFLEMDMLPVCKKCYERFPGELRRRLTRHYESA
                     QRIRPLAAESSVAQISA"
     CDS             complement(join(756208..756405,756636..756786,
                     756869..756952,757043..757114,757204..757324,
                     757400..757466,757533..757578,757739..757807,
                     758368..758420))
                     /codon_start=1
                     /gene="RvY_00250"
                     /gene_synonym="RvY_00250.5"
                     /locus_tag="RvY_00250-5"
                     /note="LIM and senescent cell antigen-like-containing
                     domain protein 1"
                     /product="hypothetical protein"
                     /protein_id="GAU87398.1"
                     /transl_table=1
                     /translation="MVVDMFYPGSVSNSEIEREGFDRDEPILNSQGEAYHDDCLVCAQ
                     CFRPFPEGTYYEFEGRKYCEYDFQVLYAPCCAKCKEFIVGRVIKAMNTSWHPDHFQCE
                     LCGRVLSDIGFMRNQGRALCHPCNERVKAEAAGKYICYRCKAIIDDKPLKYKNEPYHP
                     YHFNCSNPECGRELDSDAREIREELYCLRCHDKMGIPICGACRRPVEDRVVTALGKHW
                     HVEHFVCAKCEKPFLGTKHFEKKGLAYCELHYHQLFGNIDFVSGEVIEDSNLTTQFFF
                     LPSLDNLVLW"
     CDS             759364..759597
                     /codon_start=1
                     /gene="RvY_00251"
                     /gene_synonym="RvY_00251.4"
                     /locus_tag="RvY_00251-4"
                     /product="hypothetical protein"
                     /protein_id="GAU87399.1"
                     /transl_table=1
                     /translation="MAQKELYQELRRLEKQSTEIAGSLQELRSIIIVAAVIERQNAFA
                     GLRKFDEATVGVQLQNFVDLRHLSLVTSLGHEL"
     CDS             759485..759877
                     /codon_start=1
                     /gene="RvY_00251"
                     /gene_synonym="RvY_00251.3"
                     /locus_tag="RvY_00251-3"
                     /product="hypothetical protein"
                     /protein_id="GAU87400.1"
                     /transl_table=1
                     /translation="MRLPVFGSLTKRPSAFSFRILLTFAICPLSPALVTNFDFHFRLR
                     EPSSSCPQMSNSVSLDSRKDDPAYWVRYSISGMCSFIVSTSLYWFLVSCLISSVIYPF
                     MAFRNRVLSSSHDAILNSLSRKTGNKEW"
     assembly_gap    759965..760014
                     /estimated_length=50
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     CDS             complement(join(761270..761445,761512..761709,
                     761768..762259,762541..762669,762735..762980,
                     763038..763069,763130..763201,763269..763343,
                     763416..763487,763553..763624,763690..763761,
                     763827..763895,763973..764041,764118..764189,
                     764264..764335,764430..764501,764561..764681,
                     764741..764940,765051..765220))
                     /codon_start=1
                     /gene="RvY_00252"
                     /gene_synonym="RvY_00252.1"
                     /locus_tag="RvY_00252-1"
                     /note="leucine-rich repeat-containing G protein-coupled
                     receptor 7; LGR7"
                     /product="hypothetical protein"
                     /protein_id="GAU87401.1"
                     /transl_table=1
                     /translation="MRDMHGTSWTSFLLQVIIVRSRIAMAVEGLIRFQHHQCPTGEFP
                     CTMSSKCLAQRYWCDEIKDCPEGDDEDVRYCGEKTSGFGRHFLRRIADASKEDGCMAP
                     EPLMPPGTVIQDHVGQQGVKCFVKAFPKRCTCMVNRVRCDNLSLTQIFTFTNETADPE
                     APIYSFVHNRIQFIQEDTFRMLPNMRHLDFRQNSISGLNVRAFNGLSRLRRLHLDQNK
                     LSRIDPRVFWPLKNLCFLWLGHNVIQNWEPHSFNNTKLRWLDLKSNKISLEPGMFDQL
                     RDLYYLELEKNVIRSLTKAKLAGLSSLLYLDLSDNVIERCDEDTFVSTPNLEELSLSN
                     NSLMVLPEKLFAPLHNLQFLNMSHNPGIKSLPMDIFKGLNRLDRLNLSGILISNIHRE
                     MFDDIPNNALVIFSKFHYCYYAAHIVDCYPKSDGISSSENLIELTHTRTLMWVLIAIV
                     PLANLFVLLARCCIQANEPLFEEVPSARFHRHDMDVMCKLLCNVFGANALMAAYLLII
                     ALYDIHYRENYHRVAYEWLHGFACQAAGMLASFSVFVSLITLCVIVVDRCICITQSPH
                     SHLSSRGCTILISAIWLTMLMLLGIPVPIWDDVTGSFYGNNGMCLPLYLDEPFLHGWW
                     YSSLLFFGVYFASLAITVFCVVKTKLFVAKQLEGAILPEVRADLAVAKRFWIIITVNL
                     IGWLPLILIKILAFTSFDINNHLHSIFAILILPLNSFLTPVLHVYLSMEFRRKYAKVI
                     YMTLDGHAKCCIARRDSTKSYHNVNDAAAMTPLANTRRITVGNHASPGAPLMRVRTTS
                     PCDRRPSNGHMVLGVLTVPQTRTRPRSY"
     CDS             complement(join(762533..762669,762735..762980,
                     763038..763069,763130..763201,763269..763343,
                     763416..763487,763553..763624,763690..763761,
                     763827..763895,763973..764041,764118..764189,
                     764264..764335,764430..764501,764561..764681,
                     764741..764940,765051..765220))
                     /codon_start=1
                     /gene="RvY_00252"
                     /gene_synonym="RvY_00252.2"
                     /locus_tag="RvY_00252-2"
                     /note="leucine-rich repeat-containing G protein-coupled
                     receptor 7; LGR7"
                     /product="hypothetical protein"
                     /protein_id="GAU87402.1"
                     /transl_table=1
                     /translation="MRDMHGTSWTSFLLQVIIVRSRIAMAVEGLIRFQHHQCPTGEFP
                     CTMSSKCLAQRYWCDEIKDCPEGDDEDVRYCGEKTSGFGRHFLRRIADASKEDGCMAP
                     EPLMPPGTVIQDHVGQQGVKCFVKAFPKRCTCMVNRVRCDNLSLTQIFTFTNETADPE
                     APIYSFVHNRIQFIQEDTFRMLPNMRHLDFRQNSISGLNVRAFNGLSRLRRLHLDQNK
                     LSRIDPRVFWPLKNLCFLWLGHNVIQNWEPHSFNNTKLRWLDLKSNKISLEPGMFDQL
                     RDLYYLELEKNVIRSLTKAKLAGLSSLLYLDLSDNVIERCDEDTFVSTPNLEELSLSN
                     NSLMVLPEKLFAPLHNLQFLNMSHNPGIKSLPMDIFKGLNRLDRLNLSGILISNIHRE
                     MFDDIPNNALVIFSKFHYCYYAAHIVDCYPKSDGISSSENLIELTHTRTLMWVLIAIV
                     PLANLFVLLARCCIQANEPLFEEVPSARFHRHDMDVMCKLLCNVFGANALMAAYLLII
                     ALYDIHYRENYHRVAYEWLHGFACQAAGMLGK"
     CDS             complement(join(766049..766105,766198..766434,
                     766496..766531))
                     /codon_start=1
                     /gene="RvY_00253-1"
                     /gene_synonym="RvY_00253.1"
                     /locus_tag="RvY_00253"
                     /product="hypothetical protein"
                     /protein_id="GAU87403.1"
                     /transl_table=1
                     /translation="MQSFLVLPVLITVAFCMSENSDIVLDESRPDVFYCPTKPYTDDS
                     KKILTALPIAKLCEYGAGKKRPQGSPQDCFNDADEMPLACDEKSRFMKRLKIRKDAEN
                     LINSKDF"
     CDS             join(775083..775143,781868..782035,782173..782329,
                     782697..782822,782976..783203,783431..783613,
                     783672..783738,783815..783931,784099..784239,
                     784323..784651,784714..785222,785788..785921)
                     /codon_start=1
                     /gene="RvY_00254"
                     /gene_synonym="RvY_00254.3"
                     /locus_tag="RvY_00254-3"
                     /note="probable 3',5'-cyclic phosphodiesterase pde-1;
                     PDEase_I"
                     /product="hypothetical protein"
                     /protein_id="GAU87404.1"
                     /transl_table=1
                     /translation="MDDDERQDEVLGGSDVGACSVANAPEPIRPSDFTAFPPANADGA
                     LLKNAAADLAAKSSTTVSSNSPSEQLPPTLLKRHSTSSGLRQRKPSTQKISSEAVNGL
                     GAEAIGLSLKDAPLPSSTEAIHLAIARLRQMVQLIGDGSSLLDLPLEDVKANLEFSAK
                     VLENVYEEEHRSSSPPSDCDNSAGGSPVHRRHAAGTRADLHRLALPPCTNSRSASPSL
                     SSCDTLFSFAAALKSDRAKGPRSRNRKPRRVNEEDEDELSDVQPSQVPNEVREWLAST
                     FTRKLSVVKRPNEKPKFRSVANAIRAGIFVERIYRRMSSSQVLHIPPKIVMQLRSIDE
                     WTFDVFALNEASNGQALRYVANEVLTRYDLLTKYKISNYALENYMVAVEAGYSKYNNP
                     YHNLIHAADVTQTMHWFLYQTGLAHWLSDLEIFASLIGAIIHDYEHTGTTNNFHVQSR
                     SNLAMLYNDRSVLENFHLSASFALMQKEEHNILANLSKEEYKEFRSLVIDMVLATDMS
                     IHFQQIKNMRTLLGMPENIDKSKALQLVLHSCDISHPAKPWDLHYKFTLGVLEEFFQQ
                     GDREQELGLPFSPLCDRQTTVIAQSQIGFIDFIVEPSMAITGDMLEKILKPLQGEDSE
                     DAEPLELLNVVNEARPRTAPPVRSASEGVNAFVHKNNVWRHTAAKASHDIKKPWVQHF
                     QENKVKWREEQVQSDAERRLKGRKDSDKEDSIDANIIHEEEVPDGSASRPLSPKHTK"
     CDS             join(777135..777222,781868..782035,782173..782329,
                     782697..782822,782976..783203,783431..783613,
                     783672..783738,783815..783931,784099..784239,
                     784323..784651,784714..785222,785788..785921)
                     /codon_start=1
                     /gene="RvY_00254"
                     /gene_synonym="RvY_00254.2"
                     /locus_tag="RvY_00254-2"
                     /note="probable 3',5'-cyclic phosphodiesterase pde-1;
                     PDEase_I"
                     /product="hypothetical protein"
                     /protein_id="GAU87405.1"
                     /transl_table=1
                     /translation="MGICVGRPASLSSATEQYLFKKTPSRSSKVANAPEPIRPSDFTA
                     FPPANADGALLKNAAADLAAKSSTTVSSNSPSEQLPPTLLKRHSTSSGLRQRKPSTQK
                     ISSEAVNGLGAEAIGLSLKDAPLPSSTEAIHLAIARLRQMVQLIGDGSSLLDLPLEDV
                     KANLEFSAKVLENVYEEEHRSSSPPSDCDNSAGGSPVHRRHAAGTRADLHRLALPPCT
                     NSRSASPSLSSCDTLFSFAAALKSDRAKGPRSRNRKPRRVNEEDEDELSDVQPSQVPN
                     EVREWLASTFTRKLSVVKRPNEKPKFRSVANAIRAGIFVERIYRRMSSSQVLHIPPKI
                     VMQLRSIDEWTFDVFALNEASNGQALRYVANEVLTRYDLLTKYKISNYALENYMVAVE
                     AGYSKYNNPYHNLIHAADVTQTMHWFLYQTGLAHWLSDLEIFASLIGAIIHDYEHTGT
                     TNNFHVQSRSNLAMLYNDRSVLENFHLSASFALMQKEEHNILANLSKEEYKEFRSLVI
                     DMVLATDMSIHFQQIKNMRTLLGMPENIDKSKALQLVLHSCDISHPAKPWDLHYKFTL
                     GVLEEFFQQGDREQELGLPFSPLCDRQTTVIAQSQIGFIDFIVEPSMAITGDMLEKIL
                     KPLQGEDSEDAEPLELLNVVNEARPRTAPPVRSASEGVNAFVHKNNVWRHTAAKASHD
                     IKKPWVQHFQENKVKWREEQVQSDAERRLKGRKDSDKEDSIDANIIHEEEVPDGSASR
                     PLSPKHTK"
     CDS             join(777135..777222,781868..782035,782173..782329,
                     782697..782822,782976..783212,783431..783613,
                     783672..783738,783815..783931,784099..784239,
                     784323..784651,784714..785222,785788..785921)
                     /codon_start=1
                     /gene="RvY_00254"
                     /gene_synonym="RvY_00254.1"
                     /locus_tag="RvY_00254-1"
                     /note="probable 3',5'-cyclic phosphodiesterase pde-1;
                     PDEase_I"
                     /product="hypothetical protein"
                     /protein_id="GAU87406.1"
                     /transl_table=1
                     /translation="MGICVGRPASLSSATEQYLFKKTPSRSSKVANAPEPIRPSDFTA
                     FPPANADGALLKNAAADLAAKSSTTVSSNSPSEQLPPTLLKRHSTSSGLRQRKPSTQK
                     ISSEAVNGLGAEAIGLSLKDAPLPSSTEAIHLAIARLRQMVQLIGDGSSLLDLPLEDV
                     KANLEFSAKVLENVYEEEHRSSSPPSDCDNSAGGSPVHRRHAAGTRADLHRLALPPCT
                     NSRSASPSLSSCDTLFSFAAALKSDRAKGPRSRNRKPRSAVRVNEEDEDELSDVQPSQ
                     VPNEVREWLASTFTRKLSVVKRPNEKPKFRSVANAIRAGIFVERIYRRMSSSQVLHIP
                     PKIVMQLRSIDEWTFDVFALNEASNGQALRYVANEVLTRYDLLTKYKISNYALENYMV
                     AVEAGYSKYNNPYHNLIHAADVTQTMHWFLYQTGLAHWLSDLEIFASLIGAIIHDYEH
                     TGTTNNFHVQSRSNLAMLYNDRSVLENFHLSASFALMQKEEHNILANLSKEEYKEFRS
                     LVIDMVLATDMSIHFQQIKNMRTLLGMPENIDKSKALQLVLHSCDISHPAKPWDLHYK
                     FTLGVLEEFFQQGDREQELGLPFSPLCDRQTTVIAQSQIGFIDFIVEPSMAITGDMLE
                     KILKPLQGEDSEDAEPLELLNVVNEARPRTAPPVRSASEGVNAFVHKNNVWRHTAAKA
                     SHDIKKPWVQHFQENKVKWREEQVQSDAERRLKGRKDSDKEDSIDANIIHEEEVPDGS
                     ASRPLSPKHTK"
     CDS             join(777135..777222,781868..782035,782173..782329,
                     782697..782822,783431..783613,783672..783738,
                     783815..783931,784099..784239,784323..784651,
                     784714..785222,785788..785921)
                     /codon_start=1
                     /gene="RvY_00254"
                     /gene_synonym="RvY_00254.4"
                     /locus_tag="RvY_00254-4"
                     /note="probable 3',5'-cyclic phosphodiesterase pde-1;
                     PDEase_I"
                     /product="hypothetical protein"
                     /protein_id="GAU87407.1"
                     /transl_table=1
                     /translation="MGICVGRPASLSSATEQYLFKKTPSRSSKVANAPEPIRPSDFTA
                     FPPANADGALLKNAAADLAAKSSTTVSSNSPSEQLPPTLLKRHSTSSGLRQRKPSTQK
                     ISSEAVNGLGAEAIGLSLKDAPLPSSTEAIHLAIARLRQMVQLIGDGSSLLDLPLEDV
                     KANLEFSAKVLENVYEEEHRRVNEEDEDELSDVQPSQVPNEVREWLASTFTRKLSVVK
                     RPNEKPKFRSVANAIRAGIFVERIYRRMSSSQVLHIPPKIVMQLRSIDEWTFDVFALN
                     EASNGQALRYVANEVLTRYDLLTKYKISNYALENYMVAVEAGYSKYNNPYHNLIHAAD
                     VTQTMHWFLYQTGLAHWLSDLEIFASLIGAIIHDYEHTGTTNNFHVQSRSNLAMLYND
                     RSVLENFHLSASFALMQKEEHNILANLSKEEYKEFRSLVIDMVLATDMSIHFQQIKNM
                     RTLLGMPENIDKSKALQLVLHSCDISHPAKPWDLHYKFTLGVLEEFFQQGDREQELGL
                     PFSPLCDRQTTVIAQSQIGFIDFIVEPSMAITGDMLEKILKPLQGEDSEDAEPLELLN
                     VVNEARPRTAPPVRSASEGVNAFVHKNNVWRHTAAKASHDIKKPWVQHFQENKVKWRE
                     EQVQSDAERRLKGRKDSDKEDSIDANIIHEEEVPDGSASRPLSPKHTK"
     CDS             complement(780938..781195)
                     /codon_start=1
                     /gene="RvY_00255-1"
                     /gene_synonym="RvY_00255.1"
                     /locus_tag="RvY_00255"
                     /product="hypothetical protein"
                     /protein_id="GAU87408.1"
                     /transl_table=1
                     /translation="MARSISGNTLYGLELKPSMNEVAPLGSLRLSDRGYTCREKEETC
                     DAHATKLGAWEEKSMDGGLETWLQSESNARVAGKYSLIEGE"
     CDS             complement(781571..781741)
                     /codon_start=1
                     /gene="RvY_00256-1"
                     /gene_synonym="RvY_00256.1"
                     /locus_tag="RvY_00256"
                     /product="hypothetical protein"
                     /protein_id="GAU87409.1"
                     /transl_table=1
                     /translation="MAVNGKPTLARSRGDYLTDTQITEEACRPDCNTLHLNLQCTRDY
                     RGTPRFVSNHRG"
     CDS             join(787602..787765,787856..788196,788263..788402)
                     /codon_start=1
                     /gene="RvY_00257"
                     /gene_synonym="RvY_00257.3"
                     /locus_tag="RvY_00257-3"
                     /note="COG5062"
                     /product="hypothetical protein"
                     /protein_id="GAU87410.1"
                     /transl_table=1
                     /translation="MDDPLEGYSSELFVQNVIGCKSFTVYHVLACTALFFFHDGLLRL
                     FWRRKAASKRHVFLLLDFFVIILPTLLIVTLLSDWMAYLLRFLMMSSVVLMLKCAVAS
                     GDREGGTIGAPDDEKGHSQEYIVVTEFRGCVLLLVCIAILAVDFDLFPYEMVKTDRQG
                     YSLMDLGVGFLCWRFVSLYAVDHATVMAEEASKMWDETSRRFSPFTGHTKVPGN"
     CDS             join(787602..788196,788377..788402)
                     /codon_start=1
                     /gene="RvY_00257"
                     /gene_synonym="RvY_00257.4"
                     /locus_tag="RvY_00257-4"
                     /note="COG5062"
                     /product="hypothetical protein"
                     /protein_id="GAU87411.1"
                     /transl_table=1
                     /translation="MDDPLEGYSSELFVQNVIGCKSFTVYHVLACTALFFFHDGLLRL
                     FWRRKAASKRQYVRLPNIYLLIVSVSSMKPSKFYISRFVSSVFLLLDFFVIILPTLLI
                     VTLLSDWMAYLLRFLMMSSVVLMLKCAVASGDREGGTIGAPDDEKGHSQEYIVVTEFR
                     GCVLLLVCIAILAVDFDLFPYEMVKTDRQGYSLMDLGVGHTKVPGN"
     CDS             join(787602..787765,787856..788246)
                     /codon_start=1
                     /gene="RvY_00257"
                     /gene_synonym="RvY_00257.5"
                     /locus_tag="RvY_00257-5"
                     /note="COG5062"
                     /product="hypothetical protein"
                     /protein_id="GAU87412.1"
                     /transl_table=1
                     /translation="MDDPLEGYSSELFVQNVIGCKSFTVYHVLACTALFFFHDGLLRL
                     FWRRKAASKRHVFLLLDFFVIILPTLLIVTLLSDWMAYLLRFLMMSSVVLMLKCAVAS
                     GDREGGTIGAPDDEKGHSQEYIVVTEFRGCVLLLVCIAILAVDFDLFPYEMVKTDRQG
                     YSLMDLGVGTFIIANALVAPQTQE"
     CDS             join(787929..788242,788377..788545,788622..788878,
                     789013..789229)
                     /codon_start=1
                     /gene="RvY_00257"
                     /gene_synonym="RvY_00257.1"
                     /locus_tag="RvY_00257-1"
                     /note="phosphatidylinositol glycan, class W; PIGW"
                     /product="hypothetical protein"
                     /protein_id="GAU87413.1"
                     /transl_table=1
                     /translation="MAYLLRFLMMSSVVLMLKCAVASGDREGGTIGAPDDEKGHSQEY
                     IVVTEFRGCVLLLVCIAILAVDFDLFPYEMVKTDRQGYSLMDLGVGTFIIANALVAPQ
                     TQETHKSSWKLILSDVGDTAVLVILGVSRFVSAYLTEYHVSESEYGKHWNFFCSLAFV
                     KIFGRLLAAVFHPLVLPYVGLLIGCLYEAILQFGLYDFVLDSPSSKTFDSAVLQFLFD
                     NRSGLSSSVGFLAMFLMWIYVGRLFRTEKRSASDITQLARHLLQRSFFVLLITFVMRV
                     PSRRLANLSYIFWLVSSGISHAHLLCKLVSSIQMHTTDVVVS"
     CDS             complement(join(788634..788804,790655..790774))
                     /codon_start=1
                     /gene="RvY_00258-1"
                     /gene_synonym="RvY_00258.1"
                     /locus_tag="RvY_00258"
                     /product="hypothetical protein"
                     /protein_id="GAU87414.1"
                     /transl_table=1
                     /translation="MTAKDLQLATRTVRNNQKEAKSRIIKALRYHWGAVQMNNCSGAV
                     VKKELKDRRIECLARRRIQNEVIKAKLEYGLVQAAYQQTDIGEYKGMKYRGQ"
     CDS             join(788832..788878,789013..789142,789230..789386,
                     789478..789815)
                     /codon_start=1
                     /gene="RvY_00257"
                     /gene_synonym="RvY_00257.2"
                     /locus_tag="RvY_00257-2"
                     /product="hypothetical protein"
                     /protein_id="GAU87415.1"
                     /transl_table=1
                     /translation="MFLMWIYVGRLFRTEKRSASDITQLARHLLQRSFFVLLITFVMR
                     VPSRRLANLSYIFWLTYQVLAFLAFQLMVRLILLYIDQNSKRLAAEFRTRGGGIKALT
                     HFQRQDLHGALSKVNLASPGASLFTPAILSAMNYNSMVFFLLANLLTGLVNLSIDTRQ
                     LKTFASMLILTIYLTVITSVAYFLYAKKIRVPLRFSSLSRTVLIKLFLFLMTLLFCLA
                     FLKTR"
     CDS             join(789092..789142,789230..789386,789478..789815)
                     /codon_start=1
                     /gene="RvY_00257"
                     /gene_synonym="RvY_00257.6"
                     /locus_tag="RvY_00257-6"
                     /product="hypothetical protein"
                     /protein_id="GAU87416.1"
                     /transl_table=1
                     /translation="MRVPSRRLANLSYIFWLTYQVLAFLAFQLMVRLILLYIDQNSKR
                     LAAEFRTRGGGIKALTHFQRQDLHGALSKVNLASPGASLFTPAILSAMNYNSMVFFLL
                     ANLLTGLVNLSIDTRQLKTFASMLILTIYLTVITSVAYFLYAKKIRVPLRFSSLSRTV
                     LIKLFLFLMTLLFCLAFLKTR"
     CDS             complement(join(795080..795686,795941..796251))
                     /codon_start=1
                     /gene="RvY_00259-1"
                     /gene_synonym="RvY_00259.1"
                     /locus_tag="RvY_00259"
                     /note="CG8312"
                     /product="hypothetical protein"
                     /protein_id="GAU87417.1"
                     /transl_table=1
                     /translation="MTFFRRNKKSVNISETDPTYKVVYLGNVLTTLAKGDGCADKPLQ
                     ILWRNYTSTQMKDIKMKVTICNSGLKAETTEHGLTEYWAHRITFCGSHPSFPKLCGWI
                     YRHEGKKMKPELRFHAVLFTKPEKACQMAQLLQQRVHWALNEFKRDKISKQNARRLHE
                     ILSEIAPTVCKRKQILSTGQNFRPSLERCKSMGALGGPRLGAIEEEMVEEEEMLEEED
                     FIATLKRNSFETETSSSYNDSDSGASVDWSIDSSPAGSWNVKRKGPCSMVLPVNPLKT
                     DVFGMLGMKRAVEETCSVESGFEEPTTPR"
     CDS             join(799123..799162,799471..799571)
                     /codon_start=1
                     /gene="RvY_00260-1"
                     /gene_synonym="RvY_00260.1"
                     /locus_tag="RvY_00260"
                     /product="hypothetical protein"
                     /protein_id="GAU87418.1"
                     /transl_table=1
                     /translation="MVYVVVKWFGTIRELVFSADQTEVRLVPLKELTPEEHDEDGDDD
                     DD"
     CDS             join(800744..800858,800920..801189,801388..801590,
                     801744..802037)
                     /codon_start=1
                     /gene="RvY_00261-1"
                     /gene_synonym="RvY_00261.1"
                     /locus_tag="RvY_00261"
                     /product="hypothetical protein"
                     /protein_id="GAU87419.1"
                     /transl_table=1
                     /translation="MTTQSQWEYISTTPSSLHPSFITDTDANAAAITCKDSTTKLNEK
                     EQLGPRPDLCKQGTGRYPAPDCRYYVQCTGINAAVARCPGGFVFDPVGSQCDWPSKNL
                     QCLQSCYESGNFDKPQNPEPTPSVTPQPFLTTTIDSDIRTANLSCNESHCVPKAGCQV
                     ELCKEPRGQFEIIGNCSKFANCWENCAYITDCPDYLVFTDLKGACDLPFNLPQDHRCY
                     TSPYSGGQHTLEASTTAGSSSGSTLPAGAEQDQDNDGGINSNSNNGYTFAPLKFPSFA
                     MNQMQGTGPGRMVQAQW"
     CDS             join(802390..802456,802542..802646,802719..802807,
                     802909..802955,803041..803195,803266..803384,
                     803460..803607,803690..803907,803968..804147)
                     /codon_start=1
                     /gene="RvY_00262"
                     /gene_synonym="RvY_00262.1"
                     /locus_tag="RvY_00262-1"
                     /note="ChtBD2"
                     /product="hypothetical protein"
                     /protein_id="GAU87420.1"
                     /transl_table=1
                     /translation="MGFLSVWIVLLLGFSSLAESVTVSIGNLAANSRCLQSLKQHGTP
                     DATFTAKFVDKHCPELCRNTSGHFSTGQFAHPWDCKSFINCYQDEAWIGFCQTGLNFN
                     ENKKQCDWPKNANCTPKPVPTDTERPMFVVVATTPVSPALADLPRNTCKATDPNFNTY
                     EDLGHRPDLCTSGSGLYPAPDCRFYIRCNDTRAMAAKCPAGFLFDTTKRQCDWPHKIE
                     SCSQLCQENYVPPTKSTTTSPVMTTTVHPASSAPLIQSTSTTTTTTTTATTSKSTSTL
                     PPRDPLCKNVSGNFEYQNDCTKYVSCKDWHAILHDCPKGLVFVAAKGWCNWTWMLPEQ
                     HRCYKAFDNGSGDCPFYRGENDTAPLPAVASTAVKPIPMIY"
     CDS             join(803117..803195,803266..803384,803460..803607,
                     803690..803907,803968..804147)
                     /codon_start=1
                     /gene="RvY_00262"
                     /gene_synonym="RvY_00262.2"
                     /locus_tag="RvY_00262-2"
                     /product="hypothetical protein"
                     /protein_id="GAU87421.1"
                     /transl_table=1
                     /translation="MFVVVATTPVSPALADLPRNTCKATDPNFNTYEDLGHRPDLCTS
                     GSGLYPAPDCRFYIRCNDTRAMAAKCPAGFLFDTTKRQCDWPHKIESCSQLCQENYVP
                     PTKSTTTSPVMTTTVHPASSAPLIQSTSTTTTTTTTATTSKSTSTLPPRDPLCKNVSG
                     NFEYQNDCTKYVSCKDWHAILHDCPKGLVFVAAKGWCNWTWMLPEQHRCYKAFDNGSG
                     DCPFYRGENDTAPLPAVASTAVKPIPMIY"
     CDS             805895..806155
                     /codon_start=1
                     /gene="RvY_00263-1"
                     /gene_synonym="RvY_00263.1"
                     /locus_tag="RvY_00263"
                     /product="hypothetical protein"
                     /protein_id="GAU87422.1"
                     /transl_table=1
                     /translation="MVNKWTAFGLVEVVLNGEVVFVDDVQRLHYGEPPYVLLNNDGCA
                     LRHVKYFLDAKGDEDPLFNKILDKILKNYPASTPETLPSKIT"
     CDS             join(806402..806725,806800..807276,807355..807542,
                     807620..807936,808065..808507)
                     /codon_start=1
                     /gene="RvY_00264-1"
                     /gene_synonym="RvY_00264.1"
                     /locus_tag="RvY_00264"
                     /product="hypothetical protein"
                     /protein_id="GAU87423.1"
                     /transl_table=1
                     /translation="MGQQELHQIRSLYELQPPDGSASSEFESSDQSAASPYSELFRGK
                     IYQHYMLLETSGTGGLEGGLVESPKCAPADFEDATQRRTIMREKPFAIVVSDPFPEEK
                     QDLLFQTYGDVRVRARRRLRARISRIPATDVFARWLVENPAFQTFIMLVIAYNCVTLG
                     IQAEYSDRSGTTAAMVRSVLDCLDVLALAIFMFEIWLKWKVNFRDFWLNPWNTFDFLI
                     TLFTFITTAISMAGNATPADTSLRSVGKTMRAFQVLRLMRILTRSQGIKVIVFTVTQS
                     LKDMGSILVVFVLFMYIFLVTGVIFMSEMAKTTDQLVVTGNFSAEVVQYGHRFQNLYW
                     GFLTLYQIFTIDHWYAMLHNSWCKLMDPIFPTIYILLWVLIGSLIFRNIFAGVVVNTF
                     QSLRQTVAEEDEEDEKDISDRSLSEFKNFIDLQISEQDHHMTSQEDLLLETSESSTSL
                     QEKPSQAQTKDPVLRLNEKGSTWLYSFLKSLHMLEKLVTLKPTKWKKDLIFQYFEVME
                     ELQENLHERQEIVRMMDDWILTMMNKDDPASQPKPADRTKQLKTMLRNKAAHNDNEKK
                     LPTVFGRYHGQPAAPR"
     CDS             complement(join(808769..808968,809089..809104))
                     /codon_start=1
                     /gene="RvY_00265-1"
                     /gene_synonym="RvY_00265.1"
                     /locus_tag="RvY_00265"
                     /product="hypothetical protein"
                     /protein_id="GAU87424.1"
                     /transl_table=1
                     /translation="MADRKNVRTKEPPKNHPSTHEQQNTTTTTTTTTNTTATGHDAKN
                     HGHAGTRGRVDDDSRYGQSLLPQNTKK"
     CDS             join(811426..811737,812157..812450)
                     /codon_start=1
                     /gene="RvY_00266-1"
                     /gene_synonym="RvY_00266.1"
                     /locus_tag="RvY_00266"
                     /product="hypothetical protein"
                     /protein_id="GAU87425.1"
                     /transl_table=1
                     /translation="MAPQRTEHSLAIRNLVIKKHLLKVSNYEISRQLLIPRCSVIKIV
                     KKYKEMGSVENNPRCGRPRKTTALTDRLIVRKAVKERQKSASTIEEEIKAGLSVSVSE
                     ETDNDPKHKPMLVSNWLNKYHTKQLFWAPYSPDLNPIEHLWAEVERRLRKIELKNIGQ
                     LEEAIVEVWYNIEPEFCRNLVHSMPRRIAKVKKNQGFASGY"
     CDS             812947..813198
                     /codon_start=1
                     /gene="RvY_00267-1"
                     /gene_synonym="RvY_00267.1"
                     /locus_tag="RvY_00267"
                     /product="hypothetical protein"
                     /protein_id="GAU87426.1"
                     /transl_table=1
                     /translation="MAIDSKTDDEAADSDICAEPDDGDDMDFHEGDSKYFYSASTLYL
                     AFNRYQFLLAKAPLTTDTTEGLISPPVLIDTPPMGSSHH"
     CDS             complement(join(813469..814004,814133..814583))
                     /codon_start=1
                     /gene="RvY_00268-1"
                     /gene_synonym="RvY_00268.1"
                     /locus_tag="RvY_00268"
                     /product="hypothetical protein"
                     /protein_id="GAU87427.1"
                     /transl_table=1
                     /translation="MKTKIGRLPNVKEDRLRIYQLFDKAAHCYNKDNFEKNWQDLIND
                     GTMTEEFRDYLQDNWYDCRESWAYPFRNVRTYGNNTNNTIESFFHALKAAIHMTRGLR
                     LHCRSLARSCTGSAVEKYAHLPSLGFSIRQTNAIVRVGATYQAVFTTFAQRGGGAISG
                     LLTPDRLHDPDFRRLDKTSTCVQVHFNGANHLLASAWNPTTRDLSLFDSKPSVALTWQ
                     VKHELWLCYSQGEEELRCQNESVQDQVNSVDCAFFALAFAAEIAAKKNPREASFSGQN
                     LLSWVSSSFSAKSATKVKRRPGRAAERVVLNHLYYAGRRGGVFGPMGTGAAT"
     CDS             816051..816332
                     /codon_start=1
                     /gene="RvY_00269-1"
                     /gene_synonym="RvY_00269.1"
                     /locus_tag="RvY_00269"
                     /product="hypothetical protein"
                     /protein_id="GAU87428.1"
                     /transl_table=1
                     /translation="MNNWLNVPAQPFLYPEFPSSSAPLNQRAQFTHLKKVYDQDKLTL
                     LKSSRLTRKSVRPQPIERQNVKRALVNFDSSTIASLQLYASHDPNAYMG"
     CDS             join(816689..817045,817184..817255)
                     /codon_start=1
                     /gene="RvY_00270-1"
                     /gene_synonym="RvY_00270.1"
                     /locus_tag="RvY_00270"
