LOCUS       BC080628                2787 bp    mRNA    linear   HUM 28-JUL-2005
DEFINITION  Homo sapiens nuclear factor of activated T-cells, cytoplasmic,
            calcineurin-dependent 2 interacting protein, mRNA (cDNA clone
            IMAGE:6341468), partial cds.
ACCESSION   BC080628
VERSION     BC080628.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2787)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 2787)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (27-AUG-2004) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC
            cDNA Library Preparation: Rubin Laboratory
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: National Institutes of Health Intramural
            Sequencing Center (NISC),
            Gaithersburg, Maryland;
            Web site: http://www.nisc.nih.gov/
            Contact: nisc_mgc@nhgri.nih.gov
            Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
            Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
            Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
            Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
            Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
            McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
            Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
            Young,A., Zhang,L.-H. and Green,E.D.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 59 Row: k Column: 16
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 46447822.
FEATURES             Location/Qualifiers
     source          1..2787
                     /db_xref="H-InvDB:HIT000265892"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="IMAGE:6341468"
                     /tissue_type="Brain, neuroblastoma"
                     /clone_lib="NIH_MGC_47"
                     /lab_host="DH10B-R"
                     /note="Vector: pOTB7"
     gene            <1..2787
                     /gene="NFATC2IP"
                     /gene_synonym="FLJ14639"
                     /db_xref="GeneID:84901"
     CDS             <1..942
                     /gene="NFATC2IP"
                     /gene_synonym="FLJ14639"
                     /codon_start=1
                     /product="NFATC2IP protein"
                     /protein_id="AAH80628.1"
                     /db_xref="GeneID:84901"
                     /translation="VRRRRRLVLDPGEAPLVPVYSGKVKSSLRLIPDDLSLLKLYPPG
                     DEEEAELADSSGLYHEGSPSPGSPWKTKLRTKDKEEKKKTEFLDLDNSPLSPPSPRTK
                     SRTHTRALKKLSEVNKRLQDLRSCLSPKPPQGQEQQGQEDEVVLVEGPTLPETPRLFP
                     LKIRCRADLVRLPLRMSEPLQSVVDHMATHLGVSPSRILLLFGETELSPTATPRTLKL
                     GVADIIDCVVLTSSPEATETSQQLQLRVQGKEKHQTLEVSLSRDSPLKTLMSHYEEAM
                     GLSGRKLSFFFDGTKLSGRELPADLGMESGDLIEVWG"
BASE COUNT          641 a          718 c          711 g          717 t
ORIGIN      
        1 gtcaggcggc ggcggcggct ggtgctggat ccgggggagg cgccgctggt tccggtgtac
       61 tcggggaagg ttaaaagcag ccttcgcctt atcccagatg atctatccct cctgaaactc
      121 taccctccag gggatgagga agaggcagag ctggcagatt cgagtggtct ctaccatgag
      181 ggctccccat caccaggctc tccctggaag acaaagctga ggactaagga taaagaagag
