LOCUS       BC073959                1900 bp    mRNA    linear   HUM 30-DEC-2006
DEFINITION  Homo sapiens vacuolar protein sorting 16 homolog (S. cerevisiae),
            mRNA (cDNA clone MGC:87858 IMAGE:6182570), complete cds.
ACCESSION   BC073959
VERSION     BC073959.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1900)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 1900)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (23-JUN-2004) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: Dr. James R. Lupski
            cDNA Library Preparation: Life Technologies, Inc.
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: National Institutes of Health Intramural
            Sequencing Center (NISC),
            Gaithersburg, Maryland;
            Web site: http://www.nisc.nih.gov/
            Contact: nisc_mgc@nhgri.nih.gov
            Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
            Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
            Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
            Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
            Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
            McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
            Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
            Young,A., Zhang,L.-H. and Green,E.D.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAK Plate: 174 Row: m Column: 5
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 18450367.
FEATURES             Location/Qualifiers
     source          1..1900
                     /db_xref="H-InvDB:HIT000265181"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:87858 IMAGE:6182570"
                     /tissue_type="Peripheral Nervous System, dorsal root
                     ganglion"
                     /clone_lib="Lupski_dorsal_root_ganglion"
                     /lab_host="DH10B"
                     /note="Vector: pCMV-SPORT6"
     gene            1..1900
                     /gene="VPS16"
                     /gene_synonym="hVPS16"
                     /db_xref="GeneID:64601"
                     /db_xref="HGNC:HGNC:14584"
                     /db_xref="MIM:608550"
     CDS             94..1668
                     /gene="VPS16"
                     /gene_synonym="hVPS16"
                     /codon_start=1
                     /product="VPS16 protein"
                     /protein_id="AAH73959.1"
                     /db_xref="GeneID:64601"
                     /db_xref="HGNC:HGNC:14584"
                     /db_xref="MIM:608550"
                     /translation="MPWLWTAPHQKESQKADEYLREIQELGQLTQAVQQCIEAAGHEH
                     QPDMQKSLLRVGLDGRAGEGGAGRGWDGQQGSSLLSPSGSSQAASFGKCFLDRFPPDS
                     FVHMCQDLRVLNAVRDYHIGIPLTYSQYKQLTIQVLLDRLVLRRLYPLAIQICEYLRL
                     PEVQGVSRILAHWACYKVQQKDVSDEDVARAINQKLGDTPGVSYSDIAARAYGCGRTE
                     LAIKLLEYEPRSGEQVPLLLKMKRSKLALSKAIESGDTDLVFTVLLHLKNELNRGDFF
                     MTLRNQPMALSLYRQFCKHQELETLKDLYNQDDNHQELGSFHIRASYAAEERIEGRVA
                     ALQTAADAFYKAKNEFAAKATEDQMRLLRLQRRLEDELGGQFLDLSLHDTVTTLILGG
                     HNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYLPFVEICMK
                     QHNKYEAKKYASRVGPEQKVKALLLVGDVAQAADVAIEHRNEAELSLVLSHCTGATDG
                     ATADKIQRARAQAQKK"
BASE COUNT          500 a          490 c          545 g          365 t
ORIGIN      
        1 ggggctccag cctgtgcagc tcctccaacc cagcttattt gaaccacaac ccagaatggt
       61 taggggccag atgtgggagt gttctctgtc atgatgccct ggctctggac tgctccccac
      121 cagaaagaga gccagaaggc ggacgagtac ctgcgggaga tccaggagct gggccagctg
      181 acccaggccg tgcagcagtg cattgaggct gcaggacatg agcaccagcc agacatgcag
      241 aagagtctgc tcagggttgg cctggatggc cgggccgggg agggtggggc tgggaggggg
      301 tgggatgggc agcagggaag ctctctccta tcgccctctg gctcttctca ggccgcctcc
      361 ttcggaaagt gtttcctgga cagatttcca cccgacagct tcgtgcacat gtgtcaggac
      421 ctgcgtgtgc tcaatgctgt tcgggactat cacatcggga tcccgctcac ctatagccaa
      481 tataagcagc tcaccatcca ggtgctgctg gacaggctcg tgttgcggag actttacccc
      541 ctggccatcc agatatgcga gtacttgcgc cttcctgaag tacagggcgt cagcaggatc
      601 ctggcccact gggcctgcta caaggtgcaa cagaaggatg tctcagatga ggatgtggct
      661 cgagccatta accagaagct gggggacacg cctggtgtct cttactccga cattgctgca
      721 cgagcctatg gttgtggccg cacggagctg gccatcaagc tgctggagta tgagccacgc
      781 tcaggggagc aggtacccct tctcctaaag atgaagagga gcaaactggc actaagcaag
      841 gccatcgaga gcggggacac tgacctggtg ttcacggtgt tgctgcacct gaagaacgag
      901 ctgaaccgag gagatttttt catgaccctt cggaatcagc ccatggccct cagtttgtac
      961 cgacagttct gtaagcatca ggagctagag acgctgaagg acctttacaa tcaggatgac
     1021 aatcaccagg aattgggcag cttccacatc cgagccagct atgctgcaga agagcgtatt
     1081 gaggggcgag tagcagctct gcagacagcc gccgatgcct tctacaaggc caagaatgag
     1141 tttgcagcca aggctacaga ggatcaaatg cggctcctac ggctgcagcg gcgcctagaa
     1201 gacgagctgg ggggccagtt cctagacctg tctctacatg acacagttac caccctcatt
     1261 cttggcggtc acaacaagcg tgcagagcag ctggcacgtg acttccgcat ccctgacaag
     1321 aggctctggt ggctgaagct gactgccctg gcagatttgg aagattggga agagctagag
     1381 aagttttcca agagcaagaa atcacccatt ggctacctgc cttttgtgga gatctgcatg
     1441 aaacaacata acaaatacga agccaagaag tatgcttccc gcgtgggtcc cgagcagaag
     1501 gtcaaggctt tgcttcttgt tggcgatgtg gctcaggctg cagatgtggc catcgaacac
     1561 cggaatgagg ctgagctgag cctcgtattg tcccactgca cgggagccac agatggggcc
     1621 acagctgaca agattcaacg ggccagggca caagcccaga agaagtgagg agtccatcct
     1681 gtacatctca agcaaggggt tcctccccta gcacctgggc ttggcagaag ggccatagtt
     1741 catccagctc ctcccctaga gcaatgctga ggagcggggg catggtagca gggctgtctg
     1801 gttttaaata aagttggaac acttcaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa
     1861 aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa
//