                     /product="hypothetical protein"
                     /protein_id="GAU87429.1"
                     /transl_table=1
                     /translation="MVAIMNIHSMSAGRRFRSETSLPFTRVDDERLTWLDQFCLWASN
                     WSAGCKRLTDKNTKSPGLTTTTFKALIRTTRGVVQLIRTLLTSGAFEYVLTGKFQSDT
                     IEARFGCYRNRAGYQPLMNQHLMGHKCTFGTVELFKCSSQ"
     CDS             join(817988..818513,820052..820618,820816..821012)
                     /codon_start=1
                     /gene="RvY_00271"
                     /gene_synonym="RvY_00271.1"
                     /locus_tag="RvY_00271-1"
                     /product="hypothetical protein"
                     /protein_id="GAU87430.1"
                     /transl_table=1
                     /translation="MDNPPEKSNWKSWIRPSVALKFLQFVVRMEAWTSSPFLLTVLAI
                     FNIILGVVNGLQSLRFPGLPAETHYRNKFFFHLIFGSAFILYETLRRIYTKPETQRID
                     CKAATKFEWDITGIPLLSIILLLIIRFYPNELLCVPPACPNSNDNAVWIQSRTWPLSA
                     PEIDLPAILYRVRISVLTFGTTWLAGCGQILSLLVWCSGRDLSVRKMLQSASYGRVDL
                     TMWRELDFKHSAPKKYPNKADIALLCTSLGTASIAMLNVFVLRQTDQPCHRSADAHPL
                     MNGIYISLILSTGILGVTGASWICGYIASRLNTTVDALGCVYLALYLTLMDTVRSKYA
                     VFAYQKYGGNFARENSAGYNCLDYWMMLFIGTLAACFYKSIRRIFITLEDQRISDIGS
                     IEKWLCCSQSRSLGFQSLMQYVYCSLTGSGSVKHDLP"
     CDS             join(817988..818513,820052..820427,820816..820888)
                     /codon_start=1
                     /gene="RvY_00271"
                     /gene_synonym="RvY_00271.3"
                     /locus_tag="RvY_00271-3"
                     /product="hypothetical protein"
                     /protein_id="GAU87431.1"
                     /transl_table=1
                     /translation="MDNPPEKSNWKSWIRPSVALKFLQFVVRMEAWTSSPFLLTVLAI
                     FNIILGVVNGLQSLRFPGLPAETHYRNKFFFHLIFGSAFILYETLRRIYTKPETQRID
                     CKAATKFEWDITGIPLLSIILLLIIRFYPNELLCVPPACPNSNDNAVWIQSRTWPLSA
                     PEIDLPAILYRVRISVLTFGTTWLAGCGQILSLLVWCSGRDLSVRKMLQSASYGRVDL
                     TMWRELDFKHSAPKKYPNKADIALLCTSLGTASIAMLNVFVLRQTDQPCHRSADAHPL
                     MNGIYISLILSTGILGVTGASWICGNSRGMFLQVYPKDIHHAGRPADI"
     CDS             join(817988..818513,820052..820677)
                     /codon_start=1
                     /gene="RvY_00271"
                     /gene_synonym="RvY_00271.2"
                     /locus_tag="RvY_00271-2"
                     /product="hypothetical protein"
                     /protein_id="GAU87432.1"
                     /transl_table=1
                     /translation="MDNPPEKSNWKSWIRPSVALKFLQFVVRMEAWTSSPFLLTVLAI
                     FNIILGVVNGLQSLRFPGLPAETHYRNKFFFHLIFGSAFILYETLRRIYTKPETQRID
                     CKAATKFEWDITGIPLLSIILLLIIRFYPNELLCVPPACPNSNDNAVWIQSRTWPLSA
                     PEIDLPAILYRVRISVLTFGTTWLAGCGQILSLLVWCSGRDLSVRKMLQSASYGRVDL
                     TMWRELDFKHSAPKKYPNKADIALLCTSLGTASIAMLNVFVLRQTDQPCHRSADAHPL
                     MNGIYISLILSTGILGVTGASWICGYIASRLNTTVDALGCVYLALYLTLMDTVRSKYA
                     VFAYQKYGGNFARENSAGYNCLDYWMMLFIGKQHIQQTVCDKKAPGPFY"
     CDS             824790..824987
                     /codon_start=1
                     /gene="RvY_00272-1"
                     /gene_synonym="RvY_00272.1"
                     /locus_tag="RvY_00272"
                     /product="hypothetical protein"
                     /protein_id="GAU87433.1"
                     /transl_table=1
                     /translation="MFPRGSCQQDPDHNQGNLTWRESSGILLGWGGGRNLGDRCAVGR
                     QSGGRPARGHCDRRRGGQVDN"
     CDS             complement(join(827264..827569,827650..827796))
                     /codon_start=1
                     /gene="RvY_00273-1"
                     /gene_synonym="RvY_00273.1"
                     /locus_tag="RvY_00273"
                     /product="hypothetical protein"
                     /protein_id="GAU87434.1"
                     /transl_table=1
                     /translation="MARKLALIFVGLLALSANMPVEGNLVAIMQSMTPFILPFVAPMI
                     EGLQDMVNNNHHTNKALNADHVSAKIAEYAKEFFETMEHKGDKDNDAMELENLYLKFA
                     VGALAVILLLGIFVFAYMVHYLFNKAQRERLHNQDLIIAMRDIKPETA"
     CDS             828173..828556
                     /codon_start=1
                     /gene="RvY_00274"
                     /gene_synonym="RvY_00274.2"
                     /locus_tag="RvY_00274-2"
                     /product="hypothetical protein"
                     /protein_id="GAU87435.1"
                     /transl_table=1
                     /translation="MSGSGEDGPAWDHFMKLPKSGKSYFPDQCEHCDTLRLRESAVPR
                     LVDHLIKCRGLSFDQRRRIAVISQRAAETVPRYADSAAPSTTPASKPSTAAVVTTLYP
                     MTNQIKHHLTISCKAMNQRNRYSQR"
     CDS             join(828325..828562,829649..829866)
                     /codon_start=1
                     /gene="RvY_00274"
                     /gene_synonym="RvY_00274.1"
                     /locus_tag="RvY_00274-1"
                     /product="hypothetical protein"
                     /protein_id="GAU87436.1"
                     /transl_table=1
                     /translation="MPWTIIRPATQNCCHQSASRGNCASLCGLRSAIYHPRFKAIYRC
                     CCYDIISDDEPDQASSDNFMQGYESEKSIFSEVDAAEYDWSDSGDVVAVPLCAPAFEE
                     IGLDFERETVRVHDPFNPQSTPMIDQCATSTTKLASSWKTPLRRSLWNR"
     CDS             join(830168..830428,830513..830713)
                     /codon_start=1
                     /gene="RvY_00275-1"
                     /gene_synonym="RvY_00275.1"
                     /locus_tag="RvY_00275"
                     /product="hypothetical protein"
                     /protein_id="GAU87437.1"
                     /transl_table=1
                     /translation="MKLAYENRYSFLIGMLLAFLLKNATQTDGYYARYAFALDVQQCS
                     FGFCICHSVSSTQLTKLRKSISNGSFEVPVHSLKGRKGHGAMKAEKCGWVVDFLMENG
                     NLYGLPMPTPTRTAIQLPPIYLPSDFTFTSLYDGFCKRLRKWENEELVEAS"
     CDS             join(831208..831397,831469..832106)
                     /codon_start=1
                     /gene="RvY_00276-1"
                     /gene_synonym="RvY_00276.1"
                     /locus_tag="RvY_00276"
                     /product="hypothetical protein"
                     /protein_id="GAU87438.1"
                     /transl_table=1
                     /translation="MALFGLVDESRSHNNFFMFDGENSIGVDGQNTYGPDAVLSMLNF
                     YLSQHFNGEEILIIYCDNCRGRNQNRFLMGYCVDSVRNGRYKEVQVHFLPVGHTNFSP
                     DGFFGLFKRIFRRSTLDLPSQLRHTVGDQVGGSSTFVKGNQEVYWSWYDWKAYLEPRY
                     DTIKGFQGSYHFRLTHTTEQGVVLEYSYTDGVDEKEVVLEFAPKQRKGKASEERERRA
                     ERNPRPAALTVAGPSENRETQLLDDISQHVSFDKKLAFRSYIQSIAPRKIAQKSKRS"
     CDS             complement(join(834252..834682,834783..835263))
                     /codon_start=1
                     /gene="RvY_00277-1"
                     /gene_synonym="RvY_00277.1"
                     /locus_tag="RvY_00277"
                     /product="hypothetical protein"
                     /protein_id="GAU87439.1"
                     /transl_table=1
                     /translation="MNCPLVCIDELRVGLEAGSSDRISRRLIHVLRFTVLYNVTEADP
                     SSHCFNLSDVVTLDDREVYDNQLKNIRSAKKATQTTSIILQNVATLIERISAVRPTLQ
                     HYDDALPAAARGEMVKALRHLTLAEEKSQHLPANISFVKWLAEAITDTKQRLIVASLQ
                     GVTKTLETLRTQNSQVGYVTLRNICRTRGIFVAPYHVREGAKATVPIDVIAAGKTTIQ
                     QNMNIRPLLRYRHVVQTLINETRGLDSAGLPRPGVRNGSRTSSKVSIDPRPVVSRPID
                     PQTTPGRCSTRGRLVNSIDPRVNRNQL"
     CDS             join(835470..835509,835572..835828)
                     /codon_start=1
                     /gene="RvY_00278"
                     /gene_synonym="RvY_00278.1"
                     /locus_tag="RvY_00278-1"
                     /product="hypothetical protein"
                     /protein_id="GAU87440.1"
                     /transl_table=1
                     /translation="MRVVSSPFVGLFLGPPGETPEERKQRHASNKEKAAMLKRQAEPR
                     HRWVNSKFTLTNTEDERLQPYRTYPCMQTVYLCIFTVLVVLGLLWILHIRRQLR"
     CDS             835825..836079
                     /codon_start=1
                     /gene="RvY_00278"
                     /gene_synonym="RvY_00278.2"
                     /locus_tag="RvY_00278-2"
                     /product="hypothetical protein"
                     /protein_id="GAU87441.1"
                     /transl_table=1
                     /translation="MIPSGPYQPMANTVRIVELVHALIAIYLRLRLPARTLVRGIQTM
                     SSLCLSCYGLSEYCVSTSCRRLLCHNVVLIPFFVERTFLM"
     CDS             join(836237..836726,836883..837270,837385..837559)
                     /codon_start=1
                     /gene="RvY_00279"
                     /gene_synonym="RvY_00279.1"
                     /locus_tag="RvY_00279-1"
                     /product="hypothetical protein"
                     /protein_id="GAU87442.1"
                     /transl_table=1
                     /translation="MHDGSFISIPAASAVIIAFLILSVALLYFVQLRRFVRLGRETIP
                     ALLTELERSCDLALHPPTISPEEVSPYEISFTVSPLDQLAELFSVAVRLRHHTELLLK
                     SWIFRYRRKGLGMRRMLARIETARNRLQEAENMDDFNAIYLPEIQQQLLTLIGKIRES
                     ETKRKSQQQEESHELAEFLPSTFNFTCAIPIPDHSAHHNGSPTDTPHAETISSDRPAK
                     WSVLRPSVLPDATANRSATKSEELKPTLSQDALLDLAPHLKHRTVALKAAVDAQGDFH
                     AMMRAAKYDSLRRRDVVTRYRRRRFSGRKYTENIYSTEPDPETSKISSGRLRLLSNYT
                     PYGRSSTSFSSDGIIR"
     CDS             join(836237..836726,836883..837283)
                     /codon_start=1
                     /gene="RvY_00279"
                     /gene_synonym="RvY_00279.2"
                     /locus_tag="RvY_00279-2"
                     /product="hypothetical protein"
                     /protein_id="GAU87443.1"
                     /transl_table=1
                     /translation="MHDGSFISIPAASAVIIAFLILSVALLYFVQLRRFVRLGRETIP
                     ALLTELERSCDLALHPPTISPEEVSPYEISFTVSPLDQLAELFSVAVRLRHHTELLLK
                     SWIFRYRRKGLGMRRMLARIETARNRLQEAENMDDFNAIYLPEIQQQLLTLIGKIRES
                     ETKRKSQQQEESHELAEFLPSTFNFTCAIPIPDHSAHHNGSPTDTPHAETISSDRPAK
                     WSVLRPSVLPDATANRSATKSEELKPTLSQDALLDLAPHLKHRTVALKAAVDAQGDFH
                     AMMRAAKYDSLRRRDVVYVA"
     CDS             join(838393..838578,838868..840562)
                     /codon_start=1
                     /gene="RvY_00280-1"
                     /gene_synonym="RvY_00280.1"
                     /locus_tag="RvY_00280"
                     /product="hypothetical protein"
                     /protein_id="GAU87444.1"
                     /transl_table=1
                     /translation="MAHYGRNYRILSLLIWTFCLNGFTDAALPPASRCDKIKVKFCQN
                     VGYTLTKSYDDDFHYQHQKEAEQAINEFLPLVQSQCSRHLPLLLCSVHVPMCSPELEH
                     IVPVCHEVCHSVRSSCEPLLKKFLHTWPANLNCSGLPEKDLCIPLRDAETVTDQFTHH
                     TLPHMADLFTTTPRTRPSRKTPSTIPYSPQPVLSCPLSQIPIVTSSSTQTCVSLCDTE
                     AHFTPFEKSLVEVITAVLTALGFTLNILTLLSFLITRCSRFAYPERPIVYIASSFVFF
                     SLGYVVRLIGGREGSCSVDLRGNLHLAAHSHNLTNLCSFQFLLSFYFYNAACLWWVCM
                     TASWFLTACKRWSSEALTEFAGRYYHVFAWGISAVLTAAVLLWKKVDADELSAMCSVG
                     FTDTSSALAFVIIPSSCCLLLGGVLSVAGTISGIKIRNSITSCVTINGRLSTGPCEQS
                     ISAQSSNRNVSRSSTERIDRIIWKMSLFSLLFIVFLSVSIASNAVLYVKLVNSNREEN
                     VLGELSAVVYVRLLTPLLLCVLTSGWLFTRKTVESWRDCVKCWTSRCWRNREKDERER
                     MLTKTERRTGTVAESTVVPLLTTSSPWTPPPSRMSGLPTPPNTVTDSGKWTHSLEGSE
                     KV"
     CDS             join(843454..843658,843876..844103,844195..844356,
                     844455..844669,844875..844998,845099..845281,
                     845504..845767,846142..846350)
                     /codon_start=1
                     /gene="RvY_00281-1"
                     /gene_synonym="RvY_00281.1"
                     /locus_tag="RvY_00281"
                     /product="hypothetical protein"
                     /protein_id="GAU87445.1"
                     /transl_table=1
                     /translation="MDAKSYLDQKSHHTLHDLSKVSAVEQILNKMAPFTYPVVAAFVL
                     FLCGVAAWLVYYRWKNRSFPPGPIGLPFLGYLPFLGGYLPEKFARLSATHGDVMTVQL
                     GKKQAVVLGSLDALRAAFVDQATVFSGRGDVFLLRELWDGNGGILMSEGAKWNSLRSF
                     TIANLKLNDAMDAIKAETMEVISVLKTHLAAGDMPQDSRSFLMQVVANVGCHWTLGQR
                     VPYVDQTFQAYLANFRKVADLMHHCSSSALVPSLNPVSSKTPQMAKLEKEFQDKIDYI
                     RTLMLASLKHNKPNFAGDFLAKSKDKTDRESSLYTERELVMVLNDLWGASTEAGTSLL
                     QWAVFYMIKYPTIQRTVQEELDRVIGAPKGGIIVDADKVQLPYTMATLQEIERCASVS
                     PFGVLRCNTEATDLRGYTIPPRTLIIPNLWQIHHDKANWEDPTTFQPERFLDAKRNVT
                     RPPYLVPFSIGTRACPFQNVAESMLFSFFANLLHCFTLDTPAGQTLLTESDRISALTD
                     RPKDFQFVVKARYEQLLPGSN"
     CDS             complement(843554..843826)
                     /codon_start=1
                     /gene="RvY_00282-1"
                     /gene_synonym="RvY_00282.1"
                     /locus_tag="RvY_00282"
                     /product="hypothetical protein"
                     /protein_id="GAU87446.1"
                     /transl_table=1
                     /translation="MNSLQTGSTQVRATDTKMNSSTCAQQSADTLHTGSTHVHAATCK
                     LNTNEYSCLLSHRSVQVESFDFSSDSTLAMLLLHTERGQMQQRRDT"
     CDS             join(846674..847126,847335..847824,847925..848209,
                     848759..849409,849655..850193)
                     /codon_start=1
                     /gene="RvY_00283-1"
                     /gene_synonym="RvY_00283.1"
                     /locus_tag="RvY_00283"
                     /product="hypothetical protein"
                     /protein_id="GAU87447.1"
                     /transl_table=1
                     /translation="MAKSSASATSLSPNDKTASKLSSKAGLLGTGLFSGNNATKNATS
                     ATFSTAPLPAVQSLPLLPHESALERAKSDALKYLENFQANKAKLLDAVFTKASLYARV
                     DEEEENDEDRYIDSLVPFPEELPPLYAVLVHRLEHDANFDRLIPFVLRRLFEFGNEYL
                     FIEYIWQRIQARDTQVEQVCYENAVVLVEATAEYVDVNHRIDKFRDDVVTLDDREVYD
                     NQLKNIRSAKKATQTTSIILQNVATLIERISAVRPTLQHYDDALPAAARGEMVKALRH
                     LTLAEEKSQHLPANISFVKWLAEAITDTKQRLIVASLQGVTKTLETLRTQNSQVGYVT
                     LRNICRTRGIFVAPYHVREGAKATVPIDVIAAGKTTIQQNMNIRPLLRYRHVVQTLIN
                     ETRGLDSARVASTRGHLLEKLSSTSALRLFLQNSVGTFASELYISHMIPGISSELYYN
                     ELWRSASHVTTESLVASLGLVVDEPTYRETRDLLHLFIEAVQALRCDATQIIATTEKF
                     GYRFMSFLLISLRGKLQKSIAEDQFDPVVMSTQDERPALEGTLGFWFDELPLNFPKQL
                     PFSPCVTQIVDALKEYITKLIGLWRDMFYAIDVSAHQTVILTKHLIENDLRAMFSQRY
                     SASKLTDRQFVQLHHNFTYLEEACITLEKHMAVCLRGAISSYELCLNCEHAFDVMRGE
                     VESELFSKFTFFIEQTVKTIRLDIAPVAAKQTLGSAESKKIVDAMESFMPMIATLPLD
                     VGQRALALANSTVVASVERHLGSQEVKVVSTEGLLQLRVDLALIEQCLQKFTVFSTDT
                     ANDALRH"
     assembly_gap    848223..848272
                     /estimated_length=50
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     assembly_gap    850207..859152
                     /estimated_length=8946
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     CDS             complement(join(859173..859229,859247..859738))
                     /codon_start=1
                     /gene="RvY_00284-1"
                     /gene_synonym="RvY_00284.1"
                     /locus_tag="RvY_00284"
                     /product="hypothetical protein"
                     /protein_id="GAU87448.1"
                     /transl_table=1
                     /translation="MRGEVESELFSKFTFFIEQTVKTIRLDIAPVAAKQTLGSAESKK
                     IVDAMESFMPMIATLPLDVGQRALALANSTVVASVERHLGSQEVKVVSTEGLLQLRVD
                     LALIEQCLQKFTVFSTDTANDAFAPLKQLLDLFLYDDWATLFTTYTNADSVYKRVSLD
                     TTAKRIGRQNQVERLRGNEDRS"
     CDS             complement(join(861138..861271,861370..861529,
                     861610..861684,862448..862593,862871..863210,
                     866842..867187,867260..867317,868268..868787))
                     /codon_start=1
                     /gene="RvY_00285-1"
                     /gene_synonym="RvY_00285.1"
                     /locus_tag="RvY_00285"
                     /product="hypothetical protein"
                     /protein_id="GAU87449.1"
                     /transl_table=1
                     /translation="MALCSSGSHLHPQLGCNWCLSADDLNLKKPGLSYPPARYLSDQS
                     LIKQSPKKSDLIPDVHAEMLQVLALHSPNHSFLPNDGSRVHVEIITLLLFHAEEAGTA
                     SYTIPVFDTALADSRAFHQQVHLTQTLVGDLKYQRCDDLMDVSDDVLATFYFPNEDRW
                     KRATTVVFLTIIADCDGHAATKLAAALGKLSISNLPATGFENRELWPTRVEATTGGKA
                     GLMGFAKAFSGLMRHYNWSTVVFIAEAYRNPAMLGVAQAVSQMAGFMLHSNISVIQLD
                     GYSPETDFRQVMREANRQARGKALHGSTIVCAHLLGSSKLRREVRADDVKVFPALYRH
                     CINLRDPVKLSVENNAQTHWLTLCRNLLAANGAAAMRDWHTSGSSERQADVLRLAWVQ
                     AQPRLLHSSLLAGPAILQRLDSLPDSQPHVEEDRFDLFFLGQRLRPLTNLVKLRFCRP
                     ICPEIKLLCGQRTVLLQKAQSTQVDEERFKYDPTVSSTVQASQLKNFMRSKKDWTKAL
                     IKGMKLLFDEDELRDSCTKDKKRSPENREPLDQKKVKIIHDMVDMFCDGKKLTQPKSA
                     EINKRIGTHCSGFRKKNKKIAPLPSV"
     CDS             complement(join(870526..870847,870936..871105,
                     871192..871506,873493..873566,873691..874053,
                     874161..874307,876750..876969))
                     /codon_start=1
                     /gene="RvY_00286-1"
                     /gene_synonym="RvY_00286.1"
                     /locus_tag="RvY_00286"
                     /product="hypothetical protein"
                     /protein_id="GAU87450.1"
                     /transl_table=1
                     /translation="MPKRKLQDALQCEEASQETTQCSPSVLTSQSGRAEEAERSETAE
                     TSLTTPEKSREMLLKPTDESGADNPSTSNACATTEALSGHPLNEPKRKKSVRWSDVTV
                     YLFPRQQGFTCVPSAGGVTLGMKREHSEMRNVTLTQHEQECRSRRMQYIQQQQQQQQQ
                     IVLEEEHSDEDVDEGEEDEEVSGEEEGEDEGESEEELEEEYEEGISFPVSISIRQRRS
                     LLREAGCQVDNSERQDCQFIRVSREACGCQCQTVCNPDECSCSINKIKCQVDRYSYPC
                     GCTKEGCGNESGRVEFNPARVKTHYLNTVSRMASSSSTTTSSECSITTERVTNQGMAA
                     TTNGHFMQQSYSQPALNYDTQDGTRHYGSDTYGQLPSTQCEYSVERSSVTTSGSYHLQ
                     STNMSMSIESFSTTRTMSQPNYHYYNLHQPSYSEHDLSSVPEIATNGPVEGCMPYGYQ
                     CGYPEAAYSQHMISPPHEYSQHNGDFACPAAALPYPQLAADGHYSDSSPSSEASSRDS
                     SVSDRTHDVEDLDFGELIKQSLVETALA"
     CDS             880836..881585
                     /codon_start=1
                     /gene="RvY_00287-1"
                     /gene_synonym="RvY_00287.1"
                     /locus_tag="RvY_00287"
                     /note="COG0327"
                     /product="hypothetical protein"
                     /protein_id="GAU87451.1"
                     /transl_table=1
                     /translation="MTSPPIYLHDVAEFLRHELSVERFTKAEQGGIHRRSMRSIRRIG
                     LALEPFPGIGDWVRQEQLDVLWLHRHWQLDMKSLPADVGLICHHLPFDEALTIGYNAH
                     LAKALKDAAPLEPLGYKEDDRDKSLPPRPIGMIFDVEQLDYSAYLTFITAMFKGYERL
                     DAGKSTTISRLAVVGAMTDVLVRQAAQRGAQLYLTGAYRKAGELAVKETGIAVIAVGH
                     LRCEVWGLYALAKMLEERWPTIECVVREPTS"
     CDS             join(882469..882616,882706..883097)
                     /codon_start=1
                     /gene="RvY_00288-1"
                     /gene_synonym="RvY_00288.1"
                     /locus_tag="RvY_00288"
                     /product="hypothetical protein"
                     /protein_id="GAU87452.1"
                     /transl_table=1
                     /translation="MPSTSRKLNQFGNEAHAVAAYISLRRSLLAVGGIQVAVGIVLLI
                     AGIILGFGIAGFVTLSVLVILGILGLVAGFISQPIDAPFVVARRVRRIKMIAGGYMFL
                     LATVFLVAAVTLGWEFWQMALVSRARMEDGGVILHYPFANAILVVACAVTMLITIVPL
                     CAFGMDFGEMSKPKIPMEQ"
     CDS             886789..886980
                     /codon_start=1
                     /gene="RvY_00289-1"
                     /gene_synonym="RvY_00289.1"
                     /locus_tag="RvY_00289"
                     /product="hypothetical protein"
                     /protein_id="GAU87453.1"
                     /transl_table=1
                     /translation="MVAAANNPLALHGPSPARWGLILEDENRRGLPHVVKENIWHEKF
                     GIDYDQLPSSQPAAHAAKM"
     CDS             join(888213..888281,888366..888467,888525..888636,
                     888830..888955,889035..889147,889222..889310,
                     889404..889500,889589..889735,889817..889912,
                     890233..890505)
                     /codon_start=1
                     /gene="RvY_00290-1"
                     /gene_synonym="RvY_00290.1"
                     /locus_tag="RvY_00290"
                     /note="zinc finger CCCH domain-containing protein 15;
                     COG5252"
                     /product="hypothetical protein"
                     /protein_id="GAU87454.1"
                     /transl_table=1
                     /translation="MPPKTNSGASKKTVEKQKTKVIEDKTFGLKNKKGAKTQQFIQQV
                     VKNVQAKGAPPRRDPLAPETAQDKKAKEKAKEEELKELFKPVIQSQKVAKDVDPKSVL
                     CAFYKAGTCGKGDKCKFSHDLNIERKTEKRNLYNDDRAKEEDKMENWDDATLQDVVNK
                     KHSEGEALKPKTDIVCKHFLAAIEDNKYGWFWECPNGGEKCMYKHALPPGFVLKKDKK
                     RMEEMEEKISLEDLIEKERAALGGNLTKVTLETFRAWKIKKRKERLEKLESDKKKKEN
                     EYQAGRLNGLSGRDMFTFNPEMAVQDDDEATDDIVYKAESDDEQENVTARAIDESLFI
                     EEEVDTTGTISNSRDRHGATSHLPVTEGGDAPGTSGGVLVDDVPVDADLFDEDDCDEE
                     ESGQGDDDASDDPSQ"
     CDS             complement(join(891313..891741,891806..892227,
                     892286..892793))
                     /codon_start=1
                     /gene="RvY_00291-1"
                     /gene_synonym="RvY_00291.1"
                     /locus_tag="RvY_00291"
                     /product="hypothetical protein"
                     /protein_id="GAU87455.1"
                     /transl_table=1
                     /translation="MEKVILKEWVEKKSGLVVEPSSPAIADQLLRPLPDGFPPPKLDH
                     YMYLLPSRVLVHLEKGSNYPDAGEIYQHLPMDDETKAFLRKRRNVAEIDLDDCAALLR
                     LGDALNDPKCKDSVILLVIKKCLTSTALYGPLSATDVENWNAVECKTLRAQGLSYKIY
                     SALLFDINIGDTVRLHPNIRDGRDCMEGAEEYEQPVQYGILRYQAPIFKLESTAFWAN
                     NSDREKDDTWLGVELRGKFAGRGDSDGTVNGKRYFSCRDKSARFVAFWDVDYSLPEPE
                     TWCRCKLVDPLDKIVSKLIKERSIANPKNPWTIQEVENALNRAFPHPLFCTVELVAVQ
                     VDLITEYGGKKHQQELEKLRKLAGVFDVMCSEHESAKYFVVTADSKMYRAGRDSLEVA
                     REVFKHPSPLARDAFSKPNCESLKTVRSIGVRCSTQRRQTRASADRPEERYSRSKAFV
                     RR"
     CDS             join(893213..893284,893348..893452,893516..893680)
                     /codon_start=1
                     /gene="RvY_00292-1"
                     /gene_synonym="RvY_00292.1"
                     /locus_tag="RvY_00292"
                     /note="putative transcription initiation factor IIA
                     subunit 2; TFIIA2"
                     /product="hypothetical protein"
                     /protein_id="GAU87456.1"
                     /transl_table=1
                     /translation="MSYQMYRITTLGSTLQESLDDLIQSNQISPNVAFKVMAQFDKVV
                     NTALEQRVKSRLNFKAEHLESYRFCDNVWTFILKNVEFKDSQGHGHSEPVKVSKVKIV
                     ACDGKSAGKEA"
     CDS             893735..894088
                     /codon_start=1
                     /gene="RvY_00293-1"
                     /gene_synonym="RvY_00293.1"
                     /locus_tag="RvY_00293"
                     /product="hypothetical protein"
                     /protein_id="GAU87457.1"
                     /transl_table=1
                     /translation="MQLVTASSLPQLAFSSRNSEGLMRVKMIFVPFRYRFSTRTDYRK
                     FLKKLWRDVFRFSILLCCAASLSVFAHSVVYILPWLQFVESLETSLVFITRTTRNFTE
                     IKFKIARKSGVRPPI"
     CDS             join(894393..894673,894746..894962,895074..895341,
                     895410..895546,895656..895849,895940..896173,
                     896250..896322,896684..896797)
                     /codon_start=1
                     /gene="RvY_00294-1"
                     /gene_synonym="RvY_00294.1"
                     /locus_tag="RvY_00294"
                     /note="putative thyroid receptor-interacting protein 13"
                     /product="hypothetical protein"
                     /protein_id="GAU87458.1"
                     /transl_table=1
                     /translation="MKRSFLEERKPVKQMASPDKLTSRANRQPHQDDATAEEISSSFD
                     IVARWKIVSTPEKENSSLSANGMEAFSSYNPDVEKRRPEVHVEILVHPSSSNSEFQIG
                     SLVRKAIRKTFKQLQQRSHEFPFNHSAKMVSLPELSRALTSPGSGLDRQVQEVAFESG
                     DEEGVALSSFDDVKWQLYVYKLQNDPATEDDMGHETPAATHRILPSEEHRGLWESLVY
                     DSDVKQKLLNYSVETVLFSKLNVDDDLVSWNKVILLHGPPGTGKTSLCKALAQKLSIR
                     LVEHYSSVYLMEVNSHSLFSRWFSESGKLVMKMFQSMEEVVKQNSSLVILLIDEVESL
                     TRARQASISGNEPSDALRAVNALLTQIDKIKRYPNVLILTTSNLSQAIDLAFVDRADI
                     KQYIGNPSQAAREAILLSSISELIKRGVLGSDPSLLLPESSDSRSLLTAAAKATHEFS
                     GRALRKLPFLTKALKFPGNIGIPVTDFLRGMVTMAREQRSDAESLKSSKSPSNGS"
     CDS             complement(join(897185..897343,897403..897552))
                     /codon_start=1
                     /gene="RvY_00295"
                     /gene_synonym="RvY_00295.2"
                     /locus_tag="RvY_00295-2"
                     /product="hypothetical protein"
                     /protein_id="GAU87459.1"
                     /transl_table=1
                     /translation="MILEDESSSGSIASLLDNLRTGFYPISLNGWQATSADWWMPIIE
                     AGRGEPVLLSPREPVLDDVDLVVVRTHVPKEVQAMCDKAMIPVVIEDWLLENIIRGKK
                     "
     CDS             complement(join(897512..897727,898074..898307))
                     /codon_start=1
                     /gene="RvY_00295"
                     /gene_synonym="RvY_00295.1"
                     /locus_tag="RvY_00295-1"
                     /product="hypothetical protein"
                     /protein_id="GAU87460.1"
                     /transl_table=1
                     /translation="MMVDQVDMDTHLKRVQPVPFNKLLDGCLFTTTHPNITRSSSSEE
                     EEAEYRAGDLDERIRTWVAQMGGKMVAYFEELTDIQFANPKKRFLITSACCRTQRYLE
                     CLVANVPCIEYHWLKSMYYRGKMIDFEKYRLPAGYDSRGRVVEWIYR"
     CDS             join(899377..899387,899466..899582,899652..899715,
                     899774..899864,900138..900250,900403..900552)
                     /codon_start=1
                     /gene="RvY_00296-1"
                     /gene_synonym="RvY_00296.1"
                     /locus_tag="RvY_00296"
                     /note="p23_hB-ind1_like"
                     /product="hypothetical protein"
                     /protein_id="GAU87461.1"
                     /transl_table=1
                     /translation="MASGKLIPSATWAQRKEVVFLTFLVQDVKDLDLKIEANRIHFEG
                     SSDSKNYDFDLELYAEIDPEKSKYTKGDRVIDCLLQKKDTSAPFWPRLAKASGKQGWL
                     KTDFARWKDEDDADDEEKGGFGGGDMDFTQMMGQMGGMGGMGGMGDMGGMNFGGPGGD
                     DMPDSDDDKDDEDEEGMPKLE"
     assembly_gap    901153..901603
                     /estimated_length=451
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     CDS             complement(join(901829..902163,902333..902799,
                     902880..903306,903393..904003,904083..904234))
                     /codon_start=1
                     /gene="RvY_00297-1"
                     /gene_synonym="RvY_00297.1"
                     /locus_tag="RvY_00297"
                     /product="hypothetical protein"
                     /protein_id="GAU87462.1"
                     /transl_table=1
                     /translation="MEDHLLSDDSLEESGDERVAENAVQKRRKSSGKMPVKRRSVQPS
                     EIQLKARGMPVEEVANMVKDDTFVLRAESFGSRKGAPFWDTMRRVVDKESEDRLDFVC
                     CSRCKQVWKHDRTVNTDALHRHVSKCGVKANQPKITGYLKSHKLPLAAKQEKSRVCAR
                     YCAVDGRNFEEVVGTGFRALIDTVIDVTMKYSHAGKPTARDMLPDPTSVSQYVGKEAK
                     AIRESLLEEVKPILRLRGGGITLDFWEEEYTKVSYLGCTVPYMFGGSELRERLLFCSE
                     CDTVDRKTGAAVQKFIFSKLREIGLCEEDLKLCSFVTDQGGNMKVAFRNSGFERINCA
                     GHLLNTCSQNFLKSNPKSQHPMPAEALPVLALVNQVKSLVTHCKQGGISRQLKTTLKQ
                     HCETRWNTHVEMFASVLAVYEQLEDILAERKESHLLPSRQKMQEFHDLFEPVRDATFL
                     LSVSKRPTIHLVVPAYLELKRHFKDQVPSDFPEIRAFQKHVENIFNKELQIDELHRVA
                     VFLDPSMKHLQFLTATERVAVLKRAMEEVQKIPQPEKTGAPIVEVASRGSTKFNVKAL
                     AKYSADNPIGNEVERYASLPSPPEDQDVLSFWTEKENDFPRLKCYALRILSVSATSTP