      241 aagaaaaaga cagagtttct ggatctggac aactctcctc tgtccccacc ttcaccaagg
      301 accaaaagca gaacgcatac tcgggcactc aagaagttaa gtgaggtgaa caagcgcctc
      361 caggatctcc gttcctgtct gagccccaag ccacctcagg gtcaagagca acagggccaa
      421 gaggatgaag tggtcttggt ggaagggccc accctcccag agaccccccg actcttccca
      481 ctcaaaatcc gttgccgggc tgacctggtc agattgcccc tcaggatgtc ggagcccctg
      541 cagagtgtgg tggaccacat ggccacccac cttggggtgt ccccaagcag gatccttttg
      601 ctttttggag agacagagct atcacctact gccactccca ggaccctaaa gctcggagtg
      661 gctgacatca ttgactgtgt ggtactaaca agttctccag aggccacaga gacgtcccaa
      721 cagctccagc tccgggtgca gggaaaggag aaacaccaga cactggaagt ctcactgtct
      781 cgagattccc ctctaaagac cctcatgtcc cactatgagg aggccatggg actgtcggga
      841 cggaagctct ccttcttctt tgatgggaca aagctttcag gcagggagct gccagctgac
      901 ctgggcatgg aatctgggga cctcattgag gtctggggct gacaccccac tccctgtttg
      961 acggcccagc ctggacttgg ggagaatgac tttccctttt ttgccccata agggctagca
     1021 taagctgagg tagaacttat ctttaagctg cagcaaaatc aaggagtgac ttttgtcccc
     1081 tctcctgttg accctggttt agagccgtta accacttggt gagttatgtg ggtgttgttg
     1141 ccctgggtgg cctgtggctc cgtccacaag tcatgctgag ttttgcagcc tctgtgactt
     1201 ggagatgtcc cttcacccct cccctttcac caccatcctc ttttcctcat ggaaatgtct
     1261 gctttatgaa actatgcaca tattgaaagt gagttgaaac aaatgagggt tgggtaggag
     1321 cttccaggcc tgggatttac accacgccta gcccagcaga ggccttagtc ccatttgggg
     1381 cttgggagtg acatttgctt gaggcttata cactggtgtg gttgcctggc ttgcaggaaa
     1441 tgaccaagct cacacatgct ggctgaagcg taagcagaca actgaggtac tcttttgaag
     1501 gatgaaggtg gtggattctc agccctgggg gtcttcctca cctgaggacc cttcagagcc
     1561 accctttcta gtttgcattt cctggtgcac acatttaagg cataacagca cattcatccc
     1621 tttggtttgg gatctcagga atacagtccc atgcaaagat tctctggttt tatggctttt
     1681 ttccctttct ttacaccatc ctctcccata agcacccatg tctttgaata tgaatgtatt
     1741 tgtaaaatac cacgtttcat gtgtgaatat gtgcttttac tgtacatagt gctattgtgc
     1801 aataggtctt atgctgtttt cactcaatgt gtgctaagat ctagccccat tgactcttct
     1861 agaaatgcag tattgctttg acctgccatg tggcactcca caatgtcaat tgcagtttac
     1921 acacattgcc taaagtgggg gacacctggg tgcccctgac cccttggcac cggatacagg
     1981 ccacgataaa catcctttcg tgtgttccct tctgtgcttg tgtggcatgt gtacccagga
     2041 tgggcctata ggtcacagag gtcagtttct ctttggtttt ccagattttc tttagaacgg
     2101 tgactgaccc tcctacttga ggccgccctt ttctccttat ccttgccagc acttgtattg
     2161 ccagactacc taatttttgc cagtctcatg ggtagatagt ggtgcagtgc tttaacatac
     2221 attcatctga tcagcattaa tttggggaat tttttcactt agcctttctg gtttcccttc
     2281 ctgtgcattg cccattttct catggagttt cttatctttt ttggtttatt ctcaggagtt
     2341 gcttgtacat tcttgggcaa ttgcagataa ttccaagaat gcatatttgg gctgggtatg
     2401 gaggttcact ggtaatccca gcactttggg aggcccaggc agaaggatcg ctgcagccca
     2461 ggagttcgag actagcctgg gcaacatagc gagacctcgt ctctacaaaa aaaaattaaa
     2521 aagggggctt tggggggcca aggcgggcag atcatgaggg caggagattg agaccctcct
     2581 ggccaacatg gtgaaacccc gtctctacta agatgcaaaa aattggctgg gcatggtggc
     2641 gcacacctgt ggtcccggct actctggagg ctgaggcagg ggaatcgctt agacccagga
     2701 ggcggagatt gcagtgagcc aaggttccac cactgcactc cagcctggcg acagagcaag
     2761 gctccactca aaaaaaaaaa aaaaaaa
//