LOCUS       BC092414                2149 bp    mRNA    linear   HUM 17-JUL-2006
DEFINITION  Homo sapiens major facilitator superfamily domain containing 2,
            mRNA (cDNA clone MGC:102931 IMAGE:30387073), complete cds.
ACCESSION   BC092414
VERSION     BC092414.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2149)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 2149)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (04-APR-2005) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: Dr. Michael Brownstein
            cDNA Library Preparation: Invitrogen Corp
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Sequencing Group at the Stanford Human Genome
            Center, Stanford University School of Medicine, Stanford, CA  94305
            Web site:       http://www-shgc.stanford.edu
            Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
            Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
            R. M.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAK Plate: 196 Row: g Column: 23
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 42713695.
FEATURES             Location/Qualifiers
     source          1..2149
                     /db_xref="H-InvDB:HIT000334392"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:102931 IMAGE:30387073"
                     /tissue_type="Testis"
                     /clone_lib="NIH_MGC_180"
                     /lab_host="DH10B"
                     /note="Vector: pCMV-SPORT6.1"
     gene            1..2149
                     /gene="MFSD2"
                     /gene_synonym="FLJ14490"
                     /gene_synonym="FP1147"
                     /gene_synonym="HMFN0656"
                     /gene_synonym="PP10484"
                     /gene_synonym="RP3-342P20.1"
                     /db_xref="GeneID:84879"
                     /db_xref="HGNC:HGNC:25897"
     CDS             124..1716
                     /gene="MFSD2"
                     /gene_synonym="FLJ14490"
                     /gene_synonym="FP1147"
                     /gene_synonym="HMFN0656"
                     /gene_synonym="PP10484"
                     /gene_synonym="RP3-342P20.1"
                     /codon_start=1
                     /product="major facilitator superfamily domain containing
                     2"
                     /protein_id="AAH92414.1"
                     /db_xref="GeneID:84879"
                     /db_xref="HGNC:HGNC:25897"
                     /translation="MAKGEGAESGSAAGLLPTSILQSTERPAQVKKEPKKKKQQLSVC
                     NKLCYALGGAPYQVTGCALGFFLQIYLLDVAQVGPFSASIILFVGRAWDAITDPLVGL
                     CISKSPWTCLGRLMPWIIFSTPLAVIAYFLIWFVPDFPHGQTYWYLLFYCLFETMVTC
                     FHVPYSALTMFISTEQTERDSATAYRMTVEVLGTVLGTAIQGQIVGQADTPCFQDLNS
                     STVASQSANHTHGTTSHRETQKAYLLAAGVIVCIYIICAVILILGVREQREPYEAQQS
                     EPIAYFRGLRLVMSHGPYIKLITGFLFTSLAFMLVEGNFVLFCTYTLGFRNEFQNLLL
                     AIMLSATLTIPIWQWFLTRFGKKTAVYVGISSAVPFLILVALMESNLIITYAVAVAAG
                     ISVAAAFLLPWSMLPDVIDDFHLKQPHFHGTEPIFFSFYVFFTKFASGVSLGISTLSL
                     DFAGYQTRGCSQPERVKFTLNMLVTMAPIVLILLGLLLFKMYPIDEERRRQNKKALQA
                     LRDEASSSGCSETDSTELASIL"
BASE COUNT          481 a          614 c          556 g          498 t
ORIGIN      
        1 ggcttggcta gcgcgcggcg gccgtggcta aggctgctac gaagcgagct tgggaggagc
       61 agcggcctgc ggggcagagg agcatcccgt ctaccaggtc ccaagcggcg tggcccgcgg
      121 gtcatggcca aaggagaagg cgccgagagc ggctccgcgg cggggctgct acccaccagc
      181 atcctccaaa gcactgaacg cccggcccag gtgaagaaag aaccgaaaaa gaagaaacaa
      241 cagttgtctg tttgcaacaa gctttgctat gcacttgggg gagcccccta ccaggtgacg
      301 ggctgtgccc tgggtttctt ccttcagatc tacctattgg atgtggctca ggtgggccct
      361 ttctctgcct ccatcatcct gtttgtgggc cgagcctggg atgccatcac agaccccctg
      421 gtgggcctct gcatcagcaa atccccctgg acctgcctgg gtcgccttat gccctggatc
      481 atcttctcca cgcccctggc cgtcattgcc tacttcctca tctggttcgt gcccgacttc
      541 ccacacggcc agacctattg gtacctgctt ttctattgcc tctttgaaac aatggtcacg
      601 tgtttccatg ttccctactc ggctctcacc atgttcatca gcaccgagca gactgagcgg
      661 gattctgcca ccgcctatcg gatgactgtg gaagtgctgg gcacagtgct gggcacggcg
      721 atccagggac aaatcgtggg ccaagcagac acgccttgtt tccaggacct caatagctct
      781 acagtagctt cacaaagtgc caaccataca catggcacca cctcacacag ggaaacgcaa
      841 aaggcatacc tgctggcagc gggggtcatt gtctgtatct atataatctg tgctgtcatc
      901 ctgatcctgg gcgtgcggga gcagagagaa ccctatgaag cccagcagtc tgagccaatc
      961 gcctacttcc ggggcctacg gctggtcatg agccacggcc catacatcaa acttattact
     1021 ggcttcctct tcacctcctt ggctttcatg ctggtggagg ggaactttgt cttgttttgc
     1081 acctacacct tgggcttccg caatgaattc cagaatctac tcctggccat catgctctcg
     1141 gccactttaa ccattcccat ctggcagtgg ttcttgaccc ggtttggcaa gaagacagct
     1201 gtatatgttg ggatctcatc agcagtgcca tttctcatct tggtggccct catggagagt
     1261 aacctcatca ttacatatgc ggtagctgtg gcagctggca tcagtgtggc agctgccttc
     1321 ttactaccct ggtccatgct gcctgatgtc attgacgact tccatctgaa gcagccccac
     1381 ttccatggaa ccgagcccat cttcttctcc ttctatgtct tcttcaccaa gtttgcctct
     1441 ggagtgtcac tgggcatttc taccctcagt ctggactttg cagggtacca gacccgtggc
     1501 tgctcgcagc cggaacgtgt caagtttaca ctgaacatgc tcgtgaccat ggctcccata
     1561 gttctcatcc tgctgggcct gctgctcttc aaaatgtacc ccattgatga ggagaggcgg
     1621 cggcagaata agaaggccct gcaggcactg agggacgagg ccagcagctc tggctgctca
     1681 gaaacagact ccacagagct ggctagcatc ctctagggcc cgccacgttg cccgaagcca
     1741 ccatgcagaa ggccacagaa gggatcagga cctgtctgcc ggcttgctga gcagctggac
     1801 tgcaggtgct aggaagggaa ctgaagactc aaggaggtgg cccaggacac ttgctgtgct
     1861 cactgtgggg ccggctgctc tgtggcctcc tgcctcccct ctgcctgcct gtggggccaa
     1921 gccctggggc tgccactgtg aatatgccaa ggactgatcg ggcctagccc ggaacactaa
     1981 tgtagaaacc ttttttttac agagcctaat taataactta atgactgtgt acatagcaat
     2041 gtgtgtgtat gtatatgtct gtgagctatt aatgttatta attttcataa aagctggaaa
     2101 gcaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaa
//