                     SERLFSRSGTAVSEKRKNLAPQTLSDLMVVQSNFEFENV"
     CDS             join(904916..905518,906339..906539)
                     /codon_start=1
                     /gene="RvY_00298-1"
                     /gene_synonym="RvY_00298.1"
                     /locus_tag="RvY_00298"
                     /product="hypothetical protein"
                     /protein_id="GAU87463.1"
                     /transl_table=1
                     /translation="MDEKYKPLFQLRAFDHIGDRLEAELTKCENNSLPFAPYVLEATA
                     GISSTFEGLLLDKELDPHALAEGRTNEWTRKLWYTESKTQLVAALTAAKAKVDQVSKE
                     HPESKFLMGVRIFEPSQAVRMMEDREWTKMRDTILPKQGVTGISQIPMDEWRVYQKIA
                     EEVMFINAENLDSFWRSHSKELPVLHAIALQNIWTPVNSVESVPVTQLALPELANVEY
                     LNETQFYAVAYQVLNNIALAENFERFSFGSELRSTMQVYKPETRPRFPA"
     CDS             join(906988..907226,907300..907397,907485..907537,
                     907657..907690,907804..907927,908001..908064)
                     /codon_start=1
                     /gene="RvY_00299-1"
                     /gene_synonym="RvY_00299.1"
                     /locus_tag="RvY_00299"
                     /product="hypothetical protein"
                     /protein_id="GAU87464.1"
                     /transl_table=1
                     /translation="MLDAVRTAFRQAKMNLAAGSFLLLGTVISLTIAYEPYHMRLHAQ
                     IIRLENPQGIDYQGQPCGGQFTPRQCNAVVSAFVDTDSSVNPFHSGAESYGRYGPVEY
                     KVLSVHQDDNDPHINQIISADICGKSIEKAVVKVRATEQDENGGKRINDFTCDALLQT
                     LQGENVWSAVQLCQPEYQPKKMRLYFRYKVSRLEEKQCRQHQH"
     CDS             complement(907072..907314)
                     /codon_start=1
                     /gene="RvY_00300-1"
                     /gene_synonym="RvY_00300.1"
                     /locus_tag="RvY_00300"
                     /product="hypothetical protein"
                     /protein_id="GAU87465.1"
                     /transl_table=1
                     /translation="MTEESLKQGCMQENYAYITCREFWMLLSLRIDESRNDSVALAWS
                     KLSTAGLALIVDALWVFQPDNLSVQTHMIRLVGDRQ"
     CDS             join(910233..910270,910445..910583,910655..910916,
                     911096..911432,911548..911686)
                     /codon_start=1
                     /gene="RvY_00301-1"
                     /gene_synonym="RvY_00301.1"
                     /locus_tag="RvY_00301"
                     /note="aquaporin NIP; NIP"
                     /product="AQP2"
                     /protein_id="GAU87466.1"
                     /transl_table=1
                     /translation="MSSHVIPADHGKGNGPRAVPRDYAEHRPSWRKRLGNTFRVKNEL
                     FRHMIAEFYGTFILMVFIESTVMSQAFAGRRDDAFFIAVAHGLSVTMAIYSCAGVSGA
                     VLNPALNFAFALVGKLSWTHALFYSFAQYAGAFVASGVVYTVQYEAVNKFDGGVRQSF
                     GENGSAAFYSTFPGEHHSVASSFLHEMVCTALLMSGVLSMADEKNWKPHKGFIPVATG
                     LLITTILLAFGANEGVGMNPARDLSPRLFMLAAGYPLDVLSFWDYNYFWIPVVAPHVG
                     AIVGALTYTFFIEVQHPVRREDTPYYPQ"
     CDS             912055..912369
                     /codon_start=1
                     /gene="RvY_00302-1"
                     /gene_synonym="RvY_00302.1"
                     /locus_tag="RvY_00302"
                     /product="hypothetical protein"
                     /protein_id="GAU87467.1"
                     /transl_table=1
                     /translation="MASSGHHSRLRAQNSESSVTSLLLRKVSWWEFLVKTCNGLRRHS
                     TVHNEKAPQSQRNFDLRDSVFVDDKSLEAANTTFEVDECNQSARQILPLSPRRKSIFA
                     TV"
     CDS             join(912954..913012,913130..913268,913340..913601,
                     913784..914132,914196..914367)
                     /codon_start=1
                     /gene="RvY_00303-1"
                     /gene_synonym="RvY_00303.1"
                     /locus_tag="RvY_00303"
                     /note="GlpF"
                     /product="AQP3"
                     /protein_id="GAU87468.1"
                     /transl_table=1
                     /translation="MARTTGNYSYEMEVRHEKDQNGIKAVPSSYPTHSLTWRGNLARK
                     LRIKNELARHTLAEFFSTFFLMIFIESTVASQALAGQKQDLLLIALGQGLGVTMGIYV
                     SGGVSGAVLNPAIGVAFSIIGKLTWIHTFFYAMAQYAGSFLAASLVYGIMYEPLEVYD
                     GGVRQVVDNANGTGGTGTWWATLPPDHRSIGGAFLHEGACTAFLVIGVLAITDDRNWK
                     PHKGFIPFAIGMVVTTILLGFGANEPVSMNPARDFAPRMFALLAGYPLEMFSINNYGY
                     FWIPIVATHLGAIIGALLYTVCIELHHVPQEEDTPIFPDEGRDREKKPSR"
     CDS             complement(join(914950..915085,915186..915312,
                     915405..915525,915672..915862,915943..916087,
                     916264..916649,916729..916818,917055..917280,
                     917598..917801))
                     /codon_start=1
                     /gene="RvY_00304-1"
                     /gene_synonym="RvY_00304.1"
                     /locus_tag="RvY_00304"
                     /product="hypothetical protein"
                     /protein_id="GAU87469.1"
                     /transl_table=1
                     /translation="MGFTCRTALIAAAVLLQFIYISAGVFDGVVTLPNGISLQGELSS
                     ESADHQQRTFAFYGIKYGTAARFEHSVLNEDWSYLADPAQPKQGYACPQVPSKVPNAN
                     NQVPHMSEDCLYLDIYLPPAVQSQPDKKWPVMFFIHGGVFREGSKDIYNSTILAAATD
                     AIVVTVNHRLSAFGFLSTMDQSAKGNWGLGDVKLALSWVRSNVVAFNGDVNRITLFGQ
                     SSGAGMVSALLLDDDIRENVKAGVAFSGSMLAPWALAKDAVDGTKSLAKKLRCPTNTN
                     QAMVDCIKTVSVDRILKHATGKDATTNFVPVIDGVHIAKHPEQILKDRAKRPGSGKSA
                     NFITGYMKEDMAYMLWLIMPQMMSDSFPYSHNMMLTTLTTYIAIRTGCPLYAPIAVLK
                     LESFYKIKKGMSNREYREILVEIFTDAEFAVATLKEANLYASIAPKTNQMYRISTDLD
                     FHNLKAFHTMDVLHLFRGNLDAFMGPKTSDAVTASLHAFLRQVAHTGRSTGPSVGRNA
                     EIHDLNQAATWVKDKDNLRKLSFWRNLTPCSLW"
     CDS             complement(918644..918856)
                     /codon_start=1
                     /gene="RvY_00305-1"
                     /gene_synonym="RvY_00305.1"
                     /locus_tag="RvY_00305"
                     /product="hypothetical protein"
                     /protein_id="GAU87470.1"
                     /transl_table=1
                     /translation="MTIKSGKHAGYARRSEECATRCLRGDRTLLLILILYNGLATFTA
                     MHGPTSLSLPGVRLLVNKDAKQYLYN"
     CDS             join(918998..919204,919355..919441)
                     /codon_start=1
                     /gene="RvY_00306-1"
                     /gene_synonym="RvY_00306.1"
                     /locus_tag="RvY_00306"
                     /product="hypothetical protein"
                     /protein_id="GAU87471.1"
                     /transl_table=1
                     /translation="MKVLLPTTEPGHLVQLPAANARLELVPLRDWGPLLLQKLTAWFL
                     TTEEALIGPRNAPPGYLKGHPTIHWKAYTTSGQKAMGVSLKVPKMTAMRLNRA"
     CDS             complement(join(919942..920383,920582..920634))
                     /codon_start=1
                     /gene="RvY_00307-1"
                     /gene_synonym="RvY_00307.1"
                     /locus_tag="RvY_00307"
                     /product="hypothetical protein"
                     /protein_id="GAU87472.1"
                     /transl_table=1
                     /translation="MLTVNELTATSRQLLPITTSGSGKPPQIIPLYQTGNTATYSGTF
                     EPFILTLEVTPNPDFYGWSYGSSVPLTRASPPRNQVGGQNNFQSSAGNDFLLPGEAQN
                     WNGQRGDWSFPERVNEPPNSCRPNNGGQAQSRGAANQQGNFGQYNDCNPNSNNRNDRS
                     SYGK"
     CDS             complement(join(920636..920851,920924..920929))
                     /codon_start=1
                     /gene="RvY_00308-1"
                     /gene_synonym="RvY_00308.1"
                     /locus_tag="RvY_00308"
                     /product="hypothetical protein"
                     /protein_id="GAU87473.1"
                     /transl_table=1
                     /translation="MTQDGCKYGRQTTGDTLGPFYKPNSPIQHLVGNEVPSICVNTPG
                     NFRLYLNGTVRLNRLVDICGFPTKALMDV"
     CDS             complement(922476..922679)
                     /codon_start=1
                     /gene="RvY_00309-1"
                     /gene_synonym="RvY_00309.1"
                     /locus_tag="RvY_00309"
                     /product="hypothetical protein"
                     /protein_id="GAU87474.1"
                     /transl_table=1
                     /translation="MVLHVRLRYGAQLNSDRCGCRFDPGNQAALQHFLKGKLMEFAAT
                     SHPLATTLVLLIIKFKARPIHRE"
     CDS             complement(922914..923240)
                     /codon_start=1
                     /gene="RvY_00310-1"
                     /gene_synonym="RvY_00310.1"
                     /locus_tag="RvY_00310"
                     /product="hypothetical protein"
                     /protein_id="GAU87475.1"
                     /transl_table=1
                     /translation="MTSRRNSGSIARFIFKHALWKFTKSATTLLLFREKTPVARSSLC
                     SPEQIQTMWMAYQRKEATSGRSVLINKVIYAKTEVSARVFLYTIVCRTGFETILYQCE
                     LALPVG"
     CDS             complement(923410..923583)
                     /codon_start=1
                     /gene="RvY_00311-1"
                     /gene_synonym="RvY_00311.1"
                     /locus_tag="RvY_00311"
                     /product="hypothetical protein"
                     /protein_id="GAU87476.1"
                     /transl_table=1
                     /translation="MSGDAVVPPPGLAECRQMDEQLATVASASFQDIADRQVLLDEVL
                     CCVDYLKLLVRLR"
     CDS             complement(join(924209..924374,924456..925130,
                     925420..925673))
                     /codon_start=1
                     /gene="RvY_00312-1"
                     /gene_synonym="RvY_00312.1"
                     /locus_tag="RvY_00312"
                     /product="hypothetical protein"
                     /protein_id="GAU87477.1"
                     /transl_table=1
                     /translation="MWMSYFLRHLARKTSLVEKEDAHPRNPITEEALPELLAGPMAAQ
                     VVEVDRQLADVASAGFQHIDNNLLEEIFNCAEFLRLLILRRVCRNWHREISRELAPWN
                     RQVAIAFGSFPLHKMYHYGHVMNQRNFWHYARQAHTVVVFQDPGKPRKFSGGQVMYIW
                     GAYDAQVRSDRRTQLIEKVIYGNTVVCSNDFHCAAMRRDGFEIVVYRSTIALDVGELL
                     TRSDATGGQRDCWFPSGGPPLHMEISNRKRYLLTEEDVSSMKYGGLPNPTAVYFAMIM
                     KTAVAVDVDRLVADFLGTPDKQLYTPWVERLLQQFDPDQLSALDDFLDGDVRTFAAKV
                     NPLVTTLFQYILKQKLVAEWNLPAFLGDGI"
     CDS             join(926036..926373,926435..926605,926774..926999,
                     927077..927123,927225..927333,927454..927744)
                     /codon_start=1
                     /gene="RvY_00313-1"
                     /gene_synonym="RvY_00313.1"
                     /locus_tag="RvY_00313"
                     /note="WD40"
                     /product="hypothetical protein"
                     /protein_id="GAU87478.1"
                     /transl_table=1
                     /translation="MSWSGNSLPRYGPSGSHSPSYEASRHHPTSPTQPARLPAHRSPS
                     AVPENSQPVTGPASCRLDDSTMKSFRISRTLQETKGIVNSVDFSPTGEHVLTATDDES
                     IVVYECLSVDKPKVHRLCNSKKYGVDNAIYTHSTIAALHSSTKVDDNIRYLNLQENKY
                     ISVFSGHTKRVTELHQSPVDDQFLSASVDRTIRLWDHRAGCTGMLTNLDTTPILTIDP
                     EGLIFAAGHCTTRENRIMLYDIRNYQKGSFSTFRYPEESDADWCGMEVSPDGRYLLVN
                     TNGFVVYIMDAFQGSCRFCFRGHANRGQSLKASFTPDSQYVLIGSTDGKLHIWNLRTG
                     RNVAVLAPKQKDLFHKIVKFHPTNALAVSAGNKVSFWLPYIVDQANSSGYSSNRSPGQ
                     W"
     CDS             complement(join(928015..928481,928729..929068))
                     /codon_start=1
                     /gene="RvY_00314-1"
                     /gene_synonym="RvY_00314.1"
                     /locus_tag="RvY_00314"
                     /note="COG3897"
                     /product="hypothetical protein"
                     /protein_id="GAU87479.1"
                     /transl_table=1
                     /translation="MSKRRRSSESLPTSEPTIFSSSRKTFERKFCFAGETFPNPAADS
                     TVHSFQLLSRPGTRSPAESAEGESVEVVVSEEIDVDYSCYTWPSSAVMAQYIWFHQEN
                     FIGRTVLEVSSGTSVPGILAAKLGASVILSEYAMNPSAIQRCKFQAENNEVSVRTIGV
                     IWGQVTHELAQLQDLDFILLSDVFYEPSHFEDVVFTIRFLLERHPNAVCLSAYQIRDE
                     KWSLHFLLNKWNMTAKKLDLESFDADRADIAGSHLPGSVEIDLYRFFLGQ"
     CDS             join(929616..929767,929937..930067,930151..930185,
                     930262..930372,930450..930631,930713..930875)
                     /codon_start=1
                     /gene="RvY_00315-1"
                     /gene_synonym="RvY_00315.1"
                     /locus_tag="RvY_00315"
                     /note="protein YIPF5; YIP1"
                     /product="hypothetical protein"
                     /protein_id="GAU87480.1"
                     /transl_table=1
                     /translation="MSGYADEPAGFYPSSYAWSDPAAAAGVPGGPPIPNMMTPGVSAP
                     PGPMYNPLAYGGPQATANMYAQQNDAVSQRFAQAGGYTGDDVEHEPPLLEELGINFDH
                     ILQKTMTVLNPFRRPDVTIMSDSDLAGPFVFCLLFGGLLLLHGKIHFGYIYGIGLLGC
                     LGMYSLLSLMSVQGVSIGCVVSVLGYCLLPMVLLSAISIIATLQGLLGMIGVGLTILW
                     CSWSASKLFVTALSMDHQQPLVAYPCALLYGVFSLLTVF"
     CDS             complement(join(931268..932565,932789..933278))
                     /codon_start=1
                     /gene="RvY_00316-1"
                     /gene_synonym="RvY_00316.1"
                     /locus_tag="RvY_00316"
                     /note="IGc2"
                     /product="hypothetical protein"
                     /protein_id="GAU87481.1"
                     /transl_table=1
                     /translation="MDFTIAIPVLMILSSFGREAFAASLSANLAASSSSTSCPSTCRC
                     SWRNGLQTADCSRRNLTTIPPNIPSSIVVLDLSGNPLRSLPNATFAQANLAHLLKLDL
                     SHCSLSDISSLAFSAMSNLRELNLDTNTFTMLNPAIFEPIYSLRVLSLKHNTLPSLPA
                     FSFSPLSQLETLDLQHSQVAHIDTEAYRGLERLRSLQLNGNALRKLQPSSLHPLKSLQ
                     QLDLHNNPWNCDCRVRDVQQWMKERKVGSGFEPSCATPLEYHNIPWNSFPVTKFACAP
                     EIVSMEAFDILPGRNISVECGVFGDPVPNVTWYRDRSPINQSTIEYFNKKYEVMMRNL
                     SSHFVHVLVVRNASEADGGYYQCLAKNWVGNVTTEIALFRSEAILSIVEVVILLVALL
                     VFLSFVSFMVLYCCRYRNKRPFPLCKIWREKIRKSLPDEKASLKSDKFHGVTYFKSSD
                     ATLSNSSSLLQPHPISQEATRLLNDKLAPTFTQENETSSDGSTNEEDKDSGIQHGSEG
                     SDSLRNDSSCTPQDIFPDSDASSITHMPVNVNAVTVKSPRNVRFSPSLSSAAPCPPRS
                     SLRRSPAPSHQQLKVNFVSGYDPYLGTEV"
     CDS             complement(934619..934975)
                     /codon_start=1
                     /gene="RvY_00317-1"
                     /gene_synonym="RvY_00317.1"
                     /locus_tag="RvY_00317"
                     /product="hypothetical protein"
                     /protein_id="GAU87482.1"
                     /transl_table=1
                     /translation="MQLNTYVHKRRALATRQSSFSPAKPRTDDEKIEVGLTFLLVLGE
                     NYTCLSVFSSCLSRLLSQIVKCTSESGFRCNRLEGIVFCCALLISDISNSNLLSEIMY
                     SAVVATGTDIHRKNWA"
     CDS             complement(941294..941521)
                     /codon_start=1
                     /gene="RvY_00318-1"
                     /gene_synonym="RvY_00318.1"
                     /locus_tag="RvY_00318"
                     /product="hypothetical protein"
                     /protein_id="GAU87483.1"
                     /transl_table=1
                     /translation="MRSRPKSTLESLWYLCNQASNLFILFKRQELQCVMNMNAGLLER
                     SNDGYGREQDHGQQTVAQDGYDAPNRRALPH"
     CDS             complement(join(942393..942514,942891..943048,
                     943218..943349,943597..943639,943703..943781,
                     943859..944011))
                     /codon_start=1
                     /gene="RvY_00319-1"
                     /gene_synonym="RvY_00319.1"
                     /locus_tag="RvY_00319"
                     /product="hypothetical protein"
                     /protein_id="GAU87484.1"
                     /transl_table=1
                     /translation="MTLQGTNFEAPPSYPGSFVEGDMDVPSAAAGRTGPSFEDLNTLD
                     EPIKDTVFRDVKAIGQKFFHVLIPHKGQKLLRDWDLWGPLILCTFVAIMLQGANADKT
                     ADNNAGPEFAQIFLLVALGSVIVTLNSKLLGGNISFFQSVCILGYCLLPEALALIACR
                     IFAIALHGTVLFALRTTVITVGFLWATWASVVFLGDTQQPNRKALSVYPIFLFYLIIS
                     WLIMSQTGHN"
     CDS             join(944694..944765,944856..945058,945308..945431,
                     945503..945582,945660..945831,945946..946087,
                     946320..946537,946622..946726,946849..946938,
                     947072..947236,947315..947443,947658..947930,
                     948023..948289,948509..948715,948870..949217,
                     949563..949969,950183..950459,950534..950721,
                     950806..950881,951171..951359,951463..951603,
                     951806..951895,952186..952315,952592..952875,
                     953227..953319)
                     /codon_start=1
                     /gene="RvY_00320"
                     /gene_synonym="RvY_00320.1"
                     /locus_tag="RvY_00320-1"
                     /note="PRK12323"
                     /product="hypothetical protein"
                     /protein_id="GAU87485.1"
                     /transl_table=1
                     /translation="MTDKEAPEGEDPKNIPLEQRIEHKNWKCRAHGFEELAKQKFPMA
                     DTPDDIDFKKYASSVKNFVQDSNAAAHEKGLEAAYSFVDNASPAISGKVCSDVVAAII
                     GKCFTARQKQKEKGVDIILLYFEIEKQEATLEELVKGLSNKSPKIVSGCLSVMRDALR
                     TFGSKYVTLKLIIKPTLPLLEDRDKSVRDEARALLAEVYRWSGEAIRPALKELKPAQM
                     TELESEFEKHKNGPKVVPEKLVRSEQAKAKVAVEAPDGVEGDAAAAGDGAAEEEEDTV
                     KAEDLVEPVNIMPYLTEDFFKSLQSAKWSDRKDSLDILDKHSSTPKIAEGDFSGLITI
                     LQKIVAKDSNVVCVALGAKCLANMAKGLNKKFSPYAHSCVSIILEKFKEKKANVVTAL
                     QEAIDGCFLSLTLEQISQDIIEFLGHKTPSVKAETTKFLVRCFSKFNPEDLPKKLLKV
                     FLEALIKNTNDPDATVRDSAFEAIGTAYKVVGEKTMAPFLVDVDDIKKKRIEEYRDKA
                     VITAPKRKAPPAGAATKAEPSSKPEAKVVPGKKPVVRPGTKPAAKPAPAPAKAPSESD
                     DQESASPAEPAPAAAAKKVVGAKGKAVPAAAKPKVATKEEDTSPNITGTLKMKKQREN
                     DEKLLKVLKWSFALPHKEFILQLKDQASTVFSNSILTWMFSDDFKNHIKAIQSLQDDL
                     LRDREATIAVLDVVLRWFTLRFFDTNPQVLAKALEYLQLLFKKLNDDPPYTLTEMESS
                     SFLPFLLMKTGDPKEQIRKDVQHIVRLICNVMPYTKVYSYLADGMNAKVTKNAKQREG
                     CLKLATWAMESYGLEVCGSKPQDSLKIVAQQVGDRDKDVREAALKNLVEAYQLLGTEK
                     LFKFIGANEMPKKDRDMIEERIKRAPQKTAPAPTPTPTPKSDPTPAERPEASVRPAAR
                     YTTVHAAPSQSSSSVDASEPTTDSASDSGASTQSKASAAAPTQEKERDDTEKRPATVT
                     LKRQPPQLIPISSAQLDSALGTVEIPKLRQNDSPATDRVSILINSLMSDNPETSLNAL
                     KKIDEQFTKNGGADTAVKSSLADLYRLLNEVLKRLSANFMPNYPTNYQYIGTCYGHVL
                     HILRELFKNPRYTDQTTAVVLSDLIHNLIMVILDRRMELMIGGEEIVKNANLITLRIV
                     DNANRTQILCASIRLLRELLGSGHMTDKFLDLVIKCLWRCVRKMPENSMELQVEPVFL
                     EVHLFLKQFPAAFWQTAGEETPFRTIKTIVYTLTKMYGSKCMDYLTLIDDPQNSELAS
                     FLKRIAKTMEKEGEGDHRRENGDTNGHSPATHASLKKHEGNLSSIVQKVGSSDDQTVQ
                     QGLRELYEYKEAHGVDLDAFLLRTSPEFQQFVKDGLRAIEFEDKGLGLPNDGLSEKSQ
                     MIMQRLRGVISSPFITAQDIANVQSMAAEVKMDIRAGCFNTAKQRVDDAIKEVESRAY
                     NVENADSQRPPSLLSPSTPTKARSADDNAVNKTNNMAALRARVKNYLENKATN"
     CDS             join(944694..944765,944856..945058,945308..945431,
                     945503..945582,945660..945831,945946..946087,
                     946320..946537,946622..946726,946849..946938,
                     947072..947236,947315..947443,947658..947930,
                     948023..948289,948509..948715,948870..949217,
                     949563..949969,950183..950459,950534..950721,
                     950806..950881,951171..951359,951463..951603,
                     951806..951937)
                     /codon_start=1
                     /gene="RvY_00320"
                     /gene_synonym="RvY_00320.2"
                     /locus_tag="RvY_00320-2"
                     /note="PRK12323"
                     /product="hypothetical protein"
                     /protein_id="GAU87486.1"
                     /transl_table=1
                     /translation="MTDKEAPEGEDPKNIPLEQRIEHKNWKCRAHGFEELAKQKFPMA
                     DTPDDIDFKKYASSVKNFVQDSNAAAHEKGLEAAYSFVDNASPAISGKVCSDVVAAII
                     GKCFTARQKQKEKGVDIILLYFEIEKQEATLEELVKGLSNKSPKIVSGCLSVMRDALR
                     TFGSKYVTLKLIIKPTLPLLEDRDKSVRDEARALLAEVYRWSGEAIRPALKELKPAQM
                     TELESEFEKHKNGPKVVPEKLVRSEQAKAKVAVEAPDGVEGDAAAAGDGAAEEEEDTV
                     KAEDLVEPVNIMPYLTEDFFKSLQSAKWSDRKDSLDILDKHSSTPKIAEGDFSGLITI
                     LQKIVAKDSNVVCVALGAKCLANMAKGLNKKFSPYAHSCVSIILEKFKEKKANVVTAL
                     QEAIDGCFLSLTLEQISQDIIEFLGHKTPSVKAETTKFLVRCFSKFNPEDLPKKLLKV
                     FLEALIKNTNDPDATVRDSAFEAIGTAYKVVGEKTMAPFLVDVDDIKKKRIEEYRDKA
                     VITAPKRKAPPAGAATKAEPSSKPEAKVVPGKKPVVRPGTKPAAKPAPAPAKAPSESD
                     DQESASPAEPAPAAAAKKVVGAKGKAVPAAAKPKVATKEEDTSPNITGTLKMKKQREN
                     DEKLLKVLKWSFALPHKEFILQLKDQASTVFSNSILTWMFSDDFKNHIKAIQSLQDDL
                     LRDREATIAVLDVVLRWFTLRFFDTNPQVLAKALEYLQLLFKKLNDDPPYTLTEMESS
                     SFLPFLLMKTGDPKEQIRKDVQHIVRLICNVMPYTKVYSYLADGMNAKVTKNAKQREG
                     CLKLATWAMESYGLEVCGSKPQDSLKIVAQQVGDRDKDVREAALKNLVEAYQLLGTEK
                     LFKFIGANEMPKKDRDMIEERIKRAPQKTAPAPTPTPTPKSDPTPAERPEASVRPAAR
                     YTTVHAAPSQSSSSVDASEPTTDSASDSGASTQSKASAAAPTQEKERDDTEKRPATVT
                     LKRQPPQLIPISSAQLDSALGTVEIPKLRQNDSPATDRVSILINSLMSDNPETSLNAL
                     KKIDEQFTKNGGADTAVKSSLADLYRLLNEVLKRLSANFMPNYPTNYQYIGTCYGHVL
                     HILRELFKNPRYTDQTTAVVLSDLIHNLIMVILDRRMELMIGGEEIVKNANLITLRIV
                     DNANRTQILCASIRLLRELLGSGHMTDKFLDLVIKCLWRCVRKMPENSMELQVEPVFL
                     EVHLFLKQFPAAFWQTAGEETPFRTIKTIVYTLTKMYGSKCMDYLTLIDDPQNSELAS
                     FLKRIAKTMEKEGEGDHRRENGDTNGHSPATHASLKKHEGNLSSIVQKVGSSDDQTVQ
                     QVRKTSLASKPLRR"
     CDS             complement(join(954335..954471,954551..954643,
                     954726..954811,954887..955011,955085..955228))
                     /codon_start=1
                     /gene="RvY_00321-1"
                     /gene_synonym="RvY_00321.1"
                     /locus_tag="RvY_00321"
                     /note="Lipocalin_2"
                     /product="ApoD1"
                     /protein_id="GAU87487.1"
                     /transl_table=1
                     /translation="MDHQVFLFAACIAICALGHVKTCHGQIVLFGGCEKQNVTVKSDF
                     DASKYMGKWHEQKRYFVEYERGLKCVTAQYTALPDGVQVLNSGIKSSNGENSTALGEA
                     IVPNAAEPAKLSVQFPRSPAGDLWIVDTDYETYSVAYSCRNAGPFRLESAWLLSRKPD
                     QFSNETMSHIDDILRKNNIEKEAFLHVDQSSCSF"
     CDS             complement(958032..958244)
                     /codon_start=1
                     /gene="RvY_00322-1"
                     /gene_synonym="RvY_00322.1"
                     /locus_tag="RvY_00322"
                     /product="hypothetical protein"
                     /protein_id="GAU87488.1"
                     /transl_table=1
                     /translation="MGSAEELPMDATPGMGSPVSVTSRGEGAAATTTPERGQPGSSTS
                     TASHNHHTRPWRITSTQAVREKPIGR"
     CDS             complement(960910..961296)
                     /codon_start=1
                     /gene="RvY_00323-1"
                     /gene_synonym="RvY_00323.1"
                     /locus_tag="RvY_00323"
                     /product="hypothetical protein"
                     /protein_id="GAU87489.1"
                     /transl_table=1
                     /translation="MHPVLYFISRLSIRPPEQTGSSITVPLCLSSFRLLGPNSTQPQT
                     HPHRYPSRHFGQLFRLIPFSLPTNALTQPKLPFTLFPSWMTSTSQTCPAQPCNLGRRG
                     SNPTVSYFLLSACRDAMTAAAFAANK"
     CDS             complement(961345..961665)
                     /codon_start=1
                     /gene="RvY_00324-1"
                     /gene_synonym="RvY_00324.1"
                     /locus_tag="RvY_00324"
                     /product="hypothetical protein"
                     /protein_id="GAU87490.1"
                     /transl_table=1
                     /translation="MASRLTAMMVPFCILLGVVIMTSKVNGQFFTKTDKAVPRLGRRM
                     DPSMTQPASGNDQLAVPISQEIIYPSANSDLLRQPTLEDIRKWSQKAAFYNGGFYLDF
                     TIQS"
     CDS             complement(join(962671..962727,963426..963608))
                     /codon_start=1
                     /gene="RvY_00325-1"
                     /gene_synonym="RvY_00325.1"
                     /locus_tag="RvY_00325"
                     /product="hypothetical protein"
                     /protein_id="GAU87491.1"
                     /transl_table=1
                     /translation="MDYDDLLVYETSDVNNAKFSFVVSQPQPLLTMETTRGITLVVSL
                     GALRKPADRSLATSMRTDRVVAYISMPHLVVLDEG"
     CDS             complement(join(963949..965633,965705..965887,
                     966155..966508,966579..967319,967394..968627,
                     968713..968997))
                     /codon_start=1
                     /gene="RvY_00326-1"
                     /gene_synonym="RvY_00326.1"
                     /locus_tag="RvY_00326"
                     /note="Herpes_BLLF1"
                     /product="hypothetical protein"
                     /protein_id="GAU87492.1"
                     /transl_table=1
                     /translation="MGLCHVKYLVISTLKDRMDIRTSTQMIQLLLLVSVSCFRLFLPC
                     SGQSVQCVGGQTGSPLARVEPIDGAALFTDEEFVAEPRPWGTFCCNPDVNEFALVLQG
                     GDFYPVPLPPANFPPSQCNPDQPESVTLTVVKAPTGVIRDCRKIELDDLEGVPCLIFL
                     QGDVKNYLNRRQNCTYAPLPRVQCPGSSAGVEIKLNTETVAIIDQNAAPQWSTAFYQL
                     DPISEFAGAGSLIHLPWLSNLSVAEPWDKWGSQNWNISSITVFNVDGGVSDLLTVDWD
                     LSIRADPNMPPSQELTVPAIRLVKRISYKSCQAFGCNFTFSLTAFNFDGMNSTVDIFL
                     SVLDENNLPPRFDEHESLIELDEDDVNQDGKLPQVHAVDQDVGINCSIRYTLDKDSTN
                     FLVDESTGQLRLRNPEEPLQWSGEDLSRNTDSLLIRATEIPTDDGRCSLDMVATTLVE
                     ILVTSRRAVPIVVTTEPPLLSVKTYSYAEEAVGQVNVWWNGTEQNVETEFRMNISKGH
                     EDGAFDILPNGTLIKVWGKAVTERRLISIEIRDTSIRARLLLTKELTITTNGVGLRFV
                     STVYESQVFESSLNPANESFHFNAIDNLSGPCDGCICRFDHNDLPGSTVVNGTAVTVS
                     SWVDDANSREVYRSRIDVSCQEAMTVVLVNWHPRPRFRQSVEIRLPASTPAGNVIGVL
                     RPLHGYPYKLHYAAVADDFLVVDDERTGVLLLGQQLPAQEVPYQTTVFVHNEDGQGFQ
                     PEIVVPVSVLVFTDADFGATSTSTLASTAETGTGSTPTGNTDDTSPTGSTKQTPEIPN
                     SSSLSITGSTDTYSEETNWSEITSATETYTDRTSPASPPSGSTSDTASPATGGPSSGF
                     TPTRSTEQGTQSTTQGSMSPIPSVSPSISPTSESTVASADPTDSTSSTLEISSPSTHR
                     TESTSTKTITNSDLPENTEPTVQSTTPFTSTGQSDSMGTTPATSTLPPTVNIMANLAD
                     DFTDEQKKYFSFNGSSSQLEIKDVLPPNTPFDLSFSTRNARQTRADSAVQSRLDTSYV
                     IALRTLSYPVLTPKEGLSLPEIFLIVVSCLLFLAGVALIVCVVLIQRYRRQKAIDEQS
                     LRYPEAYAKNVPSTIYGSNVDFALRTNQSPNTVASFKSDSNHGSVFVRRSQSRAQSSN
                     PSFARNQSVLDTDRVKLVDNLEADRDSNQTDVDQLPNIPISQEMPRGNANIVMEDETD
                     NNAVSFMQSEDEVAKVEEVPERVETAKPEPDYPVTAAPPPPPPPPPPPPPPPRPDSTL
                     LSFGNTTEDNSDHIEAGDSEMSTSVWRSSDTEAKKTVEPTISAGEIFMNELKGAVSNP
                     YTVLKPLEFEKDSEKTVRFGLNVETISGGSSMDKPDDDTEEVNSPPVSVNITLSKPPL
                     PPKPAVVISPAVPKYQSAAKLDAIPAREAAVVSPPAPVYKSSRLVKGDRRVKENRGKN
                     GGTIVKRQISDSRSSNTPRPPAAAVAKSEAVDTETEQLTAEDTDIVSLNDDEDRTAL"
     CDS             complement(join(969457..970446,970522..970638))
                     /codon_start=1
                     /gene="RvY_00327-1"
                     /gene_synonym="RvY_00327.1"
                     /locus_tag="RvY_00327"
                     /note="DUF1208"
                     /product="hypothetical protein"
                     /protein_id="GAU87493.1"
                     /transl_table=1
                     /translation="MDLSYLTPIFETTSLEYQAKISLARAEKTQENFGNFCHLFSTYS
                     RIVAQARDRGDVLSTDLKKYAEEQQSSPTSKQSYDDFASLLYTMQSQEEARVRRLESK
                     VVAGFSKYSYICYSFLDHIKKAMAVREREHKKAEDFARNQNRFIGNINLKHHKQEKVQ
                     TAVHDSKRAQELLKRESDKFEGQKNEDLRRILMNFAEVELVFHAQALELYTSAYNLCK
                     TMGSNADIAHFRKSIAVPLAPPEGNPLAGVNQQLSGVEVKKEEGVTGESVAGEITAGE
                     DSGEVTEILATTDEATVDTADETAQQPRGSVKAVPKRPRRKSSVRRSSLTPAQIRRFS
                     KQFGVSEKEYREESTHNLAEHPKNVLKGSGRTAR"
     assembly_gap    973314..973363
                     /estimated_length=50
