LOCUS BC106911 484 bp mRNA linear HUM 17-SEP-2007 DEFINITION Homo sapiens transmembrane protein 98, mRNA (cDNA clone IMAGE:40031873), partial cds. ACCESSION BC106911 VERSION BC106911.2 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 484) AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G., Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D., Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K., Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F., Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L., Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L., Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S., Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J., Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J., McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S., Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W., Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A., Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S., Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y., Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D., Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M., Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E., Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A. CONSRTM Mammalian Gene Collection Program Team TITLE Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002) PUBMED 12477932 REFERENCE 2 (bases 1 to 484) CONSRTM NIH MGC Project TITLE Direct Submission JOURNAL Submitted (01-OCT-2005) National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda, MD 20892-2590, USA REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov COMMENT On Nov 1, 2006 this sequence version replaced BC106911.1. Contact: MGC help desk Email: cgapbs-r@mail.nih.gov Tissue Procurement: Baylor Human Genome Sequencing Center cDNA Library Preparation: Baylor Human Genome Sequencing Center cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL) DNA Sequencing by: Sequencing Group at the Stanford Human Genome Center, Stanford University School of Medicine, Stanford, CA 94305 Web site: http://www-shgc.stanford.edu Contact: (Dickson, Mark) mcd@paxil.stanford.edu Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers, R. M. Clone distribution: MGC clone distribution information can be found through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov Series: IRAM Plate: 14 Row: b Column: 24. FEATURES Location/Qualifiers source 1..484 /db_xref="H-InvDB:HIT000338549" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="IMAGE:40031873" /tissue_type="PCR rescued clones" /clone_lib="NIH_MGC_283" /note="Vector: pCR-Blunt II-TOPO with reversed insert; Clone identification sequence tag: NA" gene <1..484 /gene="TMEM98" /gene_synonym="DKFZP564K1964" /db_xref="GeneID:26022" /db_xref="HGNC:HGNC:24529" CDS <1..288 /gene="TMEM98" /gene_synonym="DKFZP564K1964" /codon_start=1 /product="TMEM98 protein" /protein_id="AAI06912.1" /db_xref="GeneID:26022" /db_xref="HGNC:HGNC:24529" /translation="LAITSHRVDDVVKSMYPPLDPKLLDARTTALLLSVSHLVLVTRN ACHLTGGLDWIDQSLSAAEEHLEVLREAALASEPDKGLPGPEGFLQEQSAI" BASE COUNT 96 a 134 c 135 g 119 t ORIGIN 1 cttgccatca ccagccacag ggtggatgat gttgtgaagt cgatgtaccc tccgttggac 61 cccaaactcc tggacgcacg gacgactgcc ctgctcctgt ctgtcagtca cctggtgctg 121 gtgacaagga atgcctgcca tctgacggga ggcctggact ggattgacca gtctctgtcg 181 gctgctgagg agcatttgga agtccttcga gaagcagccc tagcttctga gccagataaa 241 ggcctcccag gccctgaagg cttcctgcag gagcagtctg caatttagtg cctacaggcc 301 agcagctagc catgaaggcc cctgccgcca tccctggatg gctcagctta gccttctact 361 ttttcctata gagttagttg ttctccacgg ctggagagtt cagctgtgtg tgcatagtaa 421 agcaggagat ccccgtcagt ttatgcctct tttgcagttg caaactgtgg ctggtgatgg 481 caag //