LOCUS       BC171908                1452 bp    mRNA    linear   HUM 18-MAR-2009
DEFINITION  Homo sapiens lipase, family member M, mRNA (cDNA clone MGC:198623
            IMAGE:9054562), complete cds.
ACCESSION   BC171908
VERSION     BC171908.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1452)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 1452)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (19-DEC-2008) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: Mike Brownstein, NIMH
            cDNA Library Preparation: British Columbia Cancer Research Center
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Genome Sequence Centre,
            BC Cancer Agency, Vancouver, BC, Canada
            info@bcgsc.bc.ca
            Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
            Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
            Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
            Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
            Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
            Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
            Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
            Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
            Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRCB Plate: 19 Row: I Column: 1.
FEATURES             Location/Qualifiers
     source          1..1452
                     /db_xref="H-InvDB:HIT000503639"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:198623 IMAGE:9054562"
                     /tissue_type="Pooled, cerebellum, kidney, placenta,
                     testis, lung, colon, liver, heart, thyroid, bladder,
                     uterus, PCR rescued clones"
                     /clone_lib="NIH_MGC_362"
                     /lab_host="DH10B"
                     /note="Vector: pCR4-TOPO with reversed insert; Clone
                     identification sequence tag: ATCATTTG"
     gene            1..1452
                     /gene="LIPM"
                     /gene_synonym="bA304I5.1"
                     /db_xref="GeneID:340654"
                     /db_xref="HGNC:HGNC:23455"
     CDS             256..1407
                     /gene="LIPM"
                     /gene_synonym="bA304I5.1"
                     /codon_start=1
                     /product="LIPM protein"
                     /protein_id="AAI71908.1"
                     /db_xref="GeneID:340654"
                     /db_xref="HGNC:HGNC:23455"
                     /translation="MTRPLDRKQSEIIQHQGYPCEEYEVATEDGYILSVNRIPRGLVQ
                     PKKTGSRPVVLLQHGLVGGASNWISNLPNNSLGFILADAGFDVWMGNSRGNAWSRKHK
                     TLSIDQDEFWAFSYDEMARFDLPAVINFILQKTGQEKIYYVGYSQGTTMGFIAFSTMP
                     ELAQKIKMYFALAPIATVKHAKSPGTKFLLLPDMMIKGLFGKKEFLYQTRFLRQLVIY
                     LCGQVILDQICSNIMLLLGGFNTNNMNMSRASVYAAHTLAGTSVQNILHWSQAVNSGE
                     LRAFDWGSETKNLEKCNQPTPVRYRVRDMTVPTAMWTGGQDWLSNPEDVKMLLSEVTN
                     LIYHKNIPEWAHVDFIWGLDAPHRMYNEIIHLMQQEETNLSQGRCEAVL"
BASE COUNT          420 a          309 c          356 g          367 t
ORIGIN      
        1 tggcttctga ttctggtggc gtatatgttc cagagaaatg tgaattcagt acatatgcca
       61 actaaagctg tggacccaga agcattcatg aatattgaga atcatcatca tcgcctgtgg
      121 aaaggaagta gagaatcagg agtaaggaaa gagataaatc aaactgtgat acagacttca
      181 aaacagccag actcaactcc atgaggagct atggagctaa aactgctctt cagagatgtc
      241 ctacgttggg ctgagatgac caggccttta gaccgcaaac agagtgaaat catccaacat
      301 caaggctatc cctgtgagga atatgaagtc gcaactgaag atgggtatat cctttctgtt
      361 aacaggattc ctcgaggcct agtgcaacct aagaagacag gttccaggcc tgtggtgtta
      421 ctgcagcatg gcctagttgg aggtgctagc aactggattt ccaacctgcc caacaatagc
      481 ctgggcttca ttctggcaga tgctggtttt gacgtgtgga tggggaacag caggggaaac
      541 gcctggtctc gaaaacacaa gacactctcc atagaccaag atgagttctg ggctttcagt
      601 tatgatgaga tggctaggtt tgaccttcct gcagtgataa actttatttt gcagaaaacg
      661 ggccaggaaa agatctatta tgtcggctat tcacagggca ccaccatggg ctttattgca
      721 ttttccacca tgccagagct ggctcagaaa atcaaaatgt attttgcttt agcacccata
      781 gccactgtta agcatgcaaa aagccccggg accaaatttt tgttgctgcc agatatgatg
      841 atcaagggat tgtttggcaa aaaagaattt ctgtatcaga ccagatttct cagacaactt
      901 gttatttacc tttgtggcca ggtgattctt gatcagattt gtagtaatat catgttactt
      961 ctgggtggat tcaacaccaa caatatgaac atgagccgag caagtgtata tgctgcccac
     1021 actcttgctg gaacatctgt gcaaaatatt ctacactgga gccaggcagt gaattctggt
     1081 gaactccggg catttgactg ggggagtgag accaaaaatc tggaaaaatg caatcagcca
     1141 actcctgtaa ggtacagagt cagagatatg acggtcccta cagcaatgtg gacaggaggt
     1201 caggactggc tttcaaatcc agaagacgtg aaaatgctgc tctctgaggt gaccaacctc
     1261 atctaccata agaatattcc tgaatgggct cacgtggatt tcatctgggg tttggatgct
     1321 cctcaccgta tgtacaatga aatcatccat ctgatgcagc aggaggagac caacctttcc
     1381 cagggacggt gtgaggccgt attgtgaagc atctgacact gacgatctta ggacaacctc
     1441 ctgagggatg gg
//