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     CDS             join(974957..975194,975270..975337,975497..975850)
                     /codon_start=1
                     /gene="RvY_00328-1"
                     /gene_synonym="RvY_00328.1"
                     /locus_tag="RvY_00328"
                     /note="putative centrin-1; CETN2"
                     /product="hypothetical protein"
                     /protein_id="GAU87494.1"
                     /transl_table=1
                     /translation="MPLIVRQSADSFRIGQFDFASSFPFCLESFLRTQDFPTKSSVFV
                     HATPCKMSSKSGKSNQSAAARKKNLKVDLTDKQRAEVREAFDLFDPDQSGEIDGKDLK
                     VCLRALGFEPKKEEIKRMLQDVKSDDGKINFDQFLILITSKMNEKDAHEEIQKAFRLF
                     DSDDTGKISFQNLKRVARELGESLTDEELREMIEEADLNGDGEVDEKEFLRIMQKTGL
                     Y"
     CDS             complement(join(976794..976887,976986..977155,
                     977239..977374,977659..977966))
                     /codon_start=1
                     /gene="RvY_00329"
                     /gene_synonym="RvY_00329.1"
                     /locus_tag="RvY_00329-1"
                     /product="hypothetical protein"
                     /protein_id="GAU87495.1"
                     /transl_table=1
                     /translation="MDPIEMWGIFFLSSVACATGAAAMPIEAWGIFFLSSVAVIKGGR
                     VDRAQHLVDISKYPEVKGFFRIEAWPLHLENDQVVEHNGISCDEPLGICGPELRIFID
                     KERQNHDFGADSTSHRNYTALLTAEDLNSPVVNKTISRNVCGKSVRSVDVRVRAEDVN
                     TMRYDDKIDNFSCFIFGPDIPAANEAESKWSTELSCDGQDRKSTKIWFRYRWFFIDPK
                     ICRSSFNDRGMLVGSLS"
     CDS             complement(join(977849..978296,978538..978740))
                     /codon_start=1
                     /gene="RvY_00329"
                     /gene_synonym="RvY_00329.2"
                     /locus_tag="RvY_00329-2"
                     /product="hypothetical protein"
                     /protein_id="GAU87496.1"
                     /transl_table=1
                     /translation="MNIFPASHSGGVDLGRAGKISLKWQFVIHSYMTTLVFPSTRCAG
                     VVGLHGIYLLVTSTLGQRSTLKRTLRDFRGKIVSACVHDYRSSVLVFITRLQPALLDF
                     TPAFQVPTKASFAVDSTTKSNSRSSGHISTTTASFRKPYEGGYRGAPFRGVPGIPQPS
                     HVLHRLIFLRSPGFPGKKWIRSRCGAFSSCRLWHAQLVLPPCLSKPGASFSCHRWQ"
     CDS             complement(join(978976..979046,979121..979485,
                     979709..979765,979837..979886,979951..980295,
                     980365..980517,980804..981012,981095..981167))
                     /codon_start=1
                     /gene="RvY_00330"
                     /gene_synonym="RvY_00330.1"
                     /locus_tag="RvY_00330-1"
                     /note="bifunctional arginine demethylase and
                     lysyl-hydroxylase PSR; JMJD6"
                     /product="hypothetical protein"
                     /protein_id="GAU87497.1"
                     /transl_table=1
                     /translation="MDERNEHDEEYFSKLAEAKEASRSELKTAADWNALNYAKLFAFS
                     LDAFIDNVPRIDATLVPHEQFIEEYERPYEPVVIRNSQLGWKAQTNWNYEALQELYGE
                     DRFKVGEDDEGYSVRLKLKHYLRYMKETDDDSPMYIFDSSFAERTGEKALLKDYSIPE
                     YFADDLFEYADQKRRPPYRWFVLGPARSGTGIHIDPLGTSAWNALVHGYKRWCLFPTA
                     VQKEALKVQKREAPKQTNEAVSWFQCVYPKTQLPSWPAEHKPLEILQKPGETVFVPGG
                     WWHVVVNLTDTVAVTQNFASRVNFPVVWHKTVRGRPKLSQKWYAVLRAKRPEIADMAD
                     QVDLQRSTGVQSDSSSSCSSSSSSSSNSEDEDDTKTKRPVPDGAAGSPQGTMNLPEHV
                     GSKRPLDSPDSGEGSLDSSDNSERKKLKAEVLPDDRLDGLEGRNAGAT"
     CDS             complement(join(979705..979765,979837..979886,
                     979951..980295,980365..980517,980804..981012,
                     981095..981167))
                     /codon_start=1
                     /gene="RvY_00330"
                     /gene_synonym="RvY_00330.2"
                     /locus_tag="RvY_00330-2"
                     /note="bifunctional arginine demethylase and
                     lysyl-hydroxylase PSR"
                     /product="hypothetical protein"
                     /protein_id="GAU87498.1"
                     /transl_table=1
                     /translation="MDERNEHDEEYFSKLAEAKEASRSELKTAADWNALNYAKLFAFS
                     LDAFIDNVPRIDATLVPHEQFIEEYERPYEPVVIRNSQLGWKAQTNWNYEALQELYGE
                     DRFKVGEDDEGYSVRLKLKHYLRYMKETDDDSPMYIFDSSFAERTGEKALLKDYSIPE
                     YFADDLFEYADQKRRPPYRWFVLGPARSGTGIHIDPLGTSAWNALVHGYKRWCLFPTA
                     VQKEALKVQKREAPKQTNEAVSWFQCVYPKTQLPSWPAEHKPLEILQKPGETVFVPGG
                     WWHVVVNLTDTVAVTQNFAR"
     CDS             complement(join(981822..982095,982298..982584,
                     982662..983078,983356..983973))
                     /codon_start=1
                     /gene="RvY_00331-1"
                     /gene_synonym="RvY_00331.1"
                     /locus_tag="RvY_00331"
                     /note="aspartyl-tRNA synthetase, cytoplasmic; DARS"
                     /product="hypothetical protein"
                     /protein_id="GAU87499.1"
                     /transl_table=1
                     /translation="MADIVEKDQKENAEKVSKNAAKKAEKAAKKAEIIAEKKTASGDA
                     SAEVETEDFAKDKYGLTALNQSKEKVDRDLTIVKDLTATLADQLVWIRGRLQTSRAKG
                     KQCFFVLRQQQYTVQALVAVGDKVSKQMVKFAAGISKESIVDVYGVVRKVDQTIDSCS
                     QQDVELHVEQIFVVSSAEARLPLLIEDASRSEKAEDATGPQISVNQDTRLDNRVLDLR
                     TTTNQAIFRLEAGVCKLFRNALDAKGFVEIHTPKIIQAASEGGANVFTVSYFKSSAYL
                     AQSPQFYKQMAIASDFNRVYTIGSVFRAEDSNTHRHLTEFIGLDLEMAFSYHYHEVTD
                     TIGQLFVEIFKGLRDNYADEISTVNKQYPAQPFTFLEPALRLEYTQGVQMLREAGVEM
                     EDDADLSTPNEKLLGKLVKAKYDTDFFILDKYPLAVRPFYTMPDPNNPRLSNSYDMFM
                     RGEEILSGAQRIHDPALLTERSKHHGIDLSKIQSYIDAFKYGCYPHGGGGIGLERVVM
                     LYLGLDNIRKTSMFPRDPKRLAP"
     CDS             986724..987224
                     /codon_start=1
                     /gene="RvY_00332-1"
                     /gene_synonym="RvY_00332.1"
                     /locus_tag="RvY_00332"
                     /note="zinc finger HIT domain-containing protein 1;
                     ZNHIT1"
                     /product="hypothetical protein"
                     /protein_id="GAU87500.1"
                     /transl_table=1
                     /translation="MAVQEVPFSLLDLDLKKAREKQNVAAQREAARRQRLENLQKDNH
                     FEDPHKNLVLAKDVPTFDDEADRKQTKKSRKAKLKERWKKSFPQALVDEERYWTTQQA
                     ASDFASLTYNYFTAEVGKSELPPLKLCSICSFPCNMKCVVCEDKFCSKKCLETHRDIR
                     CMKRVL"
     CDS             complement(join(987296..987556,987809..987989,
                     988052..988180,988244..988446,988508..988683,
                     988738..988809,989028..989151))
                     /codon_start=1
                     /gene="RvY_00333-1"
                     /gene_synonym="RvY_00333.1"
                     /locus_tag="RvY_00333"
                     /note="RNA 3'-terminal phosphate cyclase-like protein;
                     RCL1"
                     /product="hypothetical protein"
                     /protein_id="GAU87501.1"
                     /transl_table=1
                     /translation="MALEEFSGSFYFRQRLVLAVLSGKSIRISKIRQKDEHPGLSGYE
                     LNFLALLAKITNGTSWIIDETGTKLTFHPGLLSGGLFEHDCQTDRSITYYLEALLLLA
                     PFTKQSIEVIFTGVTNDQIDPSIDAIRHSSLPLLQKFLGTDEGLELKILARGLRPNGG
                     GKVRFTCPSKLKLRPLRNMEDSGLIRSIRGIAFTCGMSPSMGNRLGEAAKKILKEFVA
                     DVYCYTDQCKSDRNAGRSKGYGITLIAETEKGIRYAVDVTSEQPRSPDESTEQNKTME
                     TAEEMGERAALLLLEEIYRGGCVGSINQGLALLLMCLGQNGDVSKIQTGPLSPFTIQL
                     LRYIKEFFSVEFRITADSKTISDSPENSKIILSCVGIGYSNLSKTVS"
     CDS             join(992164..992563,992668..993281)
                     /codon_start=1
                     /gene="RvY_00334-1"
                     /gene_synonym="RvY_00334.1"
                     /locus_tag="RvY_00334"
                     /product="hypothetical protein"
                     /protein_id="GAU87502.1"
                     /transl_table=1
                     /translation="MAFRAVLYLALFAVALADLPPNYESLTAIQKQEILWNNINADVY
                     DYDNLPTAGPTPAQLVAFMNVNFTLQTFLLVSDEMPVGRTKVIHPYGPVAKARMVIFP
                     NSRYTGIFSPGQTHCLVRPSPGSFNPQNLVPGLGVKCLIDGAPSQNIMSLFAFAGQGT
                     NGNYFENSKFNIPLTDDRRTGRKITCPHLEALATKAGEVGSNTRNPVNDLFEATLAAL
                     PGGINDRPEDTGNMPLYEQASVRGDGSLVPAGQVVAPYKIEFVPNRLLSYPADTDKDF
                     RYQFGQIEPGTVVYQVVLYRTALSAEGELVGHLVSDSPFVSSHYADNRFFMRHGRQRW
                     QSE"
     CDS             complement(996971..997177)
                     /codon_start=1
                     /gene="RvY_00335-1"
                     /gene_synonym="RvY_00335.1"
                     /locus_tag="RvY_00335"
                     /product="hypothetical protein"
                     /protein_id="GAU87503.1"
                     /transl_table=1
                     /translation="MFELEDFPKLFAHCIKLEDDYWDIDTKEDRIEAVGDEQAVEDVA
                     EEGGDLEPLDQDLDDDNDLALLPF"
     CDS             complement(join(997209..997417,999278..999365))
                     /codon_start=1
                     /gene="RvY_00336-1"
                     /gene_synonym="RvY_00336.1"
                     /locus_tag="RvY_00336"
                     /product="hypothetical protein"
                     /protein_id="GAU87504.1"
                     /transl_table=1
                     /translation="MNHCENGKMLATPANATAAPERRSRDLEVVESNTVPEDDVNETL
                     DPVVEAEEIDGVAGVGRHLLKTEEGIETVRLPPYQMLGPPQRVCRQAKHHQKAA"
     CDS             join(1005225..1005457,1005584..1005719,1005783..1005816,
                     1005886..1005922,1006115..1006210,1006351..1006447)
                     /codon_start=1
                     /gene="RvY_00337-1"
                     /gene_synonym="RvY_00337.1"
                     /locus_tag="RvY_00337"
                     /product="hypothetical protein"
                     /protein_id="GAU87505.1"
                     /transl_table=1
                     /translation="MNGSICLLLALFFTSVLAGLVDRMQDVSDAQRYPLIRDFIRIEA
                     NILRLDNPRGISHTGLPCDITDSCDPRVIAFIDTEKPNHDFGGDSVPYRNWFTLYDGN
                     NINSPEINKLITRDICGVPIRKVNVRVRAIDKDMFNDDKIDNFACFITTDNTPAADEK
                     SAQWSAEMPCYGEDKSAIRVWIQWRWYLIPEQQCRASSNGRGWLDGWFTK"
     CDS             join(1008090..1008207,1008286..1008383,1008486..1008693,
                     1008780..1008900,1008991..1009087)
                     /codon_start=1
                     /gene="RvY_00338-1"
                     /gene_synonym="RvY_00338.1"
                     /locus_tag="RvY_00338"
                     /product="hypothetical protein"
                     /protein_id="GAU87506.1"
                     /transl_table=1
                     /translation="MAKAAIIALLIGFCATLGSAGLIDRGQDLADVAKYPLITGFFRI
                     EMNVVRLDTQGKSHTGLPCDIFDKCDPKIIAFIDTEKPNNDFGGDSVPYSNYITLVDA
                     NNTPDVVEIDKTISRDVCGKGVRKIAMRVRAIDKDGLNDDKIDNYKCHITGERNPPAE
                     NEKVAQWSPEIACAGEDRASSKVYLRYRWYNIPESTCRPSSNGQGLFSGLFSR"
     CDS             join(1010858..1010986,1011079..1011146,1011235..1011267,
                     1011349..1011406,1011474..1011551,1011617..1011665,
                     1011741..1011858,1011953..1012046)
                     /codon_start=1
                     /gene="RvY_00339-1"
                     /gene_synonym="RvY_00339.1"
                     /locus_tag="RvY_00339"
                     /product="hypothetical protein"
                     /protein_id="GAU87507.1"
                     /transl_table=1
                     /translation="MNFLCWLTLCAFVGICCGGLIDRGQDLADSARYPLVTGYIRIEL
                     HISRLDTRGKSHTGLWCDITDKCDPRVIAFIDTDRPNHDFGGDSVPYDNYVTLFDGDN
                     VDMVDIRKTISRDICGKGVRKVALRVRAIDKDTFNDDKIDNYKCFITGDHTPAESERS
                     ADWSPEIACAGEDRPSSKVYLKYRWYFINESECRPSSNGRGLFSGMFS"
     CDS             join(1012686..1012915,1012987..1013122,1013205..1013238,
                     1013416..1013557,1013653..1013749)
                     /codon_start=1
                     /gene="RvY_00340-1"
                     /gene_synonym="RvY_00340.1"
                     /locus_tag="RvY_00340"
                     /product="hypothetical protein"
                     /protein_id="GAU87508.1"
                     /transl_table=1
                     /translation="MMQLTIFCFAGILAYANAGIGARVQDQKDSDFPLLSGYFRIEAA
                     ILKLDNPNAISHTNLPCDITDKCDPTVTAIIDTEKPNHDFGGDSAPYRNWEVIYNGQE
                     VNSPEINKVLTRDNCGTGIRKVNVRVRAMDKDTVNDDKIDNFSCFITGAGPVGMPAAN
                     KDEAKWSPDFTCDGQDQKTIKVHVRYRWYKIPQAECKPTKTSGIPFIDGMFS"
     CDS             complement(join(1013871..1014133,1014193..1014436,
                     1014635..1014951,1015013..1015118))
                     /codon_start=1
                     /gene="RvY_00341-1"
                     /gene_synonym="RvY_00341.1"
                     /locus_tag="RvY_00341"
                     /note="WD repeat-containing protein 61; WDR61"
                     /product="hypothetical protein"
                     /protein_id="GAU87509.1"
                     /transl_table=1
                     /translation="MTHSVISTTKNAHEDEIWACKWATTGANSSDVIVTGSLDSAIKL
                     WRLDPETGQPVETKTLVGHRMGILRLDISAEHDMIASSGMEGSIHFWDLQTGAPRTEA
                     IQGGKIECWGLAFRPHSTLIGTSAQQGKIRLFDINTRNEVEAFDTRGKFITSVHFSAN
                     GKFLAAGSTEGTLYIFDLQANRLLHAIEAHGKPIRAVLFSPNSAMLASASEDGTIRLY
                     EPTEGLPITRITGHTSWITSLDFSPDSARVASCSTDATVRVWKTDKEKLAVFNEAHDK
                     IVWDVAFSPEGNKLISVAADNNMVLYRTPKEYS"
     CDS             join(1015512..1015581,1015655..1015854,1016047..1016229,
                     1016301..1016456,1016519..1016596,1016717..1016867,
                     1016973..1017069,1017177..1017312,1017523..1017774)
                     /codon_start=1
                     /gene="RvY_00342-1"
                     /gene_synonym="RvY_00342.1"
                     /locus_tag="RvY_00342"
                     /note="DDB1- and CUL4-associated factor 13; WDSOF1"
                     /product="hypothetical protein"
                     /protein_id="GAU87510.1"
                     /transl_table=1
                     /translation="MKVKVLSRNPDQYLRETKRDIPKIPRNYDPVQHPFEAAREYVRA
                     VNTAKLDRLFAKPFIGSLDGHREGVQTLLCHPQSLSTLISGSYDGEIRLWSLTERKCL
                     KAVQAHRGMVRSLCFNVTGSHLFSVGDDQNINQWNIDNFDEPVSTIPSKSSLFAIDHH
                     YNEAKFATGGEAVEIWDEDRSHPIRSFSWGADSIQALKFNRVETNILASCAADRSIVL
                     HDIRQAEPLRKVVLKMRSNALCWNPMEAFLFTVANEDYNCYSFDMRKLGTPVMVYMDH
                     VSAVLDLDYSPTGREFVTASYDKTIRIFPADKGRSREIYHTKRMQRVTTVKYSRDDKY
                     VVSGSDEMNIRLWKAHASQKLGYLEPRESAASRYNEKLKDKYGHHPQVKRILRHRHLP
                     KHVYNAKKQNDESRFSQKRKEGNRRAHSKPGAVPFVPERKKVTLQEQE"
     CDS             join(1020129..1020183,1020342..1020489,1020619..1020660,
                     1020943..1021396,1021703..1021948,1022026..1022136,
                     1022211..1022246,1022489..1022592,1022716..1022890,
                     1022962..1023095,1023322..1023608,1023665..1023709,
                     1024033..1024325,1024386..1024646,1024803..1024973,
                     1025148..1025189,1025245..1025964)
                     /codon_start=1
                     /gene="RvY_00343-1"
                     /gene_synonym="RvY_00343.1"
                     /locus_tag="RvY_00343"
                     /note="electroneutral sodium bicarbonate exchanger 1; ae"
                     /product="hypothetical protein"
                     /protein_id="GAU87511.1"
                     /transl_table=1
                     /translation="MASAPANNRSSARNRRNRDSAQFTLGDGEEVAEERANIPVVTHP
                     LFCEMEELRRAKSDGTLEWKETARWIKFEEDVEEGGNRWSKPFVATLPLPSLLDLRTH
                     IGQAAILLDVEVPALAPLCDLVIGEWINKGLVQEYHRDQVRDLLLRRHRHQFEGLGDH
                     KPSFALRQLSGIGRTLSQGLFNITHLGGEGTGEDGEEEKKRRQSEHRMNKVLSATSMA
                     SSDESGAVLSRNASRGNLNFSRKLPLDAESATILVGEVEFVLRPVCAVIRIGNNVCLG
                     NLTEVNIPTRFIFLLLGPVGNAAKYHEIGRAMGAVCSDPIFQQHLYAARSRKDLTDAL
                     DEFMNEATLLPPGEWDPQIRIEPPKKLPAQADRKRSLAESSAASPIVEEKEVEQKEEV
                     QVERTGRLFGGLVGDIKRKSRYYISDFRDGLSLQCLAAVVFLYFATLTPVVAFGAVLG
                     VHTGNNMAAMESILSAAVVGILWAFFAGQPLTIMGSTGPVLVFEAIVTTTCSTYGLEY
                     LPLRFWIGIWTGLFLFIMVATDAAYLVQFITRFTEEGFAALISFIFIFEAIQKLFAVR
                     KKRNVCVWPLNCPQLYEDCHCNISSNPSVFPDAQQPTSDLNSYSIAEMESGPAQLLSN
                     VTRGECSAQGGVLTGPGCSYTPDVFFFSIILFCGTYFLSYMLKGFRNEPYFPNRVRVI
                     VSDFGVTAAIIAMTLLDFYLGLDTPKLQVPSGLTPTIPDRSWIVHPFGTNPWWTSLAA
                     IIPALFAVILIFMDQEITAVIVNRSENKLKKGYGYHLDLLVLTISVIFCAIMGLPWMV
                     AATVLSINHVNSLKQESESRAPGEAPQFVSVRENRLTTLCIYLLVGASVFMTPLLSRI
                     PMPVLYGVFLFMGVSALRGLQFVDRLALLFMPLKYQPDYSYVRHVPLKKIHLFTFIQI
                     LCLALLWVLKSFDESSILFPLMVLALVGVRRLMDFVFSQRELKLLDDLMPEFTRRKKE
                     DQTKNNQDKTTEPHHNQVHESPSANHISVALPNGHVMTIPVNHSEHNSKGPEMVNETT
                     VKKSPRWNQSDKKEAQSGRPLLPKLGSSILGKGVPAQIPEEKSPPQSPSPRVSPIPLL
                     PFISVSPATPLQTPRGEAT"
     CDS             complement(join(1026324..1026411,1026513..1026810,
                     1026885..1026981,1027078..1027290,1027344..1027615,
                     1028133..1028193,1028269..1028625))
                     /codon_start=1
                     /gene="RvY_00344-1"
                     /gene_synonym="RvY_00344.1"
                     /locus_tag="RvY_00344"
                     /note="Tryp_SPc"
                     /product="hypothetical protein"
                     /protein_id="GAU87512.1"
                     /transl_table=1
                     /translation="MLFICTFLVGWLVVAAGAQCYPDRVLNIAVPRDGNSSIQSPYYP
                     SDYPKNARCEWLITGSNIGNPGLEFNAIDFDLEHSNCKNDYLLVIQVNTDGSEIQLGR
                     FCGEIGPRKLISFTNKVRILFISDKFLSKRGFKLSIKEPVCATGSKYCPGSETACVDP
                     SQFCNGVADCPDASDESSACSVPCGSTVIPPKEDLRWSRIVGGEEATPHSLPWQVALL
                     SSTGTFACGGSIVNRQWILTAAHCCQIYLSSPRNYKVRVGAHIVNATNEPYARTYDAS
                     HLAIHPGWQRPSTMSNDLCLMKISGVFDFGPHVSALCLAAEKAGSCSAGSAALVSGWG
                     KTSPARSLENNSDNDKDDLLAAREASKADPRVLPPLQQVYVDVTTNETCKKAYGSNLS
                     PDMICASRTGKDGCQGDSGGPLAQKNQDGVWTLCGVMSWGRGCAQARYPGVYARVDNA
                     LRWIWETILFT"
     assembly_gap    1027731..1027780
                     /estimated_length=50
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     CDS             complement(join(1030417..1030484,1030556..1030660,
                     1030749..1030838,1030920..1031081,1031189..1031198))
                     /codon_start=1
                     /gene="RvY_00345-1"
                     /gene_synonym="RvY_00345.1"
                     /locus_tag="RvY_00345"
                     /product="hypothetical protein"
                     /protein_id="GAU87513.1"
                     /transl_table=1
                     /translation="MISVAIVGLAFLVSAFADNVPPNCDCSAMPNKRLTCGNDGHNYT
                     DTCAYVNARVSNPNLGWRPCFQPGDQEAAAQWLKTMHAGMDPAAAEAMGKKERQACLT
                     NGQSMVGTMRVIIEQVLGMADVSIACMKPCPCSSNVCPGSKA"
     CDS             <1030749..1030889
                     /codon_start=1
                     /gene="RvY_00346-1"
                     /gene_synonym="RvY_00346.1"
                     /locus_tag="RvY_00346"
                     /product="hypothetical protein"
                     /protein_id="GAU87514.1"
                     /transl_table=1
                     /translation="LRDPCRHASSSTTARQLLGPPAESMGANQDLVKRNRTKRKSKVC
                     IK"
     CDS             complement(1032177..1032461)
                     /codon_start=1
                     /gene="RvY_00347-1"
                     /gene_synonym="RvY_00347.1"
                     /locus_tag="RvY_00347"
                     /product="hypothetical protein"
                     /protein_id="GAU87515.1"
                     /transl_table=1
                     /translation="MSEILPDPTQSLIDTCGHDTVWNYREGWPTNGHQDHDPPYKAYK
                     ASVSTTRFGRRTQVNEEDLCDGQQRLNHEHGPARASSRERRSQSDTDTVE"
     CDS             1033651..1033839
                     /codon_start=1
                     /gene="RvY_00348-1"
                     /gene_synonym="RvY_00348.1"
                     /locus_tag="RvY_00348"
                     /product="hypothetical protein"
                     /protein_id="GAU87516.1"
                     /transl_table=1
                     /translation="MADEWPSGPSGPLLVRNSTETVLPERLDGVEERVHTSRQSSNDK
                     VIAGLATIKGRGQRADLG"
     CDS             join(1034845..1035257,1035352..1035626,1035696..1036009)
                     /codon_start=1
                     /gene="RvY_00349-1"
                     /gene_synonym="RvY_00349.1"
                     /locus_tag="RvY_00349"
                     /product="hypothetical protein"
                     /protein_id="GAU87517.1"
                     /transl_table=1
                     /translation="MKQADQLRHTALEREQMAPEFVDAPWQRFIRVKDTFGSKEVSLP
                     RVHWITGWIRTIIWIQILIPLTCLVIDAVSDQQTPKDIKWDTEDAYHNKFTLHYAYEG
                     WYAAYWANGLTLCVGVYGLWVYYVPSAYLNAKIETRLRRIQNYLCAIAVIGSAIASYF
                     ELRKWQVVSKGLIKKNTAELQIPFSFSLVTAFFQLLPGTASLFLPVLGTLIITESNRF
                     FLADIPRFSCQGDSTDDLNTDENGDNPCQMAEDPDDEEWDPDTELDERQLPEDTVAAG
                     GITDPTIKRRKVSDVTGKLSVHLQDLIEQHMQRSGQESHTLLPARSKTAPVDPPAIA"
     CDS             complement(join(1036297..1036540,1036622..1036701))
                     /codon_start=1
                     /gene="RvY_00350-1"
                     /gene_synonym="RvY_00350.1"
                     /locus_tag="RvY_00350"
                     /product="hypothetical protein"
                     /protein_id="GAU87518.1"
                     /transl_table=1
                     /translation="MEALAEKVRWFQNVAKLSELAKLLIQRFDPGNKEALAQLLADKV
                     AEFAQLARPLVSVLLYYFIAGSDEEDEHNDVHSSDDEEDYDDHCDYGDGGALQLLRLR
                     FRWLW"
     CDS             complement(1036702..1037067)
                     /codon_start=1
                     /gene="RvY_00351-1"
                     /gene_synonym="RvY_00351.1"
                     /locus_tag="RvY_00351"
                     /product="hypothetical protein"
                     /protein_id="GAU87519.1"
                     /transl_table=1
                     /translation="MTVYAKGFHHPAVRRVGFQTVVHRCFVKVKVAEVFPYQRNAGAG
                     PFGDSDDEENDYDHWSVYFKSFGRTLVQIAGRDFFVLSESDLALINGTPYWVDDKQVI
                     PNPAVPYFLTSNVRRLDEH"
     CDS             complement(join(1037179..1037356,1037526..1037737))
                     /codon_start=1
                     /gene="RvY_00352"
                     /gene_synonym="RvY_00352.1"
                     /locus_tag="RvY_00352-1"
                     /product="hypothetical protein"
                     /protein_id="GAU87520.1"
                     /transl_table=1
                     /translation="MDASLDEIAVLKYSVVVTDTATPKPCGLDECQEMDKQLANVASL
                     KLTDIHPALLDEIFQSVDFLKLLIVRRVCSGWNVTISREAAPFLRQVAIAIDKNRSFG
                     SMPDVYNIWQYAKNASTVVMFGEALKM"
     CDS             complement(1037334..1037648)
                     /codon_start=1
                     /gene="RvY_00352"
                     /gene_synonym="RvY_00352.2"
                     /locus_tag="RvY_00352-2"
                     /product="hypothetical protein"
                     /protein_id="GAU87521.1"
                     /transl_table=1
                     /translation="MSGDGQATGQRCFAQADRHTSSSSGRDLPVCRLSQASDCTTVRS
                     NISARKSSGYTVATQFCEHPSKSFCEANCFCCNDNTWIRLIDRFRVVFLMLPVEFARA
                     GT"
     CDS             complement(join(1039121..1039286,1039373..1039522,
                     1039693..1040067,1040157..1040240,1040327..1040589))
                     /codon_start=1
                     /gene="RvY_00353-1"
                     /gene_synonym="RvY_00353.1"
                     /locus_tag="RvY_00353"
                     /note="putative UPF0396 protein CG6066; SynMuv_product"
                     /product="hypothetical protein"
                     /protein_id="GAU87522.1"
                     /transl_table=1
                     /translation="MGYSPARRRSGSPSSRRKRDDRRRASPPRGRRTPSRSRSRSRSP
                     VSRKRQPSKSRSRSPQRGREYSRERDRYNPVDVQPKDSNSRRWRRNDQDGHPERGNFN
                     PNRDSGRQDQFWVRRREQRDEIGNNGVAQVWSRSPPPMRDSDDEEAEARSKAVEAAKR
                     MATEEEEKEEKRKRKKKLKKAKKHKKSRSKKNSSDEDEAPPGPSWLPKNADEEPVNVG
                     GEQDEDEIGPTPRANLLTSDHRAFGKALLPGEGAAMAAFVAEGKRIPRRGEIGLTSDE
                     IVTYEQVGYVMSGSRHRRMEAVRLRKENQIYSADEKRALETFDKDERQKRENKILSQF
                     RELVKSKTSKK"
     CDS             join(1041056..1041292,1041352..1041421,1041575..1041611,
                     1041689..1041738,1041827..1042158)
                     /codon_start=1
                     /gene="RvY_00354-1"
                     /gene_synonym="RvY_00354.1"
                     /locus_tag="RvY_00354"
                     /note="cholestenol delta-isomerase; EBP"
                     /product="hypothetical protein"
                     /protein_id="GAU87523.1"
                     /transl_table=1
                     /translation="MKKLQLDDIPPHPYFPAGIHLPHYIENTHTVEILLAVFGVVVVV
                     IGVITWKIAKHYRPDFGTIDKAKICWFAVSGLIHLFLEGYFAKYHLTLSGHHDIFAQI
                     WKEYAKGDSRYLTSDTFTVVMETFTCVVDGPLCLWTAWAYLQNKPYVHVLQMLVSTAQ
                     LYGDILYMVIEWMEDFSHGPVFHPLYFWGYFVVMNAFWIIIPASLIAESAIVITKAVR
                     QSQASGNRISDSTDSLLETKKSS"
     CDS             complement(join(1045166..1045307,1045381..>1045673))
                     /codon_start=1
                     /gene="RvY_00355-1"
                     /gene_synonym="RvY_00355.1"
                     /locus_tag="RvY_00355"
                     /product="hypothetical protein"
                     /protein_id="GAU87524.1"
                     /transl_table=1
                     /translation="LLLGGCRFLLLVPFALLLCVIAGFMTGGRFTTLHGLPPQLFRKE
                     VSRKLEACLLPSVYPLLPAFAVNGIICNRLETGNNAGVTTADLYANSISAVHLPQVTG
                     MDHSIKVMNPKYPLQTPFLGTWSKAMMSRLFDPPGVKQFRDF"
     CDS             join(1046790..1046899,1047073..1047311,1047749..1048236,
                     1048458..1048778)
                     /codon_start=1
                     /gene="RvY_00356"
                     /gene_synonym="RvY_00356.1"
                     /locus_tag="RvY_00356-1"
                     /note="wingless-type MMTV integration site family, member
                     11; WNT11"
                     /product="hypothetical protein"
                     /protein_id="GAU87525.1"
                     /transl_table=1
                     /translation="MNVLRTKFTYMDLNWLLFLRAIIVGLAIDGSAGIKWLSLSKSNL
                     TWTSTQHCRLAFKYRTLDRGQAQFCKRYLDTMKYVTKASKDTRTACQTQFFHNRWNCS
                     SVELAPNFMNDLKYGTREQAYVAALSSASVVHAVAKGCASGTLTNCNCGPMPNEPPSG
                     DYKWGGCGDDVVFGMKVSRLFTDIPYSFKYFASQENQGKLKKKDKLSKLLVWKKSRQS
                     RAALNLHNQFAGRKMVEAALTRHCKCHGVSGSCQIRTCWKSLPTVKEISERLYRSYKR
                     AVEVRHLPASNSFEPVYPLVSDQTDETLLFSAKSPDHCTPDEKFGSVGTRDRLCNATS
                     HGPESCQSMCCGRGHYSYSVLVNVSCHCKYIWCCRVECQTCQQKLLVTRCK"
     CDS             join(1046790..1046899,1047073..1047311,1047749..1048257)
                     /codon_start=1
                     /gene="RvY_00356"
                     /gene_synonym="RvY_00356.2"
                     /locus_tag="RvY_00356-2"
                     /note="WNT1"
                     /product="hypothetical protein"
                     /protein_id="GAU87526.1"
                     /transl_table=1
                     /translation="MNVLRTKFTYMDLNWLLFLRAIIVGLAIDGSAGIKWLSLSKSNL
                     TWTSTQHCRLAFKYRTLDRGQAQFCKRYLDTMKYVTKASKDTRTACQTQFFHNRWNCS
                     SVELAPNFMNDLKYGTREQAYVAALSSASVVHAVAKGCASGTLTNCNCGPMPNEPPSG
                     DYKWGGCGDDVVFGMKVSRLFTDIPYSFKYFASQENQGKLKKKDKLSKLLVWKKSRQS
                     RAALNLHNQFAGRKMVEAALTRHCKCHGVSGSCQIRTCWKSLPTVKEISERLYRSYKR
                     AVEVSECML"
     CDS             join(1051414..1051622,1051925..1052007,1052077..1052261)
                     /codon_start=1
                     /gene="RvY_00357-1"
                     /gene_synonym="RvY_00357.1"
                     /locus_tag="RvY_00357"
                     /product="hypothetical protein"
                     /protein_id="GAU87527.1"
                     /transl_table=1
                     /translation="MALTLDMKAVPTTKKWDGDDGVSYGESPASGDQIVVRHAKQQSS
                     KAKVVIITASKTEAEGLQKTLDEQARHNALDLFVGRGFGLQAALGNGVVTDIVGWINS
                     FHSVSMHDERARVTSTEVVTVFGKRLYNMRKSMNPGEGTSGVQSKDLVFESDDEPL"
     CDS             complement(1055498..1056814)
                     /codon_start=1
                     /gene="RvY_00358-1"
                     /gene_synonym="RvY_00358.1"
                     /locus_tag="RvY_00358"
                     /product="hypothetical protein"
                     /protein_id="GAU87528.1"
                     /transl_table=1
                     /translation="MAPEVVRGEFVKTAADTDANSAANTAANTIAKAYKADVWSFGVI
                     MYACLAGLLDLNNLLTVKADAGVFPRSDLEKYHTNLTQRVGALPKTASFILRMTLQSI
                     LKIRDDERLDLNELLDVVDLHNVSRLPKTPTVQSSGTITAAQADEQGSPLPAPTTAPG
                     ATSDPLPSQTEPSKSEKNAENKKSVLSIFKRLNSTTQAKNTGSPPATEKSASSDTSLA
                     DPSPSQTESSKSQKNSDDVKPVVDALITLNRLNPLKKYSGVNALKELGRSKKVKGSVK
                     VLNALPQHDREAEQPPASPPSIPYALEQQPRPCNINTDQYQEVARLLVVGSTEPGIQQ
                     CGITAFGHGGVYVVTTSSREQQVVYQGTLRVPSVGTGQWSSEYYTNLLEPFTEVYAEY
                     VAALCQTESVSKNCLITAINEAVDISDQIRDSMNETIGSTDDETTQ"
     CDS             <1057788..1058138
                     /codon_start=1
                     /gene="RvY_00359-1"
                     /gene_synonym="RvY_00359.1"
                     /locus_tag="RvY_00359"
                     /product="hypothetical protein"
                     /protein_id="GAU87529.1"
                     /transl_table=1
                     /translation="LFVVLDNLTCKPKAVRYGGNKRSFCRKQFCQISGWYVADFSVRQ
                     FNVGKIFWLSFLNRERVTVVFHDITRYPFLLFKVSEFSLSLGMQDPRFLTSICGHCWD
                     KSPPGYVLSQGFPK"
     CDS             1059688..1059918
                     /codon_start=1
                     /gene="RvY_00360-1"
                     /gene_synonym="RvY_00360.1"
                     /locus_tag="RvY_00360"
                     /product="hypothetical protein"
                     /protein_id="GAU87530.1"
                     /transl_table=1
                     /translation="MVFDWRVFLFSLRIIHTTPLENQKVRTCGTRDLDLFMSTELRML
                     GILSWQHKTKLSGLANFQVLLQNYGYRKLPFR"
     CDS             1063209..1063769
                     /codon_start=1
                     /gene="RvY_00361-1"
                     /gene_synonym="RvY_00361.1"
                     /locus_tag="RvY_00361"
                     /note="TBP_TLF"
                     /product="hypothetical protein"
                     /protein_id="GAU87531.1"
                     /transl_table=1
                     /translation="MAIIKNIVATANWNCKINLEKLETMLNMAYYNPKSFSGLIIRRL
                     VPFKTHCKVFCNGKVVVNGATSEKSAKALTESYCQTMQKAGYGDARVTDFRIVNIIAT
                     FDFGRKIRLYDVYYIVRKVALGNGNYVCLVKSVSFEPEMFPAVSTKLDNVTCVLFHTG
                     KCNILGAKAESDVDLAELDFHDISEQ"
     CDS             complement(1066607..1066858)
                     /codon_start=1
                     /gene="RvY_00362-1"
                     /gene_synonym="RvY_00362.1"
                     /locus_tag="RvY_00362"
                     /product="hypothetical protein"
                     /protein_id="GAU87532.1"
                     /transl_table=1
                     /translation="MDYSNSGDFLKYLTGKVEYAEDPVYMVQIIHAASLLKNVSTWTR
                     VEVKFLASQLMQNEDSGLVLLSSTRKGIIRVIKFRIESQ"
     CDS             join(1070188..1070318,1071300..1071456)
                     /codon_start=1
                     /gene="RvY_00363-1"
                     /gene_synonym="RvY_00363.1"
                     /locus_tag="RvY_00363"
                     /product="hypothetical protein"
                     /protein_id="GAU87533.1"
                     /transl_table=1
                     /translation="MDPKLRHKQVAGDQQNKETCHAIRAKRDHVRGMAHPILMNFIVC
                     LDNPENGLLDGRRMKICKSRKDTALSKKSDKHYSEIHTIYEIKQFENQIQK"
     CDS             complement(1070526..1070804)
                     /codon_start=1
                     /gene="RvY_00364-1"
                     /gene_synonym="RvY_00364.1"
                     /locus_tag="RvY_00364"
                     /product="hypothetical protein"
                     /protein_id="GAU87534.1"
                     /transl_table=1
                     /translation="MYNCRDFCINERICKIVAISTVADRSTTVKFIIDVSPTRTNIRE
                     ETWNQHSLLRVKPVCSTVTRLLIILTVNQLGPKSVTALGCAGKETSIG"
     CDS             complement(join(1071460..1071910,1071949..1072187))
                     /codon_start=1
                     /gene="RvY_00365-1"
                     /gene_synonym="RvY_00365.1"
                     /locus_tag="RvY_00365"
                     /product="hypothetical protein"
                     /protein_id="GAU87535.1"
                     /transl_table=1
                     /translation="MSLYYHVLMGDRRRNIEQLIAEKRHLTNPPAVHHPNIDEPQKVL
                     SALVTGLFNAIGGNFPKGTIRVSQRDAPLISPRINMRSRALTSSSSTQSSKLNERKNN
                     NRNNNRCRGRSPGKRGGAGGRSGQQHRGSNVGNWGGRADQPTAGTERFGGRSHYYAAN
                     PRDDHQGSNHTAKGSSRKLKPARTSNPSEGTILTQTPKKLRTSTNMKECYSSTLIDGS
                     NDMCRGLVRVT"
     CDS             complement(1075743..1076096)
                     /codon_start=1
                     /gene="RvY_00366-1"
                     /gene_synonym="RvY_00366.1"
                     /locus_tag="RvY_00366"
                     /product="hypothetical protein"
                     /protein_id="GAU87536.1"
                     /transl_table=1
                     /translation="MGDLVTIAGFVFQNLLDRVGTRWITNSPTLDRPVDGSTVRCTNQ
                     EVVQWWLESIPVMLVCMSPLWMPYLTVFRAKELADVRGCKWWRKRKREEVPLGRSLTN
                     IRCIAYRNEDFSEFR"
     CDS             join(1077874..1077945,1078867..1079196)
                     /codon_start=1
                     /gene="RvY_00367-1"
                     /gene_synonym="RvY_00367.1"
                     /locus_tag="RvY_00367"
                     /product="hypothetical protein"
                     /protein_id="GAU87537.1"
                     /transl_table=1
                     /translation="MAPPAPVVTRILAETKANPPSGVVKLWSAYEEQTAQDGRNRRID
                     TSVYAGVALNFSVFRHPAVLHAGLRPLICQSREFMANTEIPIMHDPPHSRTRESVPGC
                     QNAAYRLINDQSSISETYSSQECIIRRSMAN"
     CDS             1080716..1080940
                     /codon_start=1
                     /gene="RvY_00368-1"
                     /gene_synonym="RvY_00368.1"
                     /locus_tag="RvY_00368"
                     /product="hypothetical protein"
                     /protein_id="GAU87538.1"
                     /transl_table=1
                     /translation="MDGEERITARILAERVRTSSYASSNAERAPRDSNGYLHMRMRPK
                     YFRSELALYDIKFYQILSGTTGSMCRTLLR"
     assembly_gap    1081645..1081694
                     /estimated_length=50
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     CDS             complement(1081751..1081948)
                     /codon_start=1
                     /gene="RvY_00369-1"
                     /gene_synonym="RvY_00369.1"
                     /locus_tag="RvY_00369"
                     /product="hypothetical protein"
                     /protein_id="GAU87539.1"
                     /transl_table=1
                     /translation="MPAATVAVQVRNTGRVRPPPKMLSSQWVLSDNTHAHNIHNTHAH
                     NIHNTHALGQVHKDSLAIQRV"
     CDS             complement(join(1083529..1085628,1087646..1088385,
                     1089926..1090486,1095811..1096067,1097110..1097185,
                     1098323..1099277))
                     /codon_start=1
                     /gene="RvY_00370-1"
                     /gene_synonym="RvY_00370.1"
                     /locus_tag="RvY_00370"
                     /note="ANK"
                     /product="hypothetical protein"
                     /protein_id="GAU87540.1"
                     /transl_table=1
                     /translation="MGAQASQLEHQEGDSPTPGSSDDAKQDAEESSISFPPAGPFGSS
                     DEAETVVGPAIEPSTERVAEPVIGLSDNSLPQYAAEHKEGHETRSTAQLVVEAAVKPT
                     VDALQVVLEKNFEKIANKVKLLGQARPDLTMDLSELGLTHAAVLLQDADLLERALQDL
                     DVDVNATANGITPLYLAAFSLYLSGVKVLLEHPETLVNGRTGDEQQTALMVAVATAVD
                     DPAGKRIGVIRALLDDGRCLLNQQDKDDWTALTYAARTGNTEAGRLLLSENRASSYSV
                     KQLLNACRIAYLSGHEVFCKVLMENITRAQCSGVLREITTVKEGSTTTPLSRELLKDA
                     QKWLAVRFTGIQTASLQPPLLARAYDDQETDESSHSPNHSDENTAVPPRTAELNTEYS
                     ALVGPVLRNSELNDSESASMISEVRRAEISSSCSNKTMITHRLTMTSRSDPRDDPELG
                     NAATDDPANRVPVPQNDDAEAITQELGANTSAIPQLTKAALVGAAEDDNWEMLYSTDF
                     SPSSGPTEGEQTNNPPSLARRCSVDDLCRYLKLSPRTTHILAESGISAIADLEQLQLK
                     DLDTDPLSGVDVEDKAVLADFLRKITLITTQPSTSSETEHQGLGESVLDPDLEQTLVR
                     DFLGAAADMKSVGEGLLALAGSEAGDLLPSFALDVQRAMVLVEQVMQVVREAQSSSTL
                     RSLDVPKEHLAKAYATLLSNAYHFTDWFAAKKLEEKYLTDLRDIIRTSGLSVTRDLET
                     LKKKQNNTLVVCCCSLYARKMKDQFLDQSECMQYQSGNNWHEQSGVVDNLFSDVDRFC
                     RFAAQNHDHSRASYCFYVDLHTDTVDNNLVQTQILGQDQLVNFEMPSPPVEVKHKTDP
                     YCVTSAQVSWREPTRGASNINSYVCYFRCSDREENWKSLDIEDAVSCSVVLRSLVPDS
                     LYEFFVRGVCVAGFTEGSEVRRIPTPTVRIPAPAKLLKTKPRNVFRTEDPRILEPNYT
                     VIENDNVTSSVDNGVIKFHQYLGKVSASPHPTAVVPASRAEDLTILLIGESGVGKSTL
                     INATANYIGGVRIEHDFRFRVVHDSDSSTSRTRDVTVYSFPYNIVCPGTISIIDTPGF
                     SDTGGLAVDQKVEQLLTDFLLCPPMANIKAINAIGIVVKGSTTNVDLHLQYVLERVLA
                     LFGQSLTPNIVWLATFADTDKPAVFRTIDDVCKLRNWPCKNKLPFNNSAWFTERNGLL
                     DFSASNFKFGHDAVKRFFETVKSFPPATLHDTRLVLKDRLHLKLMLESIKEDIRDCFW
                     EIENQQQLKAQLQGATADLENGICTEILITKKVKTLVDPSPSGNLYCSRCEKTCHARC
                     QVYTWGWFGIPSTCEVFVSGKCSICPNHCVPAAHSVGRKSYDMVPSQEKRSLEEVVYT
                     LEQEFEANVLEYPFEVLDKLNKLERAKNFEKAFQQVGKRIENLKDETKQKMLQAREVL
                     KRLEKNGFQVHSSKSVMQDYLADLLAKEERLKTPGWEDRVKHLQDCKRAQDEMDLLAD
                     DNYDPFAENVPSSRWQLMSVTNFTNSDDYLEKRNKKSLLQKILARARTVFDDAASVNM
                     SEFHTNSLQQ"
     CDS             join(1088954..1089217,1089601..1089654)
                     /codon_start=1
                     /gene="RvY_00371-1"
                     /gene_synonym="RvY_00371.1"
                     /locus_tag="RvY_00371"
                     /product="hypothetical protein"
                     /protein_id="GAU87541.1"
                     /transl_table=1
                     /translation="MQTEGPTLVPWYQGKALAWDVTVVDTLAQTYLQGSTNQVGYAAN
                     QAEEKKRRKYEELEGRYLFCPVGFETCGVFGNEARELVEKIGKKASPRVSMLPTDSCD
                     EAN"
     assembly_gap    1094830..1094879
                     /estimated_length=50
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     CDS             join(1100663..1100740,1101151..1101510)
                     /codon_start=1
                     /gene="RvY_00372-1"
                     /gene_synonym="RvY_00372.1"
                     /locus_tag="RvY_00372"
                     /product="hypothetical protein"
                     /protein_id="GAU87542.1"
                     /transl_table=1
                     /translation="MANHPKLKTPSQVHKELSMEAPIHKAYVFKLQELRERGFLDRPE
                     QVWNFDETAFNTSEMYDRVVARTGAKQIPSQFYGNEKENVTILPCGNAAGLQLKFMAL
                     HAGKVHVQSRLDDTYGLCYHAVNASGYMDQAHFANCFRCRRAL"
     CDS             join(1102369..1102685,1102760..1102865)
                     /codon_start=1
                     /gene="RvY_00373-1"
                     /gene_synonym="RvY_00373.1"
                     /locus_tag="RvY_00373"
                     /product="hypothetical protein"
                     /protein_id="GAU87543.1"
                     /transl_table=1
                     /translation="MGRGRLSNANKEIGATTATVIHGLRSRAKAGAVTTKKLPASVAE
                     DGTVTESIQITKNELAKVEKFLIVKATQSEAGTSKRVLDAIKLSKEDPSRKIRKKRPA
                     RRLRRVKSRRLKQAALQAPKGLQDELSTYFKPANAKRR"
     CDS             complement(join(1103185..1103471,1103739..1103894,
                     1103984..1104080,1104181..1104468,1104640..1104712,
                     1104986..1105281,1105521..1105717,1105771..1105958,
                     1106042..1106149,1106222..1106290,1106390..1106738,
                     1106831..1106873))
                     /codon_start=1
                     /gene="RvY_00374-1"
                     /gene_synonym="RvY_00374.1"
                     /locus_tag="RvY_00374"
                     /note="SAS2"
                     /product="hypothetical protein"
                     /protein_id="GAU87544.1"
                     /transl_table=1
                     /translation="MGQTESLVAEEQTEVNILADVPDCSEKLMAMDGHREAVEVYMED
                     LLTQVAEKVDGCEDVMKVTAVTDIESNAFVSIVSNDDQPASVLSALDPLGAAGLLPVE
                     PEAARSPVLDAENGARNKGGRAKKGSTTRYVKRAAVPKGSKKRGRPKEPATSLAEEAV
                     RESAESPQVLPVQNTSQGSERRGEAKKPTNYAEGNVPPPVKGLTDFLSNFFTPANEKR
                     RPTLKPSFTAPPKQKKPKVPLQRVASRNRSASPKETVSEGTEAAERIELIEKMRPPPR
                     KPRTTKSLPVSPSENVRPVPARRLTTRKLAVRPSEVPQELEKKDGDSAESIFGVSLEP
                     SKEDVDLFEEVRRRALISALIPPVVLEPCSGTDGSVTKSGRSSSVKKYRRKTVVAKPP
                     KLLQLGDKKYRTLHCSFSSRADAIRGDCIYMCEFCLRQFDSSRFLSEHYESCAWHSPP
                     GSILYRDTVKRYNPFVLSEGKPTTVQEEIVIYEVDGRDWALYCQRLALLGKLFIHSKN
                     LLYDVEHFCFYVLCYRNTYGDHVMGYFSKDKAKVPDCFNLSCIVVLPPYQGVGYGKLL
                     VEFSYLISRVNIQPGTPEKPLSDDGERTYKSVWKRKLLEALAWRKKDNALKTTLNDMA
                     AETGMCAQDVAGILVELKVLKREEKSGPPALKRTRPRTSRRAAGSWGIDMNAQQLTDF
                     MKAMEEDTLPKKIVLDEKKLCYAPKKQREEGEAA"
     CDS             complement(join(1108059..1108225,1108304..1108386,
                     1108478..1108627,1108691..1108877,1109174..1109535,
                     1109612..1110009))
                     /codon_start=1
                     /gene="RvY_00375-1"
                     /gene_synonym="RvY_00375.1"
                     /locus_tag="RvY_00375"
                     /product="hypothetical protein"
                     /protein_id="GAU87545.1"
                     /transl_table=1
                     /translation="MGKGETETYPCFERFQPLQPVTFDVQEYRIHRQLLCIGQEDAFF
                     LELGGDLLDTMPEDLKQSRVRKLTGEKRDSRAGKAQPTMLQKLRKKFSRKSSLLFGGQ
                     KTQLASVASTSHQEEKPVEEPSSQVATKQKRRSLSAELESLRDSLTPKFQTDSPCRTR
                     KQSGHYRMMAAGVVNDGEKVGAKKNSVKEDKRMAANEKRRLKRLQDKQLKDSNKANQN
                     LSRSTKKTSKTAVLSNGGANPRPETADGSQKVEETLTSQAEPATMDVLADWATISGGA
                     QEISIPDIAAGGSLQILALDSPLSLIDVFKQTSPTGSPLEEVRVRSADGRYFTALSPT
                     ATPSTSYSGSFFTAQKDPASPNADVFDLQTQTGTRNFDYLMRELSGKSVRHLGCSPPG
                     DVAVVLDHYLKSLPSAPQSFLNHSGPDYESGLDSSYSLEMDDSVMEDALSLLADSV"
     CDS             complement(join(1110299..1110556,1110798..1111718))
                     /codon_start=1
                     /gene="RvY_00376-1"
                     /gene_synonym="RvY_00376.1"
                     /locus_tag="RvY_00376"
                     /product="hypothetical protein"
                     /protein_id="GAU87546.1"
                     /transl_table=1
                     /translation="MKYLDLSTNDSAKGSNVTTVLGNFNGSFEEPSLPSPSSITSWFV
                     LSTTFHLFGGLTNLSLIIAAYNDRQSRPGSRLLVANLAFAGFLLSLVLSFGVTVATYF
                     SYLGLTWLLPHPGHCVFYAMYQVAIAATSWADVCLAVNRLAAICFPHQYNRVGSRKVS
                     ALMIAIAWAISIIDIGLHSSGKFGGLLERSSNGLCSLRVTERRGGFLVFLTVVIPYAL
                     VGVASVPIFITAFIKIRAARMSPQPQRRGTVLKKRLVIAKAMLASLIWCCLCAVPYTA
                     VWSVAPRLFVQYQGLTYWLKVGFVAEFAINPYGVPNCINTSSWSCEAACEEEENNRSS
                     IGTERKEVWHNDDKILCWHCAKLSARTCTIEILAVVRTPAPAYGTLYRSHQRQYARAF
                     "
     CDS             complement(join(1112667..1112804,1112865..1113013,
                     1113221..1113621,1113920..1114206,1114442..1114636,
                     1114722..1115053,1115149..1115350,1115419..1115555,
                     1115762..1115877,1115947..1116026))
                     /codon_start=1
                     /gene="RvY_00377-1"
                     /gene_synonym="RvY_00377.1"
                     /locus_tag="RvY_00377"
                     /note="very long-chain specific acyl-CoA dehydrogenase,
                     mitochondrial; ACADVL"
                     /product="hypothetical protein"
                     /protein_id="GAU87547.1"
                     /transl_table=1
                     /translation="MQQMSTLARIARAPAHILLRSSSTVTSSSTDLYAAAAPQRKEAY
                     NERPSRSESIPRLAKSSSKESATAGKGSYATKDVKPTRDKKARMEKKAMESKSFVANL
                     FRGRAVTEQIFPYPNVLDEEQRSTLQSFVEPTTKFFAEGVNPALNDEKAEVPPEVTKQ
                     LAELGAFGLQVPPEYNGLGCNNTQYARLVEIVGANDLGIGIFLGSHQSIGFKGIMLAG
                     TEEQKRKYLPKLATGEHFAAFSLTEPSAGSDAASIRSKAVLSPDGKNYILNGQKIWIS
                     NGGIAEIFTVFAQTDVKDEEGNVKEKITAFIVERGMGVKNGAPEKKMGIKCSNTTELY
                     FDDVKIPVENVLGGVGNGFKVAMAILNNGRFGMAAAMSGTMRAVIKKCVDQANSRYQF
                     GNLINSYGAIQEKLARMQMVQYVTESMAYHISGIMDQKHQDFQLEAAISKIYGSEAAW
                     FTTDEAIQLFGGMGFMKETGLERVLRDLRIFRIFEGSNDILRLFVALTGVQYAGGHLR
                     ELQKAMKNPMGNLGLVLNEGMTRGLRKIGVRSGGPSLDGQVDGKLKDSAQMLAVGIGM
                     FGETIENLLVKYRTNIVDEQFILKRVADAAIDLYSMAVILSRVTKSLQDNKETVDFEV
                     KLVNTFCHEAAQRVTANLLMTKSKRDVGNFKAMAELAQQMCEKGGAVQEHPLGF"
     CDS             join(1116432..1116666,1116861..1117264)
                     /codon_start=1
                     /gene="RvY_00378-1"
                     /gene_synonym="RvY_00378.1"
                     /locus_tag="RvY_00378"
                     /product="hypothetical protein"
                     /protein_id="GAU87548.1"
                     /transl_table=1
                     /translation="MSRFVCVSVRRNLLSNSNGCHFAPRRFMAGNTERGGFNEEGSPK
                     PKHSSVAGQSNTNPNANTGQHREPSYGSSSSVYSDHRMESQDTIDRRKENLASGPKSA
                     QDFAKAMIEENKTNAAKLAARLKDGYLTEDDRDLPEGKPHDWRAETGQITEKRRDKEH
                     AISSMPEHLKPIDKKAGIEPIPKLTDEMHAPSRHEPVERGYNSDKNDITRNL"
     CDS             complement(1117494..1117880)
                     /codon_start=1
                     /gene="RvY_00379-1"
                     /gene_synonym="RvY_00379.1"
                     /locus_tag="RvY_00379"
                     /product="hypothetical protein"
                     /protein_id="GAU87549.1"
                     /transl_table=1
                     /translation="MIPGLQLLLSLCWKLNVPAQQVLRFRAKLDELQEQQRQIEEIQQ
                     AAGDPGRSPAPSLFSRMCLARPGSCMSLRPVSSVATAGLFSMLNDFSSFTGEAGDDSS
                     PSAVRQTRGKDEEPDYSIEDLLPRLG"
     CDS             complement(join(1118110..1118438,1118614..1118860,
                     1119220..1119616,1119793..1120016,1120097..1120210,
                     1120288..1120384,1120472..1120740))
                     /codon_start=1
                     /gene="RvY_00380-1"
                     /gene_synonym="RvY_00380.1"
                     /locus_tag="RvY_00380"
                     /product="hypothetical protein"
                     /protein_id="GAU87550.1"
                     /transl_table=1
                     /translation="MADDIYEGFGSIGGAFRSELSSAVSPESVSSFRSNASNSRTFVR
                     PALSRAFARNTASARPPSSLCSTRQPLTADPGVSSARGTYHYGEVTREEDQGSDAPQA
                     VLESVLVDSIYLGAEGKIDEALEKSKEAARLCNRLQHQAANFRHGEDSDLSLSSLILK
                     VTLHYGQTLALAGKFRQAEKVFLNLLRQTTQHEGDLTTVNISLATLYQENGDFDKALQ
                     IWLTLFDDNVFSSGSEWNFLISQLTTCYSALGRYDLAFKYNEIVAEANDNHEASFRRL
                     LFLVKTEATWEKIQDAYHKLLYIHCSQCSPPSALHSSCTDLTKNATQLMLALGVSPEW
                     TEDELKRSSWQSVATEMDLQHCFDLLENGDVQQLGLFEQSLEHANKAHDAVPEDPGGK
                     YLVPSLDVCRLYLALHVGRLNLGCAHFAMGNHDAALQCFSSLGCEDADLNNKRLLYKG
                     SLPTTTKHETNVTRTASHRQSLQGDTTSALHTLLSVRVDGEDSVALYSRIGWLAASLG
                     DDDTAAWHYNRAHSLDPTDLTVIEWLARYSVEKDMPEKALKFYAEAFRIE"
     CDS             1121013..1121420
                     /codon_start=1
                     /gene="RvY_00381-1"
                     /gene_synonym="RvY_00381.1"
                     /locus_tag="RvY_00381"
                     /product="hypothetical protein"
                     /protein_id="GAU87551.1"
                     /transl_table=1
                     /translation="MAARNVTSSQSEYSVRGGITVNQDLSSAPVYGAQIPQAPASTVI
                     GDMQGFSPNHPVPDKQEPRPYSDALTDRIEQLGSTTSLMTSAEREEERRQVADVLEQL
                     DNLIRRSSQTSVDGGLQNAKRSDHDLLEGDYNP"
     CDS             complement(1122280..1122603)
                     /codon_start=1
                     /gene="RvY_00382-1"
                     /gene_synonym="RvY_00382.1"
                     /locus_tag="RvY_00382"
                     /product="hypothetical protein"
                     /protein_id="GAU87552.1"
                     /transl_table=1
                     /translation="MAECARRMIKTKIVAASANPSSQKLEQLVDKIHQLQQEIDKVKE
                     KNTRLRVHLGLAETSPSAPDLASGVTDSSSPSSPDRRARVKAGGTTDNHSKSISRPPG
                     IKKKK"
     CDS             complement(join(1122661..1122719,1122799..1122907))
                     /codon_start=1
                     /gene="RvY_00383-1"
                     /gene_synonym="RvY_00383.1"
                     /locus_tag="RvY_00383"
                     /product="hypothetical protein"
                     /protein_id="GAU87553.1"
                     /transl_table=1
                     /translation="MALADTLNMVAGLLPAQEAEFRIYLEKSGVMQLIGNVLSYAYKE
                     QTVVKPANLLE"
     CDS             1123744..1124367
                     /codon_start=1
                     /gene="RvY_00384-1"
                     /gene_synonym="RvY_00384.1"
                     /locus_tag="RvY_00384"
                     /note="succinate dehydrogenase (ubiquinone) cytochrome b
                     subunit; SDHC"
                     /product="hypothetical protein"
                     /protein_id="GAU87554.1"
                     /transl_table=1
                     /translation="MLTLRVSSHFAGALRVQSRQLTIPLHTSSFASKDVKLATDRFSG
                     KIKDQPDADQGIKFTQKEYRQSAGQGVPARGDDYFDKNLKLKRPLSPHISIYQPQLPW
                     LMSITHRVSGVALSLGLSLASVGILLASHDFVHYVDVIRSMHLNPYLIMTVKFGAAWF
                     FTYHYLNGVRHLFWDNGKGFKLPEVYRSGYAVLALSLLTAAYLVSLK"
     CDS             join(1124870..1124935,1125008..1125086,1125311..1125717,
                     1125954..1126068,1126165..1126289,1126350..1126613,
                     1126823..1126930)
                     /codon_start=1
                     /gene="RvY_00385-1"
                     /gene_synonym="RvY_00385.1"
                     /locus_tag="RvY_00385"
                     /note="UV excision repair protein RAD23; RAD23"
                     /product="hypothetical protein"
                     /protein_id="GAU87555.1"
                     /transl_table=1
                     /translation="MQVNCRLISQETFTIPAEPTTTVAELKKKIEDVKGENFKADLLK
                     LIYAGRVLDNNQATLESIKFVETGFIVVMAAKAKPSTKPTDSSARPTASTSTTSSTPT
                     TAATAPAPAPVSTASSTTIQASQPPSAQAAATQIHGAFGKTPAEIGAMVDAIVEMGYP
                     RGEAEQALRASFYNPERAVEYLISGIPAGISGGPSLSPPSGAQAAQGNAPAQPQGGGG
                     AQHNDPLANFRNSAQFAMMRQMIQQDPALLPQFVESIGQSNPALLNAIRDNQEAFLAM
                     LNNEEGMEDEEDLEGEDWQANIAEALQAQGIDPAPLGGLGGLGGAGAAQGGGGGGGVG
                     PNAQYVNVTAEEMAAIERLKALGFPEQVVIQAYLACDKNEEMAANLLFSGLDE"
     CDS             join(1129002..1129171,1130080..1130230,1130451..1130688,
                     1130935..1131496,1133364..1133993,1134005..1134260)
                     /codon_start=1
                     /gene="RvY_00386-1"
                     /gene_synonym="RvY_00386.1"
                     /locus_tag="RvY_00386"
                     /product="hypothetical protein"
                     /protein_id="GAU87556.1"
                     /transl_table=1
                     /translation="MELLVHTGPKARSSEPPPLVLLTVLGLLAVKFGVADKEVHFWQP
                     KYPPVIWYPEYPMFHNRTRPARIVVQMHDSLDFFCPDYLNSQYQSFTGPKKRPTDYGA
                     EEIFMVNGEDYQQCFQDDAKERRLNKKQTKLLLRCPNKMTANDHHSSRPNNNIKAKYQ
                     YTVSFRMFSPMPKGPEFSCNHEYYFLDDLDAEEPVYGVVPLVSPSETPTASAAPPGEE
                     PNKARGPISPSWMFPDPLQHSDTDNVGSVSTAVPTARPPERLTQRLPNISKSVRRITQ
                     LDPQSANHSRHQPTNGFHTSRRKHSKTPQSTGRRPSNFSTIDKSIAVAPEEPAEVKVR
                     MVVQQLPSPFGEFPSNGSSAASKASIRATTKPSKRVLEQATGGYRTGAKPPKKQPKER
                     KDALNRAIRNLIEAAQQNSIRGQARKQGIDRSAISREMKKRGIKVYRKVIRPFITEAQ
                     KVARKRCAQRFRKRYRKSDIPNFVFVDECYVLVEEYFNSQQERCYGKSFELIPDSKKH
                     KRLQKSPLKAMIFGGVWRDGRTRLIVRPSGFKINQATYQDRCLKPMLYDLKDKLDPRE
                     VIFYQDKAPCHVAKTTQSKPSLVVRKNNNPPNSPDLNPLDYGIWSALKARLGKHKIIR
                     NFEQLRKVLIKKWKALPEELIRDTVDSWLGRCRAVENSDGNYVD"
     CDS             complement(join(1136433..1136537,1136738..1137042,
                     1137319..1137613,1137739..1137888,1137996..1138177,
                     1138250..1138463))
                     /codon_start=1
                     /gene="RvY_00387-1"
                     /gene_synonym="RvY_00387.1"
                     /locus_tag="RvY_00387"
                     /product="hypothetical protein"
                     /protein_id="GAU87557.1"
                     /transl_table=1
                     /translation="MMPNANAGSAVIFYHEHYGNVHHPFPASFVQAVSLQDLRLINPR
                     AQPDERMICKTLVLGRYYPCMILAVEPGRSLEEQAAIVLRDRQHLEDRGRRWTNALKA
                     ERGGAVGEEQSEDEEEEVSGSEEDESDVDMENAGTQATPIITARFNPAHGTVSARRPL
                     NVSSPFKRTGPPPTKSQPPPRQIPMKQPKLVPLTPTTKHISRGVSEPHPNGNEVSDEG
                     SDDEDDDENENAATSASTPRGRSVVTTVHSRKAPVKVARKPAARRRGSAKKARRLMTL
                     APSTGVKLYPVAIPGATGGMVNLENLVERMTQETKMKAIRMAMSELFPPDDLQNCVIS
                     RKNKKADARMFDPEKLDALFEVYREYARRSGLFGRLPDRRDFGQMCSKVKIEARKQAG
                     LPGIRSGQKKNVAVPVVPVDMEAA"
     CDS             complement(join(1139567..1139690,1139758..1139837))
                     /codon_start=1
                     /gene="RvY_00388-1"
                     /gene_synonym="RvY_00388.1"
                     /locus_tag="RvY_00388"
                     /product="hypothetical protein"
                     /protein_id="GAU87558.1"
                     /transl_table=1
                     /translation="MKATRRTKNRRRSQKPDRYSYDLTAAGAWTSPAPRVAIASAPVI
                     TKNVKRMVIKKEVRIKEEKWDFT"
     CDS             1141603..>1141776
                     /codon_start=1
                     /gene="RvY_00389-1"
                     /gene_synonym="RvY_00389.1"
                     /locus_tag="RvY_00389"
                     /product="hypothetical protein"
                     /protein_id="GAU87559.1"
                     /transl_table=1
                     /translation="MDLVVGSCRPAEYSRVNLAFCVLHDTETTTDTQGIHFVDPNYIP
                     YPGWRSLNKDDQRR"
     CDS             1142484..1142876
                     /codon_start=1
                     /gene="RvY_00390-1"
                     /gene_synonym="RvY_00390.1"
                     /locus_tag="RvY_00390"
                     /product="hypothetical protein"
                     /protein_id="GAU87560.1"
                     /transl_table=1
                     /translation="MKSDSSGHHQTNHYTGELSAEAAQFTVTLLCGCNFIARFPQASK
                     LQRGRGVPGSHAVGAFLYVERLQVKGGLRIVVSCQSEIWLMPDGLKSLSETPGISHGS
                     IPCILASQGTLLVISYIGPLDHYSILQF"
     CDS             join(1143354..1143532,1146487..1146637,1146990..1147227,
                     1148815..1148931,1149081..1149694)
                     /codon_start=1
                     /gene="RvY_00391-1"
                     /gene_synonym="RvY_00391.1"
                     /locus_tag="RvY_00391"
                     /product="hypothetical protein"
                     /protein_id="GAU87561.1"
                     /transl_table=1
                     /translation="MDWQMREYFGWKFHPLFSLLLYLKYAAQSVEGLNDGSLDKDSRL
                     WHPKYPPVIWYPEFAMFHNRTSAARIVVQMHDSLDFFCPDYLNSQYQSFTGAKKRPTD
                     YGAEEIYMVNGEDYQQCFQDDAKERRLNKKQTKLLLRCPNKMTANDHHSSRPNNNIKA
                     KYQYTVSFRMFSPMPKGPEFSCNHEYYFLGIFPGQAKGSQDESSHEEMVEKALCSSNA
                     LRLQIFVSCTDGSGRHDFDKFPLMPNVIQLDRPAPSADLLMATPDSSTTIPPPTVKKP
                     ILSTQILPFDLPLPSSAKRTSTTPPSNSPPTDSEGKVFVSRSDRKIMRQQSEVAQLAS
                     TTKEPIDQEGVTFIVEFDGQKITSTSTLPSSTVLPRSRRPRPTTKHGNYTSHNKSAFS
                     RPRTTTSTAQRHCCHIFGLFCTIFAFLVVMPQLDRILDIL"
     CDS             complement(join(1150624..1150892,1151063..1151374,
                     1151656..1151668))
                     /codon_start=1
                     /gene="RvY_00392-1"
                     /gene_synonym="RvY_00392.1"
                     /locus_tag="RvY_00392"
                     /product="hypothetical protein"
                     /protein_id="GAU87562.1"
                     /transl_table=1
                     /translation="MAVVLKILHNSGQHRGIWIGDGGWKVEKIIGHKDFDPAKGFPEM
                     FKIKWLGWEEKFSSFEPAENFADTEALADYLKSHQVNANEAARLRSFTDQDHRKQISA
                     PLKPRRGRHPKGASKLTNATRTTLVSTWARSSAVTESSFARPISIVTVRKTLDGYRAI
                     RPREDQSVDPSMPEKLVQKGSMLITVTPKPGEAIITQ"
     CDS             complement(join(1152122..1152381,1152581..1152656))
                     /codon_start=1
                     /gene="RvY_00393-1"
                     /gene_synonym="RvY_00393.1"
                     /locus_tag="RvY_00393"
                     /product="hypothetical protein"
                     /protein_id="GAU87563.1"
                     /transl_table=1
                     /translation="MPPPAATVGTSRLNNGTLLSELAKIARSKSALARGPSRAQGYEN
                     RREFTRRPPSPVSRSKSLMVQKSVKRTVSSPARNERPTNKTRRPVPANRLAQASAASS
                     RVTRSRKSN"
     CDS             1152548..1152880
                     /codon_start=1
                     /gene="RvY_00394-1"
                     /gene_synonym="RvY_00394.1"
                     /locus_tag="RvY_00394"
                     /product="hypothetical protein"
                     /protein_id="GAU87564.1"
                     /transl_table=1
                     /translation="MKSSDNFLPAYLFWLARSKGFRCSVLKCRQSLQVAALFLTRASV
                     TLFVILREKLNATGSAEAMSAQRKSKLVEAWESWVALLTNYSRKTNRCDFDFSSSGDL
                     LRKRADKN"
     CDS             complement(join(1153513..1153529,1153699..1154193,
                     1154463..1154751))
                     /codon_start=1
                     /gene="RvY_00395-1"
                     /gene_synonym="RvY_00395.1"
                     /locus_tag="RvY_00395"
                     /product="hypothetical protein"
                     /protein_id="GAU87565.1"
                     /transl_table=1
                     /translation="MAVNTETWDQEAQWDVEKIVGHKDVDPVTGFPKMFKIKWLGWED
                     RFSSFEHLENLACTEVLAEYLKFHQVSADEAARLRSSTGQAPHKQVSAPRRRGRPPAS
                     KSAHTSDHTCALVNGKVECDYKVLFCTTDVRDDADGNMVVHHGSRGLLSPPTSKPVQS
                     NICGRKKRTRAKRAATPKEDKLQKRKCVERKTRVDKADQERDSFNSMQKRVNPRGGNG
                     SQQVDTFTRPSDSSNGGTDDDESVDLGIPEFRRALPVTATHTPAVSSQ"
     CDS             complement(join(1155406..1155462,1155537..1155722,
                     1155986..1156086,1156165..1156297,1156378..1156527,
                     1156710..1156946))
                     /codon_start=1
                     /gene="RvY_00396-1"
                     /gene_synonym="RvY_00396.1"
                     /locus_tag="RvY_00396"
                     /product="hypothetical protein"
                     /protein_id="GAU87566.1"
                     /transl_table=1
                     /translation="MPRIGSNYTAASPNPTEDYTPVYTTYQYPPPNPSVQSFPPGYEV
                     KVEQSHHVGAPGDSYSYTKTTTTEAHAKDKSKSSLNSPGGLLGSITKAGEKLVNKGLV
                     AANKTVDYVSAKLDETIAKHYGSSAIMNLFQTGNVLQLISKTTGRTLQILQAPNGQLV
                     LDGNGPDDPQAFHTHFIVTREPENVVTLHNNYNYIAVVNGFTTVHRAAEQGHVTLHCR
                     LRLHEPSDKYISLESLQEKTSTVGVTSSGALKSALATRYTDKDAFFAVRLIYSPHGAP
                     PTINSKDKNTK"
     CDS             complement(1157900..1158082)
                     /codon_start=1
                     /gene="RvY_00397-1"
                     /gene_synonym="RvY_00397.1"
                     /locus_tag="RvY_00397"
                     /product="hypothetical protein"
                     /protein_id="GAU87567.1"
                     /transl_table=1
                     /translation="MVEGNLCLVGIPDLVQEQNLPRPTWTFVFVLEHEQQACFLYKLP
                     KEVYRSEIIFVDEVQD"
     CDS             complement(join(1158371..1158641,1158708..1158824,
                     1158902..1159306,1159368..1159630))
                     /codon_start=1
                     /gene="RvY_00398"
                     /gene_synonym="RvY_00398.1"
                     /locus_tag="RvY_00398-1"
                     /product="hypothetical protein"
                     /protein_id="GAU87568.1"
                     /transl_table=1
                     /translation="MGRTRQVESLQIFIDFRGMAQIYLKLVLLLCFVISTIIYLAHKI
                     FHVTTETGESCISMFMGGFYAMDDFGQKGTWYAPCELIYRSTINESADCLRKSSVYLG
                     KENHIVLIGDSRIRQLRDGLIYHLSGVEHDFYVNPAIAYDQQLYKKHESTVTSIPTAN
                     LLIEFFWSVEMDEEGGTFGHALRTLESKGSKPDMIIIGAGIWVMKVCTYQKISQVECL
                     RNFKKNLIKPLQMLNRFADTGTVLWTPQNLVDEPRLLNLEYSHKELTNKNMMYYNNAI
                     RKHLLMDPLNKIIYWESYLQTDLQIDDTPDGLHVGPTTRNIDIQFLLNYLCNPYMEKD
                     YFDFRDRFSRRNICCQR"
     CDS             complement(join(1158671..1158824,1158902..1159306,
                     1159368..1159726))
                     /codon_start=1
                     /gene="RvY_00398"
                     /gene_synonym="RvY_00398.2"
                     /locus_tag="RvY_00398-2"
                     /product="hypothetical protein"
                     /protein_id="GAU87569.1"
                     /transl_table=1
                     /translation="MQGKQSLDRKQTADRSRRCTYWQYGEAHREYRMGRTRQVESLQI
                     FIDFRGMAQIYLKLVLLLCFVISTIIYLAHKIFHVTTETGESCISMFMGGFYAMDDFG
                     QKGTWYAPCELIYRSTINESADCLRKSSVYLGKENHIVLIGDSRIRQLRDGLIYHLSG
                     VEHDFYVNPAIAYDQQLYKKHESTVTSIPTANLLIEFFWSVEMDEEGGTFGHALRTLE
                     SKGSKPDMIIIGAGIWVMKVCTYQKISQVECLRNFKKNLIKPLQMLNRFADTGTVLWT
                     PQNLVDEPRLLNLEYSHKLDIFRPASADL"
     CDS             complement(join(1158671..1158824,1158902..1159306,
                     1159368..1159630))
                     /codon_start=1
                     /gene="RvY_00398"
                     /gene_synonym="RvY_00398.3"
                     /locus_tag="RvY_00398-3"
                     /product="hypothetical protein"
                     /protein_id="GAU87570.1"
                     /transl_table=1
                     /translation="MGRTRQVESLQIFIDFRGMAQIYLKLVLLLCFVISTIIYLAHKI
                     FHVTTETGESCISMFMGGFYAMDDFGQKGTWYAPCELIYRSTINESADCLRKSSVYLG
                     KENHIVLIGDSRIRQLRDGLIYHLSGVEHDFYVNPAIAYDQQLYKKHESTVTSIPTAN
                     LLIEFFWSVEMDEEGGTFGHALRTLESKGSKPDMIIIGAGIWVMKVCTYQKISQVECL
                     RNFKKNLIKPLQMLNRFADTGTVLWTPQNLVDEPRLLNLEYSHKLDIFRPASADL"
     CDS             complement(1160383..1160928)
                     /codon_start=1
                     /gene="RvY_00399-1"
                     /gene_synonym="RvY_00399.1"
                     /locus_tag="RvY_00399"
                     /product="hypothetical protein"
                     /protein_id="GAU87571.1"
                     /transl_table=1
                     /translation="MVQYIIRIDFRMATLFSSSFYDGKKPELFELDGIVANLPSHFPQ
                     SLIGLMIRMAHSSFIETINVDMNGVPTSMSRGLHESCFVPHDQSYDCLLQGFGLLLEP
                     HHSYASIGISSDLAFHKSLFRVPIWSHCAHTFTIAIDFSSKPYLRKPERPTLFTDIAD
                     TQHFELEKIVVCAFRLALQPL"
     CDS             complement(join(1161086..1161322,1161464..1161646,
                     1161735..1161860))
                     /codon_start=1
                     /gene="RvY_00400-1"
                     /gene_synonym="RvY_00400.1"
                     /locus_tag="RvY_00400"
                     /note="putative cell division control protein 42 homolog;
                     Cdc42"
                     /product="hypothetical protein"
                     /protein_id="GAU87572.1"
                     /transl_table=1
                     /translation="MALAEETQEVKCVVVGDAAAGKTSLLASYMAIKYPEESHIPKVF
                     DNYTAMVACGGELYKFSPFDTTGQEDYDRMRPLSYPQTDVFLVCFSVVEPSSFENVPG
                     KWFPEITHHCPRTPFLLVGTQIHLRDDPQTIIRLAGNNQKLISPKQGKKLAKKLRAVQ
                     YVECSALTRVRYFLAAVYTYV"
     CDS             complement(1163500..1163688)
                     /codon_start=1
                     /gene="RvY_00401-1"
                     /gene_synonym="RvY_00401.1"
                     /locus_tag="RvY_00401"
                     /product="hypothetical protein"
                     /protein_id="GAU87573.1"
                     /transl_table=1
                     /translation="MNTQAYTSMIDNQRPSTEKCCNEVANGLALLSTDKPDMVEEEKP
                     ARGMTMKWSIAKGKHRLS"
     CDS             join(1165099..1165164,1165629..1166227,1166492..1166874,
                     1167110..1167283,1167602..1167867,1168203..1169054,
                     1170202..1170378,1171296..1171587,1171936..1172837)
                     /codon_start=1
                     /gene="RvY_00402-1"
                     /gene_synonym="RvY_00402.1"
                     /locus_tag="RvY_00402"
                     /product="hypothetical protein"
                     /protein_id="GAU87574.1"
                     /transl_table=1
                     /translation="MALRSEIIVQCEDFLTSRVAQQISQSFHQVPQQQQPVSRSCSNG
                     RQPVVTSRRLPVDHVSYDDPPDTPQAPLMLNFTSLLPDDISHGCWTESELSPGDSAVY
                     SDDFSPDGDTSFSHPLSTFDSGYSYAGPSTLLCFDSANHHSVLESCSDPDTRSDQSSD
                     SIRCSLCAHPDQQLGLAEVPRWKSNWSLEDLEPIERKRQKRPSVPLYIPIPKDQMRPR
                     IGVREIDEVSELSNVPSPDGSSGISSSSPASDTECFAEEGAFLSQLHDCRVGVGQVAR
                     FRCQVTRGRAVSVTWQHGDKVVENGGRYRLYRSGDTTHSLEIYFVTLADAGVVVCRAI
                     SEENAGETSAYLRVRESLLPPRIPEFVYKMESVETIAGDDVELSCKVRGHPVPALAWY
                     FNGRKVTPMDSGLEIEHIGKEEWLVLIDKERLLSSATVRCVAHNPVGEASCAASIILL
                     SAENDNGSRSSSRRVEEKLVHIDKKITKANSRVLDSAEELLSNATQMMSLDKQLKVVD
                     SYLDRIEAKFQPGSRRPHKEASKKSRRKPAAQEGEAELSLIQVSFPPTLVLPPPPPPT
                     NSPSPGPTAIIHRTSDPAYSQPALSLPAAPPPSVSITVLSKHVASDKVRVVFKQSFDQ
                     HRRATPTVSTRPVSSADFTIRKPLKYLDIPLNEPLRYLDIPTKADRTQWEEGVRLPAV
                     VLREASMDYEAVDNPYSAENLKRRVAGGPSFFETALDPKSFPPPLTDSDPSQFDRGGG
                     QFDPRDQHSRQYVVKPKRKASPLKKSYLIEPEIFYQAESKVNRASDRLLRLDNRIGIL
                     QAELDVERDADIETPHKPEELQRLQSAVDYTAAEIQETERTIKQVELLVTRLHIQQQE
                     PQLHKAERGWTTVSPDYPDCYSYPGLAGSSPSPLVVYGTMTSTPQDFPQDGPSVRSLM
                     SRFQHEKNGLKNGHGENGGHHLGSSIAEDTSDFSATSTPDKDRKPLPVFNRAKFQEGL
                     AAAKSQAKPRIQASITARSLSREMREQLRIGHKPQMGAFRSNIMTAENGDYDPDKAAK
                     AKELAMADSAHDAHLHQQRSQPSPPSTRSDLQQHGHANHTANTTIPSPIQTQSTTARQ
                     AMPVFDEEHEHEEHQSDVDPLHSVADSVHSADQGAMESSGTYDMDSLDGDADHDEAEP
                     HYAQIAKKQQQDSAHANDHQVKEEDAGGKVNGHHRTNSNLVMDHHNDGDNDSGAGEGH
                     NEHEAPEHRQHSTNEEEGELPLSQAPNWDLLI"
     assembly_gap    1170852..1170901
                     /estimated_length=50
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     CDS             complement(join(1173902..1173960,1174048..1174063,
                     1174347..1174424,1174500..1174560,1174674..1174723,
                     1174789..1174949,1175076..1175176,1175409..1175752))
                     /codon_start=1
                     /gene="RvY_00403"
                     /gene_synonym="RvY_00403.1"
                     /locus_tag="RvY_00403-1"
                     /note="B_lectin"
                     /product="hypothetical protein"
                     /protein_id="GAU87575.1"
                     /transl_table=1
                     /translation="MSAKNTRRPTDNSSVRDLQHYLRLSDATLTRLQEEHFVSVRDVK
                     SIPVDRFGELKLPMRDEITLRNFLFPPPTGHQNITVSNKPDPRVADSGNVNDRPRLVV
                     RPEAQPHVQAQPRPVRPPPPGNPRREPRKEHTHRPHGKPPQSNHTSGNTSTSVTSKDK
                     QRPPGGSVVPENPPKSHLRSNEKLLPGQSLFSSTKNLRLTMQSDGNLVLYRTRDNHPT
                     WATNTHGQRVREAIMQQDGNLVIYGTSGHPIWATGTNAYAGTHCQVQDDGNFCLYEPT
                     GKCVWASQTWGQV"
     CDS             complement(join(1174028..1174063,1174347..1174424,
                     1174500..1174560,1174674..1174723,1174789..1174949,
                     1175076..1175176,1175409..1175752))
                     /codon_start=1
                     /gene="RvY_00403"
                     /gene_synonym="RvY_00403.2"
                     /locus_tag="RvY_00403-2"
                     /note="B_lectin"
                     /product="hypothetical protein"
                     /protein_id="GAU87576.1"
                     /transl_table=1
                     /translation="MSAKNTRRPTDNSSVRDLQHYLRLSDATLTRLQEEHFVSVRDVK
                     SIPVDRFGELKLPMRDEITLRNFLFPPPTGHQNITVSNKPDPRVADSGNVNDRPRLVV
                     RPEAQPHVQAQPRPVRPPPPGNPRREPRKEHTHRPHGKPPQSNHTSGNTSTSVTSKDK
                     QRPPGGSVVPENPPKSHLRSNEKLLPGQSLFSSTKNLRLTMQSDGNLVLYRTRDNHPT
                     WATNTHGQRVREAIMQQDGNLVIYGTSGHPIWATGTNAYAGTHCQVQDDGNFCKYESD
                     "
     CDS             join(1177096..1177180,1177401..1177637,1177760..1177933,
                     1178059..1178272,1178339..1178435)
                     /codon_start=1
                     /gene="RvY_00404-1"
                     /gene_synonym="RvY_00404.1"
                     /locus_tag="RvY_00404"
                     /note="ETS"
                     /product="hypothetical protein"
                     /protein_id="GAU87577.1"
                     /transl_table=1
                     /translation="MWKRLKLRYRNCSTISIQAEEDPLTVYKGKSNQEMEFKVDHEEE
                     VVEEDEVDDTHHTMESPSRLVIGVASVDIPVDNDMPLDLSGKLPCQISYVGNEICVET
                     HGPDSRKKNTASYTDNNAELIDSDASSTVSDCSVDLSNLENVVRLPEPKGHSELAAAK
                     RSKEKGRKSRGQLWMFIRKLLLKQDNDAIRPADRLVSWVDREKGIFRIQQTDKLSRLW
                     GTIRDNPTMTYEKLSRGLRHYYKSKILNSVPGRRLTFQFGPRASGWTEID"
     CDS             1178944..1180287
                     /codon_start=1
                     /gene="RvY_00405"
                     /gene_synonym="RvY_00405.1"
                     /locus_tag="RvY_00405-1"
                     /product="hypothetical protein"
                     /protein_id="GAU87578.1"
                     /transl_table=1
                     /translation="MCLLDKLLPHLDNVSVTSLKLKKGLAAHRHTTRHNKPQHYFHLH
                     QHHHHHPHHHKKKNPNDKVTARDWLESLVEKVDHPFTPAVETDPSLPPERYTAQDVKV
                     SPCPKSKTSEVFGSTHNAEEVRNLVRKVLMHQFEMTSQHEIPNLHHHLLSLHMSKEPR
                     KGAHLGALDRIRYMILKRRIVSMRKHSTVAVLRLHPNGLPALEELYAKTEEHVAENRE
                     KLFDVLESTESRQIAADAILDDLDLICPLKPSPHLKQISRLRDKRHLSLIGRSTINIP
                     FESSDFMARWLYRRCLQTCELNGCQLTQIQEQRSQEEDLNLSKIGKYQCTKCVASKVV
                     SARKSARYTDGPRNMANLTGSGYDLSRKYSVSQMPSMATIVEESESHVSHGPTLALYD
                     SDSTMLNEEIFSHHQLPPKNNLFFRGPRMNISGDSQQSKRSSGLRTVPDGDQFEH"
     CDS             1179337..1180287
                     /codon_start=1
                     /gene="RvY_00405"
                     /gene_synonym="RvY_00405.2"
                     /locus_tag="RvY_00405-2"
                     /product="hypothetical protein"
                     /protein_id="GAU87579.1"
                     /transl_table=1
                     /translation="MHQFEMTSQHEIPNLHHHLLSLHMSKEPRKGAHLGALDRIRYMI
                     LKRRIVSMRKHSTVAVLRLHPNGLPALEELYAKTEEHVAENREKLFDVLESTESRQIA
                     ADAILDDLDLICPLKPSPHLKQISRLRDKRHLSLIGRSTINIPFESSDFMARWLYRRC
                     LQTCELNGCQLTQIQEQRSQEEDLNLSKIGKYQCTKCVASKVVSARKSARYTDGPRNM
                     ANLTGSGYDLSRKYSVSQMPSMATIVEESESHVSHGPTLALYDSDSTMLNEEIFSHHQ
                     LPPKNNLFFRGPRMNISGDSQQSKRSSGLRTVPDGDQFEH"
     CDS             join(1182773..1182853,1182913..1182994,1183135..1183507,
                     1183862..1183987,1184060..1184210,1184274..1184480)
                     /codon_start=1
                     /gene="RvY_00406-1"
                     /gene_synonym="RvY_00406.1"
                     /locus_tag="RvY_00406"
                     /note="FabG"
                     /product="hypothetical protein"
                     /protein_id="GAU87580.1"
                     /transl_table=1
                     /translation="MVNEGESDAVAGKQAAKEEKKLSRCALVTGANKGIGYGLVRALS
                     KKFKGTVYLTARDKERGQEAQHALSRDDRLCEFLQLDVKDRASIEKVRDVIMEKHGGL
                     DLLIQNAGIVGADFYQIRLPDGPMTPPRWIDVADNNHNDVVNEVYSAEVAEDVVQTDF
                     FGALNVAEILFPLLRSHARVVYMSSGLGSLRNLEIVEVKKRLVDPELSVEELKSIAND
                     YLRVAKEKDPGNVGYPKHLGPYSFSKMCLTVLTRLQQRDIDKDESREDIIINACTPGF
                     VATEMTSYKGTKTIEEALDTPLYLAFLPPGSGPEQSKLPRGAFVRDLVEVDWIGERDS
                     SFIKV"
     CDS             join(1185384..1185461,1185524..1185856,1186082..1186267,
                     1186328..1186552,1186672..1186952,1187063..1187279)
                     /codon_start=1
                     /gene="RvY_00407-1"
                     /gene_synonym="RvY_00407.1"
                     /locus_tag="RvY_00407"
                     /product="hypothetical protein"
                     /protein_id="GAU87581.1"
                     /transl_table=1
                     /translation="MLRFGLVSLVFLQVFSNDGAEAYERSLNVSVDPGCPEATTCGAT
                     SEGYRPNLVYILSQSTATPPSPSVSNPDPSYRILWSTIGAPTVLVTEAPAGSDLHLTS
                     DNLKWMEFIEDSKHDPSSPFLFLWGGRFAGLTISKLIEFNDTKSIGKVSDSNATFIYD
                     LSSPTWYPVTLTNEPNGRVDGTFKGLLTSGGVQRNLTVIMSAFSTNDRTAMPPHMLVT
                     PSLVTVRVILDNLPVHFERSKFALELIYASNDASNTTANHSVERSTSDQYSPGVFTVE
                     RVSGSDTFVQWRPVVYTSANPGVSDSTRSTTSDLLNITMDVDRNHTDTGMPYSLLQGL
                     AGLTTTNSNTLVRFNVSFGENNDGYYNTSKYQEWLVEVGIGRAPHDTVTKSLKWVIAV
                     ALGIPAALLLVGALYAAYVKFGRSRLEDRTLLVKETTTVTNYDSVNQ"
     CDS             complement(join(1187824..1188033,1188089..1188439,
                     1188697..1188899,1189117..1189456))
                     /codon_start=1
                     /gene="RvY_00408-1"
                     /gene_synonym="RvY_00408.1"
                     /locus_tag="RvY_00408"
                     /product="hypothetical protein"
                     /protein_id="GAU87582.1"
                     /transl_table=1
                     /translation="MARSRFTDDDSAQRVDVRVKETRTIRYRNGNGNGLGDDDSDGPS
                     ANQDDYNQKTLIWWTATAVTLGIISFLMILAWCIRYNGGYDWKNPNYIIGTLNFHPTF
                     QILAFLVIAGTSMLSHRFLRTVNKFYVKIIHATLNIIAFIFIVVGVTGVFWYHDAHGI
                     PHLQSVHSWLGLTLLLLISLQWVIGLFGLLWPGFRDPLRGSYESAHRFTGRCIFILAI
                     AEILIGINKVSSNHTIMNVLALIVILYAILVGYILSKNAYTRQALMAGVGTGGYQPVS
                     GTDTVFERKLSSGSFGRRAAAKVEEDRYATTTTSVPAGNYQSMNDDPATKEALSVGRD
                     TLSRFTQRLEAKRNIDLTGPQATTEVVTTTITD"
     CDS             complement(join(1190345..1190665,1190878..1191098,
                     1191327..1191627))
                     /codon_start=1
                     /gene="RvY_00409-1"
                     /gene_synonym="RvY_00409.1"
                     /locus_tag="RvY_00409"
                     /product="hypothetical protein"
                     /protein_id="GAU87583.1"
                     /transl_table=1
                     /translation="MGSSRASASEIREVQRGYTRVDGGRVGAGVGADGVSTSRPKWLW
                     GWLGLYWLLTILMLILVGVYISNSGGLQWKNVFSPVRMFNFHPLFQTLGFLTIIGHSV
                     LIYRVFPDANIWVLQWTHALLNLFGYILMIIGVYSAGWSKDAQAQGERRTAHHFVSVH
                     SWVGLVVLILIAIQWLAGFFGLLWPGVHGARRVAVRGVHIFSGNIIFLLGCATVLIGI
                     DQLKPTSTMNTMALTVAAYALLGGYLLSTDVFYRGRMYRHPDARGQMEDENAPLASTT
                     VRYT"
     CDS             join(1192755..1192865,1193077..1193223)
                     /codon_start=1
                     /gene="RvY_00410-1"
                     /gene_synonym="RvY_00410.1"
                     /locus_tag="RvY_00410"
                     /product="hypothetical protein"
                     /protein_id="GAU87584.1"
                     /transl_table=1
                     /translation="MNTLVVSVFALSLLASQMLCGASPVSNGEDLSTQQRQTIATLAS
                     YILKIVSTSNDYSDFISTEKRNAEVLNSLIGLPRLLKDKGR"
     CDS             complement(join(1194814..1195043,1195269..1195611))
                     /codon_start=1
                     /gene="RvY_00411-1"
                     /gene_synonym="RvY_00411.1"
                     /locus_tag="RvY_00411"
                     /note="putative splicing factor, arginine/serine-rich 3;
                     SFRS3"
                     /product="hypothetical protein"
                     /protein_id="GAU87585.1"
                     /transl_table=1
                     /translation="MSRGGSGTQRSSGPLDCKVYVGDLGNNGDRSELEHAFGRFGPLR
                     NVWVARNPPGFAFVEFEDPRDAEDAARDMDGRNLCGRRVRVELSSGRSKPKRFGDRGG
                     NGGGNYGGGRDRGGGGGREERSFPRRRSRSRSPRRERRRSPSPMESKPEKRSKTSKAA
                     SRSPSPMAEKSSRRRRAASDEKNGSPSMKD"
     CDS             complement(join(1196655..1196868,1197125..1197411,
                     1197561..1197566))
                     /codon_start=1
                     /gene="RvY_00412"
                     /gene_synonym="RvY_00412.1"
                     /locus_tag="RvY_00412-1"
                     /product="hypothetical protein"
                     /protein_id="GAU87586.1"
                     /transl_table=1
                     /translation="MQTMGQRMMMLCVVVAMLMAGWTVTGTDSKSIIREMLQERMQFL
                     PDGRAANRPGRQFEDMPIERCRVTQNKELTTKLNRLCDECFQIYRVPNFYMKCRANCF
                     DNEIFRDCGKALYRQELTKEFNKFIETEVKLNGVTLPPSVTTATEKNTLAEVQEALLQ
                     LAQTQAAA"
     CDS             complement(1197121..1197408)
                     /codon_start=1
                     /gene="RvY_00412"
                     /gene_synonym="RvY_00412.2"
                     /locus_tag="RvY_00412-2"
                     /product="hypothetical protein"
                     /protein_id="GAU87587.1"
                     /transl_table=1
                     /translation="MGQRMMMLCVVVAMLMAGWTVTGTDSKSIIREMLQERMQFLPDG
                     RAANRPGRQFEDMPIERCRVTQNKELTTKLNRLCDECFQIYRVPNFYMKCR"
     CDS             join(1197684..1197755,1197921..1198124)
                     /codon_start=1
                     /gene="RvY_00413-1"
                     /gene_synonym="RvY_00413.1"
                     /locus_tag="RvY_00413"
                     /product="hypothetical protein"
                     /protein_id="GAU87588.1"
                     /transl_table=1
                     /translation="MKTKKKSPNDPGKYYWRRNPGKFHETGELPSGAQMININTSRDT
                     NLGAKAVISGDPLESFLVSVNERTRRHYDADQDKHRYFDEIMLIADG"
     CDS             1198267..1198509
                     /codon_start=1
                     /gene="RvY_00414-1"
                     /gene_synonym="RvY_00414.1"
                     /locus_tag="RvY_00414"
                     /product="hypothetical protein"
                     /protein_id="GAU87589.1"
                     /transl_table=1
                     /translation="MICSQISISSGARFRCFWPRECATWENDLGKCACARLVCCHELS
                     RFLTRKSGTGLLDGMGPQLVDTLGRSPDRISGEAVS"
     assembly_gap    1202424..1202473
                     /estimated_length=50
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     CDS             join(1204127..1204262,1204452..1204742,1204808..1204967,
                     1205222..1205511,1205584..1205638,1206530..1206629)
                     /codon_start=1
                     /gene="RvY_00415-1"
                     /gene_synonym="RvY_00415.1"
                     /locus_tag="RvY_00415"
                     /note="replication factor C subunit 5; RFC3_5"
                     /product="hypothetical protein"
                     /protein_id="GAU87590.1"
                     /transl_table=1
                     /translation="MAGRDMGLPLVAAGPTGVLGGLPWVERYRPTSMNELISHDNILA
                     TLQRFLVEDRLPHLLFYGPPGTGKTSTILSIVKQLYTPKEIPSLVLELNASDDRGIDI
                     VRNEIVNFVSARNVFSNKIKLVILDEADAMTKDAQNALRRVIEKYTNYCRFCLVCNYL
                     SKIIPAIQSRCTRFRFAPLTIEQMRPRLEEVLGQERAEWDESGMDAALILAKGDMRKA
                     LNLLQCTLMAYNKISGDAVFSCAGHPLRSEIEKAVVAMMNLPLSEAVAEVDELRTMKS
                     YAAQDVLQDIHSYLADLDLPAEVRILLLEKMADIEYRLSSGCSEKIQLSSLVAAFFIA
                     RNLLGKHTA"
     CDS             complement(join(1206947..1207419,1207568..1207921,
                     1208186..1208727,1208855..1209387,1209640..1210113))
                     /codon_start=1
                     /gene="RvY_00416-1"
                     /gene_synonym="RvY_00416.1"
                     /locus_tag="RvY_00416"
                     /note="cullin 5; CUL5"
                     /product="hypothetical protein"
                     /protein_id="GAU87591.1"
                     /transl_table=1
                     /translation="MATQRYSSFGSSMLEDGGSSEVDPHEMYHKEFRPTFLKLLNQSC
                     VPKPEWQHLFFSVHQYIMWADPKDDVAHALYKILREDTVEAVTVARDFIGAEHDDMSF
                     LQKYVQHWTEFFVLSLYAHLPFQSIDQALLEGPDASSFKPGNKGDDLGPIRRMFMEVW
                     KDTVLACFTSRLLQIVSAMMVTEREEGLAYGNLITDVRDSFFHVSPQRSFFEDSYEQM
                     YLNTLETYYTRVANERFTSGSAVDYARWAEQTFYDEHSRARKYLVPSKNYSEPINRMN
                     EKLVYILIKNARIFDSIIAESRKMVEEQRNEALGTLFKLLDRVKDGPEPLIDCVKEYI
                     VRKGKDDMMESASIVANDPEKYVEKLLTLYQTFSKLVHEAFNDDHRFTSARDRGFQEV
                     VNDTSVFSVQLKGRSGNVESRCPEMLANFCDSLLRKTTLSRRLGSEEVSQRLKSTLQV
                     LKYITSKDIFMQIYQTTLARRLILGLSVDSDLEEEMCRWLANVGMPAEVINRINRMFG
                     DVRVSEDLSREWAEHESKSHASSRLGEVDPKVLNGCSWTRLGTERTVCHMPSEVEEFL
                     TEFEKWYCGRFQGRKLGLTASSSTVVSQFTSNIGTYELELTLFQMTVFRAFVDCQKAK
                     LSLEALQVATGLPQNELRRTLWTLCTLAKCGNVVMCYAPKAQSAKDFETATRFWINMD
                     FAPTRAGRPQKRGRINLIGKLQIGGERHVEEDQESITALRELRVQEAVTKMMKTRKTA
                     TMTEIHTETIELLKNLFAPNRKMLKEQVEFLIEKGYLARDERDLNVFHYVA"
     CDS             complement(join(1210634..1210727,1210796..1210899,
                     1210955..1211257,1211524..1211760,1211817..1212091,
                     1212331..1212701,1212777..1212892,1212967..1213179,
                     1213248..1213444,1213788..1213975,1214037..1214320,
                     1214638..1215009,1215089..1215190,1215416..1215558,
                     1215683..1215828,1215905..1216010,1216116..1216344,
                     1216575..1216748))
                     /codon_start=1
                     /gene="RvY_00417-1"
                     /gene_synonym="RvY_00417.1"
                     /locus_tag="RvY_00417"
                     /note="Smc"
                     /product="hypothetical protein"
                     /protein_id="GAU87592.1"
                     /transl_table=1
                     /translation="MPRIGDTWTVKPKSRDSFLPPVTSTPLMERQKRPALISPNPEQS
                     EQASKQRRTVSPVASISSGVNGSARNSEDRRSEESAVAERPESTTPSEGSVVYKKAAG
                     WIKKVEMKDFLIHSDFAVEFGSSVNFVTGSNGSGKSSIASAIAIALGGRCTLTDRKGK
                     LSDFVKHGRKTAFIRVTLSNEGRNAYLPGIWGKSIVVERRIQKEGKNSRDAYRIVDEN
                     GALIGDTQTMLKRIVHRMNIQIDNPVFFLNQRMSKEFMQLATPKVMYKFFYQASGFDT
                     VETANQGSGKSVGETDKEIARLEREAVAVEKELEEKKSKRDVAIDEKDLYEKLEGARR
                     NRLYYEHKQFRDELSDLETAVANIKDRLDDIDGELEAKQNTTQDDEVVQHTLRQSEEM
                     EKYRKLAEKKGKALEAAKEKLKEHTKALTSLKRKAKALSPGGKTPKARSRISTTSGQR
                     ASPLASGEQSAAEWAQSFNIPNRSFDNSIVNRTSSRRNELERSILQSDERENDLDGRL
                     ETLEKRYKELIEYLDKAGNVDEEYRRKEKEIEQLKKDGVRTWKGSVSVETRNVATALS
                     KLDDDDKGCVVLGLLADEVALRDDTFGIAADHALSPWLETFFLLVPAGSSTTENFGVL
                     SGIKYFCSSEGCTPPAFLLLPDDALSAEAFRINRDDVRKIAPNAKFMQDIVKVGKNNE
                     MKILMKNVLPARNFVFVEESALAQRLSISGIPGLEKVYDAAGFCYGFENGTWNITAPE
                     VRTLTPQTVTSYTQIITAAESEKIELAGQKQLREHRTEELFKVKQQLTELKDRMMRTV
                     QHGVSARKELKVAQPNFEEPLQTQRSAWDPSLSETLPSTSHASLARSSLAPSVVDNNE
                     DEGMGEEPEEEDLAEEEQQPEEGNDELTRLNESIHKGTETAKQMRANIKKLEKEHKEA
                     VKNYNTLQQASAPASMRTRGAEKEKKEAIVRLKAEKDTLNKQLKEKNKLIAACEENKK
                     NVEEELAELDVEDPDEMPEPTQSFEDVLKELEIWNKAQEHLLMNKDAISRKQLNEQIE
                     TLEQRKKDGTRDLENAKKLQTYMDENWKQRVLNKEVGLARAADQAQKHCITLMEEQGF
                     KCQLSVNIPAGTVDYRVAPRSNTVLGPLNVLSGGERSMALAALLTSFWDQRSPFRVLD
                     EFEVCMDNKNREAAMKFLVQRATYDSAQCIFFSPLNIDLDRIAQPGVIHRVELESPPR
                     EQEEEEPGSDSEN"
     CDS             join(1218099..1218455,1218543..1218603,1218681..1218758,
                     1218870..1219108,1219326..1219538,1219620..1219710,
                     1219782..1220109,1220190..1220277)
                     /codon_start=1
                     /gene="RvY_00418-3"
                     /gene_synonym="RvY_00418.3"
                     /locus_tag="RvY_00418"
                     /note="Tryp_SPc"
                     /product="hypothetical protein"
                     /protein_id="GAU87593.1"
                     /transl_table=1
                     /translation="MLKAVLCLAALVACASAQCAPNGAMDVEVPAGGKAYIQSPNFGN
                     GDYPNNANCQWNVNSPNSAKLAIEVNSVAFSLEGVSCGFDYVSIFQVNSNGADVLLGK
                     FCGEAGPQGLVASSTRVKVVFRTDSSITKRGFNISFSDPFCNPGSNLCSGSDSVCIRP
                     DQYCDETEDCPDGSDEGPGCSGECGTTTIPPKEDKNARAFRSLVAHRAMGAGNRIVGG
                     VEAEPHSLPWQVAMLSSSGSQLCGGSIINSQWVMTAAHCCKAYAPTAANYKVRVGAHV
                     WSATNEPYAKTYTLEKLFVHPSYQRPKTYSNDFCLLKVNGIFDFGVHVGAICLADDDD
                     CAAGTAAMVSGWGNVNPARMGDQINNFDQFVKNIKDAEAGLLAKDDDPNYNQDARVST
                     LRQVYVDVVPQANCSTAYPGSISDDMICGARPGKDSCQGDSGGPFVQKNAEGIWKLCG
                     VVSWGRGCAQARYPGVYARVATATEWILQTILSN"
     CDS             complement(join(1220580..1221298,1221423..1221603))
                     /codon_start=1
                     /gene="RvY_00419-1"
                     /gene_synonym="RvY_00419.1"
                     /locus_tag="RvY_00419"
                     /product="hypothetical protein"
                     /protein_id="GAU87594.1"
                     /transl_table=1
                     /translation="MMWVSVAFAVMVTFLFGRGAMSSVLSTTDQTLQSRDSLQPMRKE
                     SEVFASPFHRRLRTTSESSDRFGDIDLGDSVKREEDLPYFINCAQFPLRVDVSMIGCQ
                     PNPILLCFTDTATGTELGSLSSDHAPVYHSYLPFGEKLEAVLSQFCDTNDRNNSGAKF
                     EIPGEHHLLGASNSVTIYAVRFPACNATMLKLANEARKTVTLRIKSCFPPRTTSTAPT
                     AKYTSLETTAERENGSITLNNITTNFSVITTMAPADTNIDTGSAMSAKHVTVGVIVVV
                     TVGVIVVVAVLMGTLILAICKSR"
     CDS             complement(1223053..1223313)
                     /codon_start=1
                     /gene="RvY_00420-1"
                     /gene_synonym="RvY_00420.1"
                     /locus_tag="RvY_00420"
                     /product="hypothetical protein"
                     /protein_id="GAU87595.1"
                     /transl_table=1
                     /translation="MKASEEILAHSLAKLANEARKTVTLRIKSCFPPRTTSTAPTAKY
                     TSLETTAERENGSITLSNITTNFSVITTMAPADTNIDKLSLL"
     CDS             1225780..1226094
                     /codon_start=1
                     /gene="RvY_00421-1"
                     /gene_synonym="RvY_00421.1"
                     /locus_tag="RvY_00421"
                     /product="hypothetical protein"
                     /protein_id="GAU87596.1"
                     /transl_table=1
                     /translation="MASRKLKTAGQVNKELMVEAAIKAVKERGLSENAAAVEFGVCRM
                     TMRRRIENPNPEPHGGKTKFPQWAEDILASFLLNCSGMGVPLNRYHCVQLFSELATEI
                     GE"
     CDS             complement(1228532..1228723)
                     /codon_start=1
                     /gene="RvY_00422-1"
                     /gene_synonym="RvY_00422.1"
                     /locus_tag="RvY_00422"
                     /product="hypothetical protein"
                     /protein_id="GAU87597.1"
                     /transl_table=1
                     /translation="MKLHHLTEAQKSQRYERGRFATEYVRGDKVSKIITMDETWIIPD
                     GCNSKGHVCHTEVLVARRA"
     CDS             join(1231340..1231696,1231784..1231844,1231922..1231999,
                     1232111..1232349,1232567..>1232650)
                     /codon_start=1
                     /gene="RvY_00423-1"
                     /gene_synonym="RvY_00423.1"
                     /locus_tag="RvY_00423"
                     /note="CUB"
                     /product="hypothetical protein"
                     /protein_id="GAU87598.1"
                     /transl_table=1
                     /translation="MLKAVLCLAALVACASAQCAPNGAMDVEVPAGGKAYIQSPNFGN
                     GDYPNNANCQWNVNSPNSAKLAIEVNSVAFSLEGGSCGFDYVSIFQVNSNGADVLLGK
                     FCGEAGPQRLVASSTRVKVVFRTDSSITKRGFNISFSDPVCSPGSNLCSGSDSVCIRP
                     DQYCDETEDCPDGSDEGPGCSGECGTTTIPPKEDKNARAFRSLVAHRAMGAGNRIVGG
                     VEAEPHSLPWQVAMLSSSGSQLCGGSIINSQWVMTAAHCCKAYAPTAANYKVRVG"
     assembly_gap    1232652..1236262
                     /estimated_length=3611
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     CDS             join(1236298..1236472,1236701..1237212,1237365..1237580,
                     1238168..1238512)
                     /codon_start=1
                     /gene="RvY_00424-1"
                     /gene_synonym="RvY_00424.1"
                     /locus_tag="RvY_00424"
                     /note="presenilin enhancer 2; PEN2"
                     /product="hypothetical protein"
                     /protein_id="GAU87599.1"
                     /transl_table=1
                     /translation="MASRKLKTAGQVNKELMVEAAIKAVKERGLSENAAAVEFGVCRM
                     TMRRRIENPNPEPHGITKTSFEDHKFFSRFLSRHKELSMRITHATNRKKDREWTTERC
                     EEYIQKLQKLKDGGFLERPEQVWNLDETAFNTARMYNRVVARRGVKQIPSQFDGNEKE
                     CVTILPCGNAAGVQLKLLALYAGKVHVQSRLDGTFDMIYHAVNSSGYMDQILFANYIK
                     KEVLPAITELLTVIFVDGHFSHVNNLLLVRYCQDFFKDTGKRVEIFCLPVGQTNHLQP
                     FDVSAFGGIKKKWHSYSRNALAGGMLNTGEQKGTPRMDISRKTDAFKANLCRKYFIGG
                     FAFLPFLWLVNVIWFFKDAFLKDTPTNMEVQRIRGYVIKSLVGCCIWTAALAAWIVVF
                     QTHRVEWDELGDRLSFIIPLGMS"
     CDS             complement(join(1239193..1239295,1239360..1239564,
                     1239631..1239906,1240007..1240225,1240291..1240422,
                     1240487..1240529,1240676..1240903))
                     /codon_start=1
                     /gene="RvY_00425-1"
                     /gene_synonym="RvY_00425.1"
                     /locus_tag="RvY_00425"
                     /note="ETS"
                     /product="hypothetical protein"
                     /protein_id="GAU87600.1"
                     /transl_table=1
                     /translation="MPETSRFLRCYRSNSGNTRYSSNASLLKSPLTDSFFSTPDKFSG
                     GKSPLPSFPDYSGVRQESEFSLKFSGISNISQNNPSEIPPAPPSYRDGSKAYSTGKRS
                     YDDDCIVSSVSSPKSDRSSPSQVPNFSSDDPDGSNGGEGGVKRFKEQNKDVSFDADVD
                     VVEFFVDDSSTNAHAALPAKMSLSNLVPLRRATSVVENNVQHSLKTSDFDDSDEDSTD
                     SDSSTDDSPSSDSDSDSDDDNEEVQVSSRKGLKKPNPRAHLPLTIYVPASACLANKDD
                     DKHRPKKYKNAIKKKKVLGEYRPEEENGGKKLINFVCDLLRNPIYEGKLLVKWENQEE
                     GIFRILQSVEVARLWGMKKANPKMTYEKFSRAMRYYYATNILVTFEKHGYPKKLVYKF
                     GPAFNWRNA"
     CDS             join(1241735..1242250,1242497..1243033,1243103..1243316,
                     1243651..1244042,1244235..1244435,1244747..1245025)
                     /codon_start=1
                     /gene="RvY_00426"
                     /gene_synonym="RvY_00426.2"
                     /locus_tag="RvY_00426-2"
                     /note="mucolipin 1; MCOLN1"
                     /product="hypothetical protein"
                     /protein_id="GAU87601.1"
                     /transl_table=1
                     /translation="MSWKEDDVPLIDLSFVSLERSQLLLPESTPRSLSPFTELPMEHI
                     EEHPEVPDHELKDVFEVDVRQRDSSGSLNQFTPRSRPRAQSSTSRHLHLTRGSSSDPA
                     IPQNDEGIMFSSGSGSGRPFLQPCCSAEVNRVRWRIRFFFMDPIQKWRHKHQFPWKLF
                     LQVIKIIFVTIQLVILGNERYTFATFLKQNTVSFRHLLLQNWNDPDIPVAVYPNTGLY
                     AVYTKQEFYEKVDFAVNQFVNMREVAIGSYHYAHSPNDTSLFRFCKREFMDAHIFPQN
                     HSFVYDSEINETCVSVNFFDVPNGTFSIQTYLSDRNASLIFDQLIDAKLLFTVRSVAL
                     QADDPEDEPGCYVFDVIVYFDNTGHNGQIPVNLDMDAHVVPCNGKLLFDDTDSVWDIL
                     VDVLDASILVVCIASLLLCLRALYNAEVLKGSVIVFFRQQLGVELTKDERMEFINLWY
                     VMIVVNDILTICGTVVKLRISSATITELSLYNACGMLLGIGNLLVWFGVLRYLGFFKT
                     YNILILTVKRALPNVMRYLTCTLFIFCGFSFCGWIILGPYHVKFQTFHSTTETIFSLI
                     NGDDMFATFAILPFSNTMIWYFSRLYLYVFICMFTYVVLSLMISLIMDAYGTVKDYYE
                     QGGPSSRLADFLTEPMTVPSETCPRHANLQRTTSLTSFGAPFVKQESRGIFKWLRKFV
                     FRDEDEPPRNVGGDLHNSSWIPHQPLHNES"
     CDS             join(1241735..1242250,1242497..1243033,1243103..1243320,
                     1243655..1244042,1244235..1244435,1244747..1245025)
                     /codon_start=1
                     /gene="RvY_00426"
                     /gene_synonym="RvY_00426.1"
                     /locus_tag="RvY_00426-1"
                     /note="mucolipin 1; MCOLN1"
                     /product="hypothetical protein"
                     /protein_id="GAU87602.1"
                     /transl_table=1
                     /translation="MSWKEDDVPLIDLSFVSLERSQLLLPESTPRSLSPFTELPMEHI
                     EEHPEVPDHELKDVFEVDVRQRDSSGSLNQFTPRSRPRAQSSTSRHLHLTRGSSSDPA
                     IPQNDEGIMFSSGSGSGRPFLQPCCSAEVNRVRWRIRFFFMDPIQKWRHKHQFPWKLF
                     LQVIKIIFVTIQLVILGNERYTFATFLKQNTVSFRHLLLQNWNDPDIPVAVYPNTGLY
                     AVYTKQEFYEKVDFAVNQFVNMREVAIGSYHYAHSPNDTSLFRFCKREFMDAHIFPQN
                     HSFVYDSEINETCVSVNFFDVPNGTFSIQTYLSDRNASLIFDQLIDAKLLFTVRSVAL
                     QADDPEDEPGCYVFDVIVYFDNTGHNGQIPVNLDMDAHVVPCNGKLLFDDTDSVWDIL
                     VDVLDASILVVCIASLLLCLRALYNAEVLKGSVIVFFRQQLGVELTKDERMEFINLWY
                     VMIVVNDILTICGTVVKLRISSATITELSLYNACGMLLGIGNLLVWFGVLRYLGFFKT
                     YNILILTVKRALPNVMRYLTCTLFIFCGFSFCGWIILGPYHVKFQTFHSTTETIFSLI
                     NGDDMFATFAILPFSNTMIWYFSRLYLYVFICMFTYVVLSLMISLIMDAYGTVKDYYE
                     QGGPSSRLADFLTEPMTVPSETCPRHANLQRTTSLTSFGAPFVKQESRGIFKWLRKFV
                     FRDEDEPPRNVGGDLHNSSWIPHQPLHNES"
     CDS             join(1249070..1249328,1249388..1249666,1250194..1250385,
                     1250516..1250589)
                     /codon_start=1
                     /gene="RvY_00427-1"
                     /gene_synonym="RvY_00427.1"
                     /locus_tag="RvY_00427"
                     /product="hypothetical protein"
                     /protein_id="GAU87603.1"
                     /transl_table=1
                     /translation="MAVHSAEPIVTTFSLATNSSCNMHIAHGGDVLVRDKFITDLNNG
                     KWDNESLDPYCSEFVSLVKGASRPVADLGVGNGFTTKKLLEAGVRVIANDLKPERLDE
                     ISRSLSAEERGRLTLAPGDALQLVIPSASLGGILATRWINVLRPYECRLLMNDFYRWL
                     APGGILCITAHTPYSNTTKEAVDLYLRRKYIGDEWPGVVTEDMLQESRRGKLWSNDWI
                     YGYDPDILAREAILAGFRVKKCSFYGTRYVSTDEFADDACNLVGIIARK"
     CDS             1250670..1251155
                     /codon_start=1
                     /gene="RvY_00428-1"
                     /gene_synonym="RvY_00428.1"
                     /locus_tag="RvY_00428"
                     /product="hypothetical protein"
                     /protein_id="GAU87604.1"
                     /transl_table=1
                     /translation="MSLHKYRHYESFPLLLYLQYQCRWKGGQFMYSVRRTYFSCSFDF
                     GESPHLKLMSFPLLLFYCFIIYYFYTFENTQVWLLVLFSPVKHVKSDYFSSLKASVKE
                     AKTGTWQPNLTDSFPKWRTIPASHTETKRHLEIDLAQFAQAAQGWDVISWNCAPLKET
                     R"
     CDS             complement(join(1251675..1251820,1251887..1251991,
                     1252068..1252163,1252492..1252581,1252659..1252763,
                     1252832..1252951,1253051..1253149,1253425..1253463,
                     1253541..1254111,1254291..1254430,1254487..1254636,
                     1254696..1254810))
                     /codon_start=1
                     /gene="RvY_00429-1"
                     /gene_synonym="RvY_00429.1"
                     /locus_tag="RvY_00429"
                     /product="hypothetical protein"
                     /protein_id="GAU87605.1"
                     /transl_table=1
                     /translation="MENPLQSERDLLLADPSSSNVASVSAIGAEADSLDISTRCEKCL
                     EDLDGPCYEHADVKRIIFDKPPNPLAYSSLPDAICLLDGQLPRKEEMVIAKRKIEALT
                     LFGPLIAPLVPLYELKEGPPRYTIWSEEAQELQAYDMRDNFLCNWIKFIRPCSSRKEA
                     NVIAYQQRGSVYLVAVRDIFPSEELRVYNKLPNSGAIQSHQLSALVLSLLASCKRPGS
                     ELPQVNNIDNIVLEMAQKVASKRKRVFRTRRTKMEALPVNVESSLFGSIGNGGIECCR
                     DDGSSEITVVEESVNEERQPQTDECAKPLGRRRKQTKDWYWLDARYKAGNMTDEEKKH
                     FESDERTLEQRKVEEANRLKHSFEKRVRRKNKLAQMTEEEREAYDARKREANATYYAR
                     NAPNNNKLLKLVREKYIQGLPLTAEELAQYEAYLKRNREKNALMRRKTLIAAGRDPEK
                     VSKRGPGKGPMFAWQLARRETTNVVDEADVEAARCIAVEERNKNGTSIPSYRLKLRQE
                     LPLTSEELAAYQKELARKRERDRRYYRKTKIAQGLQPKEVISRRKTPLEGPGKSKKNS
                     EDHWANSSGRLLDSAKVSASDVLSE"
     CDS             complement(join(1256002..1256046,1256112..1256191,
                     1256291..1256639))
                     /codon_start=1
                     /gene="RvY_00430"
                     /gene_synonym="RvY_00430.1"
                     /locus_tag="RvY_00430-1"
                     /product="hypothetical protein"
                     /protein_id="GAU87606.1"
                     /transl_table=1
                     /translation="MALSIRRSQKHQAASVDSEVVEKVPRKRLRIIRSRRTKKVEAPE
                     EQASVSGGSVSVATCSEGCVAGERHSEAGKPKARRRKKGQMVEWRLLNARYKSGGELI
                     LGYDEEEKHRFKNDGIVRHLIHPPFRCRLSASRSNSAISSLKGRLNREGRQRLED"
     CDS             complement(join(1256002..1256046,1256112..1256191,
                     1256345..1256639))
                     /codon_start=1
                     /gene="RvY_00430"
                     /gene_synonym="RvY_00430.2"
                     /locus_tag="RvY_00430-2"
                     /product="hypothetical protein"
                     /protein_id="GAU87607.1"
                     /transl_table=1
                     /translation="MALSIRRSQKHQAASVDSEVVEKVPRKRLRIIRSRRTKKVEAPE
                     EQASVSGGSVSVATCSEGCVAGERHSEAGKPKARRRKKGQMVEWRLLNARYKSGGIVR
                     HLIHPPFRCRLSASRSNSAISSLKGRLNREGRQRLED"
     CDS             complement(1256283..1256639)
                     /codon_start=1
                     /gene="RvY_00430"
                     /gene_synonym="RvY_00430.3"
                     /locus_tag="RvY_00430-3"
                     /product="hypothetical protein"
                     /protein_id="GAU87608.1"
                     /transl_table=1
                     /translation="MALSIRRSQKHQAASVDSEVVEKVPRKRLRIIRSRRTKKVEAPE
                     EQASVSGGSVSVATCSEGCVAGERHSEAGKPKARRRKKGQMVEWRLLNARYKSGGELI
                     LGYDEEEKHRFKNDGW"
     CDS             complement(join(1256859..1257068,1257356..1257492,
                     1257556..1257705,1257764..1257878))
                     /codon_start=1
                     /gene="RvY_00431"
                     /gene_synonym="RvY_00431.2"
                     /locus_tag="RvY_00431-2"
                     /product="hypothetical protein"
                     /protein_id="GAU87609.1"
                     /transl_table=1
                     /translation="MEDGAQSERGLLLADPSGANDATFSVVRIEADALVIATYCEKCQ
                     EDLDGPCYEHADARRIIFDKAPIPLAYSSLPDDLCLLNVQPLGKAMVLAKRKIEASTL
                     FGPLIAPLVPLDELEEGPPRYTMWSEEAQELQAYDLSDDFLCNWIKLVRPSSNIKEAM
                     WVRISSVVSSTWSLSETLFPQKNCWYMSDCPGVVPSPATSCQL"
     CDS             complement(join(1256859..1257068,1257356..1257492,
                     1257556..1257871))
                     /codon_start=1
                     /gene="RvY_00431"
                     /gene_synonym="RvY_00431.1"
                     /locus_tag="RvY_00431-1"
                     /product="hypothetical protein"
                     /protein_id="GAU87610.1"
                     /transl_table=1
                     /translation="MGRRASGVCCWQIRPVRMMPLSASLGLRLMLWSSLHVSTTAVLW
                     FNSGMKVLMFKDCEKCQEDLDGPCYEHADARRIIFDKAPIPLAYSSLPDDLCLLNVQP
                     LGKAMVLAKRKIEASTLFGPLIAPLVPLDELEEGPPRYTMWSEEAQELQAYDLSDDFL
                     CNWIKLVRPSSNIKEAMWVRISSVVSSTWSLSETLFPQKNCWYMSDCPGVVPSPATSC
                     QL"
     CDS             complement(join(1256859..1257068,1257356..1257529))
                     /codon_start=1
                     /gene="RvY_00431"
                     /gene_synonym="RvY_00431.3"
                     /locus_tag="RvY_00431-3"
                     /product="hypothetical protein"
                     /protein_id="GAU87611.1"
                     /transl_table=1
                     /translation="MSSCVERWFSTPAMVLAKRKIEASTLFGPLIAPLVPLDELEEGP
                     PRYTMWSEEAQELQAYDLSDDFLCNWIKLVRPSSNIKEAMWVRISSVVSSTWSLSETL
                     FPQKNCWYMSDCPGVVPSPATSCQL"
     CDS             complement(1257533..1257871)
                     /codon_start=1
                     /gene="RvY_00431"
                     /gene_synonym="RvY_00431.4"
                     /locus_tag="RvY_00431-4"
                     /product="hypothetical protein"
                     /protein_id="GAU87612.1"
                     /transl_table=1
                     /translation="MGRRASGVCCWQIRPVRMMPLSASLGLRLMLWSSLHVSTTAVLW
                     FNSGMKVLMFKDCEKCQEDLDGPCYEHADARRIIFDKAPIPLAYSSLPDDLCLLNVQP
                     LGKGTVSSLV"
     CDS             complement(join(1258637..1258716,1258788..1258892,
                     1258962..1259048,1259497..1259586,1259662..1259766,
                     1259836..1259931,1260001..1260784,1261021..1261160,
                     1261218..1261367,1261426..1261534))
                     /codon_start=1
                     /gene="RvY_00432-1"
                     /gene_synonym="RvY_00432.1"
                     /locus_tag="RvY_00432"
                     /product="hypothetical protein"
                     /protein_id="GAU87613.1"
                     /transl_table=1
                     /translation="MGRTTEGPDEPGTSFAISSITPLNAVAPPDISVISTCCEECLED
                     LDGPCYEHADVKRIIFDKPPVPLAYSSLPEALRIIGVHPSKNEEMVFAKQEIQVWTLF
                     GPLIAPLVPLDGLKEGPPRYTMWSEETRVLQAYDLSDDFLCNWIKFVRPAISKTKANV
                     IAYQQRGSVYLVAVRDILPSTELRVYIKLPKSGAIPSDQLSALVQSLLSSYNRREVQN
                     DEQAEVDEVEMELPPRQRRTARKRKHLNEADKVEGENDIQEIFEAKVSKAEKGMGYGQ
                     ESEECPAEMVEKVPPKRKRLFHSQRSKEVESSKDQGLLESVSWVGESSSTLSSSSDRP
                     GEGTALEENVNVIDGSFPEGETSKPIKRRRNEKKVLRQVEGKADRSKYWLRRKEKLAQ
                     MTEEEREVWRAKKRIENQRNSKRPNVIREKLLEGLSLTPEEQLKREKKLAFSREKAAE
                     RRTKDRIAKGKPAEPNKNYGRKKFPLFDWQIAARRAAGIVEEPQPEEPSPQKSTGPLG
                     YAPPFRRKLRLGLPLTPEEQLRYEKHLVFGRESSRRRSRLKRIAKGLDPEPMKCHKPG
                     GVPYRKPDFAWQMTE"
     CDS             complement(1262414..1262842)
                     /codon_start=1
                     /gene="RvY_00433-1"
                     /gene_synonym="RvY_00433.1"
                     /locus_tag="RvY_00433"
                     /product="hypothetical protein"
                     /protein_id="GAU87614.1"
                     /transl_table=1
                     /translation="MTFTPIASETILKIWKEENFGSVDCCGSSNVIFGLAQFFLKCRL
                     YFYSKRCTQVEKLSKTHKKVVRKPEDRIHLRSRTMNQVCFLHFVTCFSIYSLVKRDVV
                     RSHGRVELLLPLLQSVFRPLFDVFVIIALCIFYTMVNPHW"
     CDS             complement(join(1263001..1263236,1263543..1263692,
                     1263764..1263875))
                     /codon_start=1
                     /gene="RvY_00434-1"
                     /gene_synonym="RvY_00434.1"
                     /locus_tag="RvY_00434"
                     /product="hypothetical protein"
                     /protein_id="GAU87615.1"
                     /transl_table=1
                     /translation="MAYCIRLPAGYEIFLLSGIPCYLRPLYATISLCLCLPSFSKKPR
                     LVPSSPLSLLSSVWPLLSPFVLLLTLPWSLPFVLLRSVGVSVADLMESAAKKVRDVSF
                     VFTTSLIIFSRSSRGLVIRETRCPEVTILVTISYRVSAVPQPSDLELDPFRNINESIF
                     LVTHA"
     CDS             complement(join(1264006..1264104,1264258..1264623))
                     /codon_start=1
                     /gene="RvY_00435-1"
                     /gene_synonym="RvY_00435.1"
                     /locus_tag="RvY_00435"
                     /product="hypothetical protein"
                     /protein_id="GAU87616.1"
                     /transl_table=1
                     /translation="MFLGLDKLDHEILIPPLTPEEQVSREELLARNRARWTRRTEQCK
                     AANIKRVTNISKIRRKAKEGSKLLKAARFLCDRWDCVYFLLFHGTVPLTPKEQLTLEN
                     QLQEVEQLAGEEIYWKESPKLTGEEKNAADHQSRSSSEELDGNAAENETEEE"
     CDS             complement(join(1265795..1266340,1266516..1266628,
                     1266685..1267063))
                     /codon_start=1
                     /gene="RvY_00436-1"
                     /gene_synonym="RvY_00436.1"
                     /locus_tag="RvY_00436"
                     /product="hypothetical protein"
                     /protein_id="GAU87617.1"
                     /transl_table=1
                     /translation="MSASASVQMVHPVGTFIVSNRKADPTVPTSGNKEAVLKPVMANQ
                     IPVNISLCEYYQITGLPGSMNRNIVAFLADCEQCEEMLEGACFEHTDVERIIYDKPPI
                     PLAYSSVPDSSQRYEFTKVLEEDKGDTINREGTHQSMDIIWTLNRTLTSYGRNTCGNS
                     SLCLAYDLSDDFLCNWIRFVRPSSNFREVNVIAYQQHGSIYLFSVRDIAPSTELRVFV
                     NRPQGCAEVYDELFGPPVQYVRYIDPEHCARSHRKESKLRKLNQKTEKEPETSDEISR
                     TEVPASEEPTDILQYEPTESEGAASLPDVPEFTSRISLRKECGSVVSSKRVRRTKKEL
                     TEWRNLRERYY"
     CDS             join(1267087..1267234,1267255..1267539,1267608..1267712,
                     1268036..1268139)
                     /codon_start=1
                     /gene="RvY_00437-1"
                     /gene_synonym="RvY_00437.1"
                     /locus_tag="RvY_00437"
                     /product="hypothetical protein"
                     /protein_id="GAU87618.1"
                     /transl_table=1
                     /translation="MLLVTHHVTHAIKSIIVPSSAVSLLWNMFKKEEGKTRYPDRRRT
                     SVWALVLSDGEECKKGAGTRVEYKVPSRTLPEWAKRSTRVLRQEKPKRADGKVECKKV
                     PRKRVRRDDSNKGTTDTISAKAPLPRPLKDMEEEIGRKLITGIPRTPEEQLRREQDLV
                     HRRANNEKYRRKDRIAKGRDTEPAKIDNPGSFKKAPLFSWQLAEQDSSSASSK"
     assembly_gap    1268531..1268580
                     /estimated_length=50
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     CDS             complement(1269578..1270027)
                     /codon_start=1
                     /gene="RvY_00438-1"
                     /gene_synonym="RvY_00438.1"
                     /locus_tag="RvY_00438"
                     /product="hypothetical protein"
                     /protein_id="GAU87619.1"
                     /transl_table=1
                     /translation="MSKVTPDFIFSKDFMSSNNGTFCPSTKPDCNSAAHSGTPTYLSP
                     FGVSIHPGLKSHTIRLLGIPTPGGPAPPGLYQTSNCGRKTESDIYRCNLNPIGHNAMG
                     RTALQVHEPSTNWLRRVTNMDSLGCIVTPDASRVQNGDIVGVGYRGW"
     CDS             complement(join(1271305..1271473,1271693..1271873,
                     1272138..1272312,1272386..1272655,1272720..1272764,
                     1272825..1272881,1272951..1273103,1273183..1273188))
                     /codon_start=1
                     /gene="RvY_00439-1"
                     /gene_synonym="RvY_00439.1"
                     /locus_tag="RvY_00439"
                     /note="histone H2A; H2A"
                     /product="hypothetical protein"
                     /protein_id="GAU87620.1"
                     /transl_table=1
                     /translation="MMGRNMLQKTGVTFPVRRIQRYMRRHHLVNGKMRIATSGAIYLA
                     STIEYVVAEILELAGNAARDFKKKRISPKCIMSAIKWDDELRSLLKGWGMILPGSGNL
                     WGNNLGQINATISAVAFSKSGQPSATIPGSSVKAPKKVLVVTKSKRKYAKKTSAPLTT
                     QGGVETLSQRTLRTGVQLSVLKADITAVEADCYVHPTANSVSFGGEVGRRLSEVGGEA
                     LRQNLAQHANVAIPVNGAVLTGPATTGLKAAYLIHCNSPSWNDPDCVQRLEDTVKSCL
                     HRMRENNLKTLAIPNIGSGGNHFPKQTAAQTILRSISQYFQTRPADEPRDEKIIFVLY
                     DQQSVQVFQTELTNLVE"
     CDS             complement(join(1273774..1274081,1274225..1274660))
                     /codon_start=1
                     /gene="RvY_00440-1"
                     /gene_synonym="RvY_00440.1"
                     /locus_tag="RvY_00440"
                     /product="hypothetical protein"
                     /protein_id="GAU87621.1"
                     /transl_table=1
                     /translation="MSIVDAIVSPLVKTANFIRNGFHGQPATVQRRAKDSHVLTELEA
                     QWMDPHKRKILETIEDFLDICKDNSYETSSPLVIETLHKICLLCYSANDFELIHKAQD
                     IFPILIGILQNVNTPYALRLQIVSAVSILCHGNQVNCRTWCSKGGIKALLDYLRDIPV
                     DKVNDGLHKEILQLNVCTVYTLRTLMCSSREAIKAIVGSSDFSKVADLHIMMYEMKDV
                     WARTAQQQNYALDCCVVLGIGGKRPAPAS"
     CDS             complement(join(1275186..1275206,1275296..1275426,
                     1275657..1275781,1275892..1276124,1276347..1276439))
                     /codon_start=1
                     /gene="RvY_00441-1"
                     /gene_synonym="RvY_00441.1"
                     /locus_tag="RvY_00441"
                     /note="COG0431"
                     /product="hypothetical protein"
                     /protein_id="GAU87622.1"
                     /transl_table=1
                     /translation="MAAKSGLNIMVFLGSVRENRMATRVGKFIQKLLEKRSHTVEIVD
                     PKALDLGEVIQPLHFYKDPAEAPAILHELNDKIKKADGFVVVAAEYNSAISPALCSIM
                     DNFPPLSYAYRPSAIVTYSMGQFGGIRAAMQLRQFLSELTTVHMPSMTVIPKVHEAIT
                     EDGEVTAEGPLTKASEAMCKQFEWYARALKNERNSSGIPK"
     CDS             complement(join(1277076..1277245,1277322..1277507,
                     1277605..1277739,1277835..1278278,1278661..1278787))
                     /codon_start=1
                     /gene="RvY_00442-1"
                     /gene_synonym="RvY_00442.1"
                     /locus_tag="RvY_00442"
                     /note="COG0431"
                     /product="hypothetical protein"
                     /protein_id="GAU87623.1"
                     /transl_table=1
                     /translation="MSSYGSDYGSRQSREGSSEPAFRELDDDDDDDDLHFVTNIPIRD
                     SPDNDLSIRKVVGAANYVDLTPTVSRPSSSASGRLTGASRPYPVRSWSRTSHYNVHDP
                     DFGPISPTFTSPVYPTATSPSVASRSVASPTFTRYSTPTASRMSGKPIGGPLNIILVL
                     GSVREGRMCTRVAKYVQTALQSRNHHVTLLDPKEHNLGQLIQPVHFYKNPADVPKDLL
                     VINKQITEADSFVVVAAEYNSGISPALCSLMDHFPPLSWSHRPSAIVTYSMGQFGGIR
                     AAMQLRQYLSDLMTVHVPSMIVIPKVHETLNEQGVPAQAEGPLKTATDTTIMQLEWYA
                     DGMKKQRAAVGPPKSLQPG"
     CDS             complement(join(1279407..1279885,1279994..1280102,
                     1280168..1280868,1280931..1281380,1281449..1281509))
                     /codon_start=1
                     /gene="RvY_00443-1"
                     /gene_synonym="RvY_00443.1"
                     /locus_tag="RvY_00443"
                     /product="hypothetical protein"
                     /protein_id="GAU87624.1"
                     /transl_table=1
                     /translation="MGPERNRPILSTRKRVFSFTVICILISSVSSRRIGGSRWVGSGS
                     SGLSSSSRFGSSAPSGLGYSSGSRFSPSSSSGFGGGTRYGSSLGSGAAVGAGAVGAGA
                     LGGAALTRYGSNTYGSSGLGTRYGSGSSTGGIFGSSSGATRYGSSAPSGGGLDSLRNR
                     YTGVGGASRSGFGSRPAINTPSASSSVPSKVVYSPTYNTYNSYGRGGYYGRGGFGGGG
                     FGTGSLIATGLAAGVGGYYLGHALGSLYSPFGYGYGYGYPGYGGGYVPYRDRYSQYYP
                     GGTNTTVIVNNNIVGGTATNTSSGTAPVAPGQVAPATAAVAALPQKNVDACMIARWNR
                     ELPFAELPNMALEFLANDNISKTTIQEKANFMTELLTASVDAYANYNSSADIFTIPTG
                     FDVNTCNIKVSKAQLAVNTVVQEEPIMTSLRHVLSLYSNKSSDTDDLRDVVQAAKACL
                     PQGPNVANPEVLPCIDFSVQPDQILKLDPPHSMFGSSDICRAKFSPDLSKCVPKTAGT
                     MCKIEHLATLSLFARNFYLCTDALDGQTVNSLQQATPNPSPNVIVPSTNTVSSGGASP
                     PAVRDANSYLNKGLITTTERPSGFWSKLFDFLG"
     CDS             complement(join(1284119..1284244,1284431..1284508))
                     /codon_start=1
                     /gene="RvY_00444-1"
                     /gene_synonym="RvY_00444.1"
                     /locus_tag="RvY_00444"
                     /product="hypothetical protein"
                     /protein_id="GAU87625.1"
                     /transl_table=1
                     /translation="MKRTTTATEETRTQQEEIEMYRPSETGTNGQTRAAAQIDPGQTA
                     ILHAGGTTVSVTSAGGNAQLTAE"
     CDS             complement(join(1284564..1284733,1284984..1285035))
                     /codon_start=1
                     /gene="RvY_00445-1"
                     /gene_synonym="RvY_00445.1"
                     /locus_tag="RvY_00445"
                     /product="hypothetical protein"
                     /protein_id="GAU87626.1"
                     /transl_table=1
                     /translation="MDNEPEAVAGTPSSPTSTSSDGSNDSNSEKLTGYMPTRLMCETL
                     DRINCPGGGSYDKREIQPVNNVQQALELV"
     CDS             complement(join(1286832..1287145,1287170..1287332))
                     /codon_start=1
                     /gene="RvY_00446-1"
                     /gene_synonym="RvY_00446.1"
                     /locus_tag="RvY_00446"
                     /product="hypothetical protein"
                     /protein_id="GAU87627.1"
                     /transl_table=1
                     /translation="MGLCVGAKSLPENQLAVFGEKELTISHQDSAVNSSQEMYQISRN
                     MSKRGAGSVIGVALGAAVGTVLAGPVVGTALGAAVGSAATASGLATVLGAATAAGGAF
                     GGLVGSGTGALVGDAVEQNLNPNDDDGIHGKVIGGVGDIFDPAGRLGEAVQGVFGG"
     CDS             complement(join(1288071..1288271,1289452..1289960,
                     1290046..1290352))
                     /codon_start=1
                     /gene="RvY_00447-1"
                     /gene_synonym="RvY_00447.1"
                     /locus_tag="RvY_00447"
                     /product="hypothetical protein"
                     /protein_id="GAU87628.1"
                     /transl_table=1
                     /translation="MAFFKLLTASQVSKQLSMDDAVRAVKEGGITMYAAAKQHGICRE
                     TLRYRILGRHSKSSGGQLKFPPWQERSLANFLISCSDEAIPLNRNHCIGLFSHVAMEL
                     GLTNTKFDDKYFRRFLKIHAELSIRVTHASNRKKAREWTMERCEEYIAKLQKLHDEGY
                     FERTEQFWNLDEKAFDTAEMYDRVIARKGARQIPSLYDGTEKECVTILPCGNAAGIQL
                     KFMALYAGKVHVRSRLDDTEGVCYHAVNSSGYMDEIHFANYMKQVVFPALTEDKHTLA
                     KSYVGKTSEKVGAAAKDAEERKIQKYQGIASQYLFVPLGFETFGSWGPAATELINAIG
                     KKAC"
     CDS             complement(1293725..1293934)
                     /codon_start=1
                     /gene="RvY_00448-1"
                     /gene_synonym="RvY_00448.1"
                     /locus_tag="RvY_00448"
                     /product="hypothetical protein"
                     /protein_id="GAU87629.1"
                     /transl_table=1
                     /translation="MIHFEEMSRSMRSKDRRRISSGNPSGSPLVLGYKLDLEASELTR
                     VTQNQHCRTHQGIIIILGNYAKCWT"
     CDS             join(1294201..1294335,1296061..1296223,1296304..1296452,
                     1296555..1296745,1296820..1297315)
                     /codon_start=1
                     /gene="RvY_00449"
                     /gene_synonym="RvY_00449.1"
                     /locus_tag="RvY_00449-1"
                     /product="hypothetical protein"
                     /protein_id="GAU87630.1"
                     /transl_table=1
                     /translation="MWTGAEFYPLISAIFLADKVACSMAQPSGSQLNVLDILSERGLT
                     EFHRLLNGSFALRGLLSNPAPALTLFVPTNEAIDRWRRTNSNTASITSDVLQNHIVPG
                     SWSEDQLRQLALRPNKAQRKLSSGFFNSPLWISSEDSSKKDLRTNLPVLCINGAQLLS
                     SRNTQFDPRVSAPRSFPFIHLLDDILAPTGSEVSAAAFLQDSSLHIYPQLQLQEVGRR
                     IQELSNQVPEFQDSSTVYTFFLPINQAFSLLRNPASFNINVLQSHVIPNQLIFFQSYS
                     NSSRDHNTDRSFPVNSNAQLGFFDNGTTKQVFSNVVQKDSTRFRPGKVYRNIIKSNIP
                     GKQNGNATTSLPIRKDQRIFCSFKWSDSRHRRTIAHRREHRQK"
     CDS             join(1297194..1297650,1297721..1298043,1298120..1298470)
                     /codon_start=1
                     /gene="RvY_00449"
                     /gene_synonym="RvY_00449.2"
                     /locus_tag="RvY_00449-2"
                     /product="hypothetical protein"
                     /protein_id="GAU87631.1"
                     /transl_table=1
                     /translation="MEMLPRHFRFEKTSEFFAVSNGVIHVIDGLLLIEESTVKSKVET
                     QPEFSGFRELIGRMDNSDGSDNVFMEALNPEKDGGKSVTLFLPSNEAVSRLPQEQKWR
                     LRNDRAFLTRILDLHLISNSQHPLLTVDMVNGSSTATAQGRRLSFHKTNKDGNVGLPS
                     VRVDGVESRIVQGDIACSNGVIHVVDSVLGLPFLTVLQILQAEPNLSRTFRAIEHSKD
                     LKAALSTSGNNVTIFAPSDQAWLNLNQGDLARMTSHSHLMTKVIRRHVVHGRRLDGQA
                     LRREERFTTIPGDIQIKQAYAENDRSKADPPRIVLSWKGHSASIITYDIPAVNGLIHV
                     LDQVLFDQDFDITQASLSRSNTLTSSVFIAGQLFSLGLFLIS"
     CDS             complement(join(1299862..1300029,1300371..1300523))
                     /codon_start=1
                     /gene="RvY_00450"
                     /gene_synonym="RvY_00450.1"
                     /locus_tag="RvY_00450-1"
                     /product="hypothetical protein"
                     /protein_id="GAU87632.1"
                     /transl_table=1
                     /translation="MTANIVDLVSRYYYRGKPSDYVVMAMTHGKLDQVRNTDDSFGPP
                     RRLKHADGGKSFGHARPGDILHYIIAERDRRQRPAGFCEEASSQLRMENSFPSVRQQL
                     KDPE"
     CDS             complement(1299862..1300080)
                     /codon_start=1
                     /gene="RvY_00450"
                     /gene_synonym="RvY_00450.2"
                     /locus_tag="RvY_00450-2"
                     /product="hypothetical protein"
                     /protein_id="GAU87633.1"
                     /transl_table=1
                     /translation="MLQTALKRPNYLFFYSKGGKSFGHARPGDILHYIIAERDRRQRP
                     AGFCEEASSQLRMENSFPSVRQQLKDPE"
     CDS             <1302315..1302491
                     /codon_start=1
                     /gene="RvY_00451-1"
                     /gene_synonym="RvY_00451.1"
                     /locus_tag="RvY_00451"
                     /product="hypothetical protein"
                     /protein_id="GAU87634.1"
                     /transl_table=1
                     /translation="KGQFRAKMLWTHSFMEVPIYRNLLLEKSERSRFASHFHDISPDI
                     ASKRQRSSSVNGGN"
     CDS             complement(1302822..1303154)
                     /codon_start=1
                     /gene="RvY_00452-1"
                     /gene_synonym="RvY_00452.1"
                     /locus_tag="RvY_00452"
                     /product="hypothetical protein"
                     /protein_id="GAU87635.1"
                     /transl_table=1
                     /translation="MIGVIKRSKLRPQIMYHSQDRDGLSIERKHNCNQPETDLPRFSK
                     TIRAIRINLLHLSTHMFVHSALHFQPHAKYCILSRNSRPSLHSECKTRTKTDLRISDV
                     REFRESIQ"
     CDS             complement(join(1305133..1305347,1305418..1305501,
                     1305595..1305831,1305938..1306073))
                     /codon_start=1
                     /gene="RvY_00453-1"
                     /gene_synonym="RvY_00453.1"
                     /locus_tag="RvY_00453"
                     /note="COG0431"
                     /product="hypothetical protein"
                     /protein_id="GAU87636.1"
                     /transl_table=1
                     /translation="MAPLVAAGLNIILFLGSVRQPRNADRVLKLVQDRLEERSINVTV
                     FDALKLEFDKVIKPIQYYNKSEIVPENILALNQQIKDADAFVVLTAEYHGSIAPGLLN
                     LMNQFPPNSYAFRPSAVVSYSKGRFGGVRAAMQLRSFLSDLGLIQVPSLVAIPKVEEV
                     VTPDGTTKDESLLSGLDAALDQLIWFAEAIKLQRKNYGLRCVDCFDDTNLGYKGLPYK
                     NKKWS"
     CDS             complement(join(1306407..1306448,1306522..1306649,
                     1306719..1306904,1306980..1307123,1307220..1307355))
                     /codon_start=1
                     /gene="RvY_00454"
                     /gene_synonym="RvY_00454.1"
                     /locus_tag="RvY_00454-1"
                     /note="COG0431"
                     /product="hypothetical protein"
                     /protein_id="GAU87637.1"
                     /transl_table=1
                     /translation="MVFLTPAGLHFILFLGSVRENRNAERVKKYLTNFIAKHNVSVEI
                     FDPVEMAVYNYTKVVTPLHYYPKQEDAPQHLLDNNARIKKADGFIIVTPEYHSAVAPA
                     LSTLMDQFPGLSYAYRPAAIVSYSKGRFGGIRASTQLRTFLSELGMIHIPSVLAIAKV
                     ENTITPDGQTKDDTVLASTAAVVEELIWFATTVKEYSKVKELLYKGKKWIL"
     CDS             complement(join(1306513..1306649,1306719..1306904,
                     1306980..1307123,1307220..1307355))
                     /codon_start=1
                     /gene="RvY_00454"
                     /gene_synonym="RvY_00454.2"
                     /locus_tag="RvY_00454-2"
                     /note="COG0431"
                     /product="hypothetical protein"
                     /protein_id="GAU87638.1"
                     /transl_table=1
                     /translation="MVFLTPAGLHFILFLGSVRENRNAERVKKYLTNFIAKHNVSVEI
                     FDPVEMAVYNYTKVVTPLHYYPKQEDAPQHLLDNNARIKKADGFIIVTPEYHSAVAPA
                     LSTLMDQFPGLSYAYRPAAIVSYSKGRFGGIRASTQLRTFLSELGMIHIPSVLAIAKV
                     ENTITPDGQTKDDTVLASTAAVVEELIWFATTVKEYSKVM"
     CDS             1307357..1307563
                     /codon_start=1
                     /gene="RvY_00455-1"
                     /gene_synonym="RvY_00455.1"
                     /locus_tag="RvY_00455"
                     /product="hypothetical protein"
                     /protein_id="GAU87639.1"
                     /transl_table=1
                     /translation="MATSGTQKIKKKIKDAKLVLRSYRKTSTHCSSDVVLDKSESVYR
                     KSDKQPNFASRPSPVVILIYSIGV"
     CDS             complement(join(1307825..1307834,1307889..1308171,
                     1308234..1308384,1308454..1308533,1308623..1308760,
                     1308841..1308923,1308989..1309037,1309326..1309500,
                     1309603..1309667,1309769..1309902,1310044..1310144))
                     /codon_start=1
                     /gene="RvY_00456-1"
                     /gene_synonym="RvY_00456.1"
                     /locus_tag="RvY_00456"
                     /note="LIC"
                     /product="hypothetical protein"
                     /protein_id="GAU87640.1"
                     /transl_table=1
                     /translation="MRCLLASVLFGTVFAIGHQDPQRNLTARDPSHNKHGKTSVQGLG
                     DHAMLSHLLAKYDKWTRPGAYVHDSTALSGKLEDGAPTVVNVSIYIRDFTLDDAKMEL
                     HTTLTMRLTWTDERLVHPANPRHPYLFVQENHPKLWIPDIFFNNEKNAHFHHVLTPNV
                     LYRVYPSGTVYMSTKISLTSTCPMTFTWFPLDHQTCRINLGSYGYTADQVDLQWNGTM
                     PITVAHFQNTQGRFELKNTSFTREVLSTHNENFTMLTVNIAFARMVPPYIVHYYVPTA
                     MLVALSWLAFWMHPDMLTPRVLLGLAALLTIYQLQTEGKSEALRVSYGNAYGFWGQLC
                     ALFAAFSLIVSVIANYWNRRDVMCYKTVNNMDTMIYTPMATPLLAGSSYSVKKEVITR
                     GDRLDAICRVMFPLLYLCSIIAYWAVCFMT"
     CDS             join(1312401..1312542,1312646..1312960,1313032..1313309)
                     /codon_start=1
                     /gene="RvY_00457-1"
                     /gene_synonym="RvY_00457.1"
                     /locus_tag="RvY_00457"
                     /product="hypothetical protein"
                     /protein_id="GAU87641.1"
                     /transl_table=1
                     /translation="MDLKCYDCNGTIGLESSLNCDTVSPNKTAISQISFYGCMTTIVD
                     DNVHGRQLIRAGSLSANATEGCVDKVTKQNFNRRTCTCLTSLCNIGLWDLAPPPAPVV
                     TGGSESDSGETPQKELFLCWKCDNLKDGDLCLDSVVCKPESCQTVYNKTLGKITRGYA
                     NTLAKSKTCVVKVIGGPQSVACNCPNRLCNNQTAQAMVALAGVVQSSTVPSTASPAEQ
                     GKRVLNSSSRWRQPLFVISPATSAHL"
     CDS             complement(1313646..1313780)
                     /codon_start=1
                     /gene="RvY_00458-1"
                     /gene_synonym="RvY_00458.1"
                     /locus_tag="RvY_00458"
                     /product="hypothetical protein"
                     /protein_id="GAU87642.1"
                     /transl_table=1
                     /translation="MTSALETIPLNESSFPGTAELQYLAFCNQQHAKMPTDSAAAVDW
                     "
     CDS             join(1315599..1315659,1315773..1315850,1316031..1316309,
                     1316544..1316975,1317189..1317802,1318001..1318115,
                     1318183..1318611,1318677..1318702)
                     /codon_start=1
                     /gene="RvY_00459"
                     /gene_synonym="RvY_00459.2"
                     /locus_tag="RvY_00459-2"
                     /product="hypothetical protein"
                     /protein_id="GAU87643.1"
                     /transl_table=1
                     /translation="MKPPRLLSLTLKPWILCTVVVAYLLVEPIVARRSSGGSVGGGRM
                     SSGSSGSSGRYGGGLGSSSATRYGSSSGAGFGSSSPLRSSSGFGGASATRYGSSSGAG
                     VGATRYGSSSGSKIGTGTALGAGAAGGALGTYGATRLGGGSFGSSGARAGLVGSGTRY
                     GSQSSTGGIFGSSGAAGATRYGSSAPSGRGSPTDSIRNRFSGSGVRQPVAGNARPNYG
                     FGSSNTLGNRPAVNTPRASASSPSKVVYSPTYNTYNSYGRGSSFGGLGSSGYGGLGSS
                     YGGRRGFGTGSMIATGLAAGVGGYYLGRAMGSLYRPYGFGYGYPGMGYGYGGYGYGGM
                     GYGGMGYGGGMCDTCSMGGYVPYRDRYRDYYPTDNQQVITNPANNNNNNVNTQGAVAS
                     VNQPAIAATEAPQKSVDLCMLARWNRELPFAELPNMALDFLATNLISGNTTSDKAKFM
                     YEFLTVSVEAYEKYNSSADIFTIPASFDINTCNIKVSKTQLVNAATAVQQEEPIMTSL
                     RHMLSLYSNKSTDADDLTDVVNAAKACLPQGPNITNPEVLPCIDFSLSPDQMLKLETP
                     HSMFGSAEICRRQLSPDMFKCVPKVVGNPCKMEHLATLNLFARNFYLCSEAIGENTVA
                     GLEAHSSGPAAGGVPSVAGRRVESTTSSVIAYVGTGWVGSTTAKPGFWSRIFG"
     CDS             join(1315599..1315659,1315773..1316309,1316544..1316975,
                     1317189..1317802,1318001..1318115,1318183..1318611,
                     1318677..1318702)
                     /codon_start=1
                     /gene="RvY_00459"
                     /gene_synonym="RvY_00459.1"
                     /locus_tag="RvY_00459-1"
                     /product="hypothetical protein"
                     /protein_id="GAU87644.1"
                     /transl_table=1
                     /translation="MKPPRLLSLTLKPWILCTVVVAYLLVEPIVARRSSGGSVGGGRM
                     SSGRSSFGGGFGGGRSSFGGGGRSSWGGGGGGGFGNRVSFASPARSSGGLFGGSSATR
                     YGSSGSSGSSGRYGGGLGSSSATRYGSSSGAGFGSSSPLRSSSGFGGASATRYGSSSG
                     AGVGATRYGSSSGSKIGTGTALGAGAAGGALGTYGATRLGGGSFGSSGARAGLVGSGT
                     RYGSQSSTGGIFGSSGAAGATRYGSSAPSGRGSPTDSIRNRFSGSGVRQPVAGNARPN
                     YGFGSSNTLGNRPAVNTPRASASSPSKVVYSPTYNTYNSYGRGSSFGGLGSSGYGGLG
                     SSYGGRRGFGTGSMIATGLAAGVGGYYLGRAMGSLYRPYGFGYGYPGMGYGYGGYGYG
                     GMGYGGMGYGGGMCDTCSMGGYVPYRDRYRDYYPTDNQQVITNPANNNNNNVNTQGAV
                     ASVNQPAIAATEAPQKSVDLCMLARWNRELPFAELPNMALDFLATNLISGNTTSDKAK
                     FMYEFLTVSVEAYEKYNSSADIFTIPASFDINTCNIKVSKTQLVNAATAVQQEEPIMT
                     SLRHMLSLYSNKSTDADDLTDVVNAAKACLPQGPNITNPEVLPCIDFSLSPDQMLKLE
                     TPHSMFGSAEICRRQLSPDMFKCVPKVVGNPCKMEHLATLNLFARNFYLCSEAIGENT
                     VAGLEAHSSGPAAGGVPSVAGRRVESTTSSVIAYVGTGWVGSTTAKPGFWSRIFG"
     CDS             complement(join(1318968..1319214,1319315..1319419,
                     1319526..1319953,1320216..1320539,1320606..1320962,
                     1321121..1321291,1321391..1321555,1321677..1321826,
                     1321924..1322498,1322599..1322641))
                     /codon_start=1
                     /gene="RvY_00460-1"
                     /gene_synonym="RvY_00460.1"
                     /locus_tag="RvY_00460"
                     /product="hypothetical protein"
                     /protein_id="GAU87645.1"
                     /transl_table=1
                     /translation="MIRLTLLAALAASIGFVVADENKNVTVVALSNVPVENATVVNRK
                     ARHWHNQVPRKYWEHTLASQQHYLQEDRQPSQLVSAALPRDLDAFVVSSPALPLQTVT
                     LQRKDLPALTIASPRSLNPINVQLTPVQTKTFSSSQAISTPTMTFQTEARELPQVSQP
                     GVTYQTNQYVQNQQPLVASRSFQPAISHVEIQSTPIQTYQEIKPVQVEQAREFVPINQ
                     KLTSGSAQYLTQQPMEQSRSFQSASIEVPLIQETKTVQQKEEGRSFVPAIQQFIASTL
                     SQSLPTIQQQPAEQGRSFSSSNIQLPFTPESKPIQTEQARSFVPGNLQLNPTLVQSFQ
                     TLQQKPMETGRLFEFNNGFYQSTPQQESKIDQAPAGQGRVFNIPTAPLPVQDSFTQTD
                     QFILTQPVKKEVTPRVLTANIATSASSFNNNNNNNNNFDVPAGRIDNTQTFGKAFDKS
                     NNNILSGVPTVLTRMDTVNAQPSLTNFQSRTSLDQTQTNLVQPSQRDNIMFVVDGDHF
                     RESSHQIPIASTKWANRPTTFQREKDVHLEPVSLTVPSSPTTFNVINQGAIRDTKPIS
                     HGIPQTPVIVAEQVTETHDRPDASTAVGGVVVEETVDEIQQVPDNSVISAPVSTPIVS
                     TPVRPAASWSNIQQPTWTVNARPAQSVNVIQSQVRPVATTAVRDPVALQGQQYVFDFM
                     APPANADSINALLEQAIPGVTYPALTEVPLTSFTCDKHKAEGYYADTETGCQAYHRCD
                     EKGQMTDYLCPNRTIFSQITLTCDWWYNVDCSVSDKFLTYGNSRIQAHSEDVPLFDSP
                     PVGYVPAWAPLYHDAYFATQQKQLQDMQVLQQLQSVAVPTTTKIHRKTAQPSWSKF"
     CDS             1323700..1324047
                     /codon_start=1
                     /gene="RvY_00461-1"
                     /gene_synonym="RvY_00461.1"
                     /locus_tag="RvY_00461"
                     /note="kgd"
                     /product="hypothetical protein"
                     /protein_id="GAU87646.1"
                     /transl_table=1
                     /translation="MSFIKCFCLAAIVACVLAQPVPPGPTAGTAPPPAPPTGNATGSP
                     PPLPPGEAPPQPPPANAPPPAGPPPPASPPGAQNAPLVPPVGNPAVATMETSRAPQQP
                     SAAPSTPPPPPGR"
     CDS             1325280..1325735
                     /codon_start=1
                     /gene="RvY_00462-1"
                     /gene_synonym="RvY_00462.1"
                     /locus_tag="RvY_00462"
                     /product="hypothetical protein"
                     /protein_id="GAU87647.1"
                     /transl_table=1
                     /translation="MSLVKCLCLALIVGCVLAQPPPPRPPPGGRPPPPPGNGTNPRPP
                     PPGQGPPPPPPGQGPPPPPPGQGPPPPPPGQGPPPPPPGQGPPPPPPGQGPPPPPPGN
                     GPRPLPPGQGPPPPQPNNRTAAESPPPTGSPLPVDGSPPPPTQDFFAPY"
     CDS             join(1327345..1327676,1327941..1328027,1328157..1328322)
                     /codon_start=1
                     /gene="RvY_00463-1"
                     /gene_synonym="RvY_00463.1"
                     /locus_tag="RvY_00463"
                     /note="barH-like homeobox; BARX"
                     /product="hypothetical protein"
                     /protein_id="GAU87648.1"
                     /transl_table=1
                     /translation="MPFQSFTIAEILKPNSSGDNGTELPSVGVKSHSHARDHFFPAYS
                     SSVLFWNKPILSSMSNTERNAIPKSSAVDRPSKSSSSKTAHVESSSSKRRRSRTVFSD
                     AQLVYLEERFTINKYLTTPDRTKVARSLGLTQLQIKTWYQNRRMRWKKAILRNDGHSA
                     GGLSSCLQKNKGRPRKAEVRTRIPDATPPGDSER"
     CDS             complement(join(1330684..1331209,1331685..1331910,
                     1331975..1332092))
                     /codon_start=1
                     /gene="RvY_00464-1"
                     /gene_synonym="RvY_00464.1"
                     /locus_tag="RvY_00464"
                     /product="hypothetical protein"
                     /protein_id="GAU87649.1"
                     /transl_table=1
                     /translation="MDSINPLNILKLLKMDYEQDFQPNDSPSDHDKLLKALIKDFLDI
                     HINQAGSPILAIEDDLQYELQIGMPTFAEFEKSVTENKLLTGHREADFEPTPNDRLGQ
                     PDSSATEPSSHELYYGICDCKITKFVTEKYLQEEPDRKKSADECVALVRSRIQAYGLD
                     CLWNADHSGFEYEMRPARTLDLVGAKHFLALTRSENSMTHSYTVMMCVSPGARKYLPL
                     LSITLQEDRGVFGPIVKRTMLRASNLHVTASTGKTTKELVVEWCEKVFFLQMDGHCMF
                     LADPGRRLPIKKL"
     CDS             join(1337793..1337871,1338575..1338823,1340753..1340952,
                     1341080..1341287,1341353..1341523,1341632..1342021,
                     1342344..1342549)
                     /codon_start=1
                     /gene="RvY_00465-1"
                     /gene_synonym="RvY_00465.1"
                     /locus_tag="RvY_00465"
                     /note="putative RNA-binding protein MEX3A; KH"
                     /product="hypothetical protein"
                     /protein_id="GAU87650.1"
                     /transl_table=1
                     /translation="MPSSSLVAPAYSGLDAAMASLSNGPLECDQRAALQLALQLSSFH
                     LQPTEGLPSMYMYNNALRYAGGPPSPNTITAAAAAAALSLKRTQNTTECVAVPTSEHV
                     AEIVGKQGCKIKALRTKTNTYIKTPVRNEEPVFVITGRREDVEIAKAEIVQAADHFTQ
                     IRAQRRLHPPPHVPGQVTVTMQVPLRLVGLIVGPKGQTIKKIQQDTATYVITPGRDKD
                     PIFEITGCHEGVERAKELIEDHVLARTGNTLEELLIQQNDPTRQRSSSLDDRIWKDSM
                     DMWKDADRLFGGSPDNLSGGSRKESDFGNFDIGCWNVAPESPTHDSTGSNVVGGGSQF
                     FSPTKPQRSLSLANPIDIGHFDYMNNDHRRATRLNSDPIPAFGSIGASIWNVGSIQNG
                     GGGSLQNGPSWMKNGSENGFNGGSNFGFGNVFNKTSLTSNGDSDSSSPAESVVSQKMK
                     RDCMVCQDQEIVAALVPCGHNAFCMGCARGQQRCPLCYEAVQTAVRIQME"
     CDS             join(1348926..1349148,1349239..1349495,1349595..1349876,
                     1349973..1350533)
                     /codon_start=1
                     /gene="RvY_00467-1"
                     /gene_synonym="RvY_00467.1"
                     /locus_tag="RvY_00467"
                     /product="hypothetical protein"
                     /protein_id="GAU87651.1"
                     /transl_table=1
                     /translation="MESVSRTLWTRVFLVSGSILLCLHRSDALGQRPFSDVGAAGAPG
                     YSCTLSTVCSETRSCPVGCRCTLRGIPCLSGSVCSSFSGASSPLFCLCPTSTIFDSTT
                     NSCVEVTAPTVRPDPGPAPNISVINPKVPGLQATVRRCFQTPQPDDDEETRRLNLRLV
                     VTNSVSLDFCEVKVVETYLGISRKKLRKFNKCSKRDFLVDVSGVQFVDINKGLKWFVL
                     THEGPPEGPRGGYLIQRYSITCTGKNGLTSNPVQFVVAFPSCANCKFQRDSCPVDESR
                     PGRQGNGCERGRVTRPPSARQCLQFYFGNNAPKCPKLYLRTDRLTVTGRNTVSAVMEG
                     SRWTPDSFDNIVHSAEVPMNIQPEKLMNQLQQLGQTEDEDIVTQPPEHLVDDDQNDED
                     DTTADTTTTTTTQAPIEQTDDEQDDEEEETTTHTPNHQDNVDDDDGEE"
     CDS             join(1352100..1352322,1352395..1352849,1352920..1353228,
                     1353321..1353899)
                     /codon_start=1
                     /gene="RvY_00468-1"
                     /gene_synonym="RvY_00468.1"
                     /locus_tag="RvY_00468"
                     /product="hypothetical protein"
                     /protein_id="GAU87652.1"
                     /transl_table=1
                     /translation="MNAKLSDAMRFDAVFLFTFGIIGVALIHALDIRPFDQFGDDVIS
                     AAGYTCPAACTSTRSCRPGCACFLPDIACAGGAVCTTFPGGSRQLFCLCPGGTRQVGS
                     SCVTNGTVTPSTTPATTKAPTCSGSFFQRCFPRNRYHCYKCKRQSFCELTSPENSCPC
                     QSRKRRICFIIKIRSGAAALWSSQNKRQVGSTSAVTIDNLPVVIRQCSQTSRPQGSET
                     SKLNLRIEFEPGVDVRSCTTKLRETFLFISERALKTRNFCTAKDFLYNNRENHISTRS
                     FVGVKVKESLGRGQFYLTRPGPPEGPKGGFLVQRYSVYCTNTDSERSNAEDFYVAFPS
                     CRSCRFQRRDDNCPDAKRHPRRAGNGCRDDGLRLGGSDDDTSAAITPCLPFFGCTPDP
                     NDIITLSDEPRDGPIQSADFEDFDNEPSGDDQLDDSASDDAQSRKAEVSLVTTTEQSS
                     QAEEDSATSQLGAADTDEDSEDTAADADAASTASQAFAESNKFESSDNGAEVSGSVKS
                     QSSFEESSSSEDK"
     CDS             1354624..1354797
                     /codon_start=1
                     /gene="RvY_00469-1"
                     /gene_synonym="RvY_00469.1"
                     /locus_tag="RvY_00469"
                     /product="hypothetical protein"
                     /protein_id="GAU87653.1"
                     /transl_table=1
                     /translation="MITQKRKRASGYCGEFPHLAQESMPATPKIPLTELFARRRTAAF
                     SVRAPSAQGVSGD"
     CDS             complement(join(1355569..1356008,1356175..1356367))
                     /codon_start=1
                     /gene="RvY_00470"
                     /gene_synonym="RvY_00470.1"
                     /locus_tag="RvY_00470-1"
                     /product="hypothetical protein"
                     /protein_id="GAU87654.1"
                     /transl_table=1
                     /translation="MGGNNRRDSSDGILDRAGPRKNSATASDKQFAASSYKCLFHTRW
                     RLLAYLQLIVGLVTMAVNMYSHYPLFTCGLFLTDGVDWLWYGTWIGLLNVLCGLMGSL
                     ANKRGIDDGWHSWLRRSYFMVNCSLLPFANGIGITAYGITLSLYPLLCNSSLPQRFTV
                     ITAFITLCLLVLALLLNVLAVVYQVIATRRCKCWICHPKNHSAAGYIRTT"
     CDS             complement(1356167..1356508)
                     /codon_start=1
                     /gene="RvY_00470"
                     /gene_synonym="RvY_00470.2"
                     /locus_tag="RvY_00470-2"
                     /product="hypothetical protein"
                     /protein_id="GAU87655.1"
                     /transl_table=1
                     /translation="MEHKKLTFAPQTRQAGSAMKRDPLMHPLQGQISMRQDSVALSQL
                     SFNMGGNNRRDSSDGILDRAGPRKNSATASDKQFAASSYKCLFHTRWRLLAYLQLIVG
                     LVTMAVNMYSK"
     CDS             join(1357818..1358557,1358656..1358925,1358996..1359440)
                     /codon_start=1
                     /gene="RvY_00471-1"
                     /gene_synonym="RvY_00471.1"
                     /locus_tag="RvY_00471"
                     /note="COG5368"
                     /product="hypothetical protein"
                     /protein_id="GAU87656.1"
                     /transl_table=1
                     /translation="MATPILFVKFGLVLILLSLLAPKSDCAEYVLTPDDNSFLDDLQE
                     RAFRFFYEHSNPVNGLTLDRAFTDGRPPHGKDSHTNIASTACTGYALVAYCIGVERGW
                     ITRAEAIARTTATLTHFAHHAYNIHGWFYHWINQATGEREWKSEISSIDTALLLGGIL
                     TVRQYFAEDKNIVCLATEIYERVDFQWMLNGHKSWLSHGWIPAGVGWDNEPHPDKFLE
                     SRWTDYSEQTMLNLLAIASPKYPIDWKTWYDLKRNFTEYGGYKFMAAVPPLFIHQYSH
                     AFFDYRNKRERYEQFNMDYFQNSITATEAQRAFFMSEETRKDFPTYSENIWGMTASDT
                     AAGYRAWGAPPRDPEMNGTVVPCAAGGSLMFAPEITLSALKAMKSQYGESMGIYKRYG
                     FTDAFNPDPRANWVNQYVLGIDVGITLLSAENLRTGNVWKWFMTNPEATNALKMVRIL
                     PSGTDPAPSSATTIKPIFALVIVLLELWHATSTM"
     CDS             complement(join(1359545..1359635,1359706..1359944,
                     1360026..1360400))
                     /codon_start=1
                     /gene="RvY_00472-1"
                     /gene_synonym="RvY_00472.1"
                     /locus_tag="RvY_00472"
                     /product="hypothetical protein"
                     /protein_id="GAU87657.1"
                     /transl_table=1
                     /translation="MYHTVIVITTKIADGQYHLLGQKLAEQSMKLYNATYENGTSPLD
                     LYTTRETLNSVEIFAAMVNETLLDLRNMGRTGSACSGRRLRQSIRNRTFDLTLGPTYI
                     DESGSRPAELRIFTFDLSTQKMQLSASYDPTSHSYIWLDKSSLGKVNQSTAWPPDVPR
                     CGFSGFEGPCTPAQQSWRTYSVTVAVSAAILTMIVLTVGGFVTFRRQVRAGLSMWWLI
                     TLQSIPCSTLIPPYFK"
     CDS             complement(join(1360716..1360768,1361108..1361360))
                     /codon_start=1
                     /gene="RvY_00473-1"
                     /gene_synonym="RvY_00473.1"
                     /locus_tag="RvY_00473"
                     /product="hypothetical protein"
                     /protein_id="GAU87658.1"
                     /transl_table=1
                     /translation="MVGTYKSFGQAALKLTQNFDWHHVSLLLDHSVVSTDFYRLLANE
                     ILAASLSSSSWPYSVAILNFDGSDEATISGSLQSAQARSRVIFILSDTKTALRVLVS"
     CDS             complement(1361511..1361795)
                     /codon_start=1
                     /gene="RvY_00474-1"
                     /gene_synonym="RvY_00474.1"
                     /locus_tag="RvY_00474"
                     /product="hypothetical protein"
                     /protein_id="GAU87659.1"
                     /transl_table=1
                     /translation="MVKPTELRRTFDWLIGKEGRIGIKRRAKAHRRWNLTLTPPSPLL
                     ICQLSDRVLRVDRGDSMLSFQAAVGKSFLHFLRQVNRVSRPYSIQNVMTL"
     CDS             complement(join(1362422..1362546,1362968..1363142))
                     /codon_start=1
                     /gene="RvY_00475-1"
                     /gene_synonym="RvY_00475.1"
                     /locus_tag="RvY_00475"
                     /product="hypothetical protein"
                     /protein_id="GAU87660.1"
                     /transl_table=1
                     /translation="MAAEYANRKYFPHLRIVLTYIYNTTDTTCDDATGTVTTQLPGYY
                     YATVSDACLAVIGARNDGERNSKSKNTKFRWANINAQELLNQWLTVPLQKEEKGK"
     CDS             complement(join(1364861..1365088,1365148..1365239,
                     1365315..1365602,1365681..1367018,1367085..1367516,
                     1367584..1367911))
                     /codon_start=1
                     /gene="RvY_00476-1"
                     /gene_synonym="RvY_00476.1"
                     /locus_tag="RvY_00476"
                     /product="hypothetical protein"
                     /protein_id="GAU87661.1"
                     /transl_table=1
                     /translati