LOCUS       BC073844                3087 bp    mRNA    linear   HUM 03-NOV-2006
DEFINITION  Homo sapiens transmembrane protein 182, mRNA (cDNA clone
            IMAGE:3447048), partial cds.
ACCESSION   BC073844
VERSION     BC073844.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 3087)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 3087)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (23-JUN-2004) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC
            cDNA Library Preparation: Life Technologies, Inc.
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Sequencing Group at the Stanford Human Genome
            Center, Stanford University School of Medicine, Stanford, CA  94305
            Web site:       http://www-shgc.stanford.edu
            Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
            Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
            R. M.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAK Plate: 166 Row: a Column: 3.
FEATURES             Location/Qualifiers
     source          1..3087
                     /db_xref="H-InvDB:HIT000265069"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="IMAGE:3447048"
                     /tissue_type="Placenta, choriocarcinoma"
                     /clone_lib="NIH_MGC_10"
                     /lab_host="DH10B"
                     /note="Vector: pCMV-SPORT6"
     gene            <1..3087
                     /gene="TMEM182"
                     /gene_synonym="FLJ30294"
                     /db_xref="GeneID:130827"
                     /db_xref="HGNC:HGNC:26391"
     CDS             <1..613
                     /gene="TMEM182"
                     /gene_synonym="FLJ30294"
                     /codon_start=2
                     /product="TMEM182 protein"
                     /protein_id="AAH73844.1"
                     /db_xref="GeneID:130827"
                     /db_xref="HGNC:HGNC:26391"
                     /translation="WLGVLVSGKVGTGHIINTIENVTFHHEGFFWRCWFNGIVEENDS
                     NIWKFWYTNQPPSKNCTHAYLSPYPFMRGEHNSTSYDSAVIYRGFWAVLMLLGVVAVV
                     IASFLIICAAPFASHFLYKAGGGSYIAAGILFSLVVMLYVIWVQAVADMESYRNMKMK
                     DCLDFTPSVLYGWSFFLAPAGIFFSLLAGLLFLVVGRHIQIHH"
BASE COUNT          893 a          541 c          586 g         1067 t
ORIGIN      
        1 ctggctggga gttctggtct caggcaaggt ggggactggg cacatcatca atacgataga
       61 gaacgtcact tttcaccatg aagggttctt ctggaggtgt tggtttaatg ggattgtgga
      121 agagaatgac tccaatattt ggaagttctg gtataccaat cagccaccgt ccaagaactg
      181 cacacatgct tacctgtctc cgtacccctt catgagaggc gagcacaact cgacctccta
      241 tgactctgca gttatttacc gtggtttctg ggcagtcctg atgctcctgg gggtagttgc
      301 tgtagtcatc gcaagctttt tgatcatctg tgcagccccc ttcgccagcc attttctcta
      361 caaagctggg ggaggctcat atattgctgc aggcatccta ttttcattgg tggtgatgct
      421 gtatgtcatc tgggtccagg cagtggctga catggaaagc taccgaaaca tgaaaatgaa
      481 ggactgcctg gatttcaccc cttctgttct gtatggctgg tcatttttcc tggccccagc
      541 tgggatattt ttttctttgc tagctggatt actatttctg gttgttggac ggcatattca
      601 gatacatcac taaatcaact gttgccacaa gtattttctt gagagatttt aaaacaagga
      661 atactttttt tccattttgt ttcattgatc ccagcataaa gttagtagat ataacttttt
      721 agttgctatt caaattaatc attttactaa aattttcttc agtaagaagg tcctagaatc
      781 tctccagaca ccagcaagcc tctatcttgt ctaagtgctg tcaaggacct agttctttag
      841 ggaataggta aacaggtctc cctttcattg aacatgttag agttcatgca ggtcgcaaag
      901 gcctgataat agcttaatac catgacatgg ggaaaatctc gatagatttg gcttaaagtc
      961 tccttggcat tcacttctgc taattaaaaa aaatccttga agaataatta agaatgggca
     1021 aggttgtcag agaatttatt ttgtttcttg cccacacaga taatatccac atacacattc
     1081 actggctctt gtgagcaaat gaatttaaaa atagacagca gttgttctaa ttagtgggag
     1141 ccatgtactc accagttaaa atgggccaca acaaacaaga ctgagagcat gtacttatct
     1201 tgctttttca ccaacagtgg tttggttacc tagttttatt cacttaattg tgcatgctta
     1261 cataaacttt aaactacatt taaaactagc aaatctgcat accaaattat gtataacgta
     1321 gattgaattt ttatgaactt aaagtgagtt aattgtataa tgtaatattg tttaaaatat
     1381 gtaaaaacca agcatttccg cttggtccat aattctattt gatattttaa aattctcatt
     1441 taaaaattat attgctatca ttcagcatgt gaaaatttat tgataaaatg tgattttaat
     1501 attctttaga tataaacttt cagcgtactt ccatatgagg attataatag ccctgcttta
     1561 ttaaagacca taaaatatta actttcccca agatgttatg ggttccagtt cttctgatca
     1621 tttgattcct ttaattactg tccctcaatt tcttcatctt tacaatagat atattaacat
     1681 ttacagatcg actatttcct ttaacctcct agaagaaagt ttttgtgggg aaagatgatt
     1741 ctgtattatt cagtagcata gacattttgc atatcaaaga tgttcatttg gcactaatgt
     1801 tgattgaaat caaatccatc tgagatgcct agctcgtatt tgcattctgg aagcctccat
     1861 cgcaggggag ctcggcaggg tatgtgagct ttgttggagg tgcggtgttt cattctgcag
     1921 ctgttgtgag gacagagagg catggcccac aggcaaaaaa agtcaccacc cagaagatgc
     1981 tctgggatag aggaactgct ccttttcatc agctcttcca atgccgtggg agaggtgatc
     2041 ccagtcttct ctgtacatct tgtgcttttc cattaagact tgttccagtg ggaaggagct
     2101 ttggaaaaat tgcaaaggtc tgaatcttca gggcattttc atgacaggac ttgccaataa
     2161 taataataat aataataata ataataataa taataaagct ccagaggcct aactggtttc
     2221 tcaagtcatt tcagtgatat cattgaaacg tttttgtggt acttcccttt gtctttcact
     2281 gtttcatttt tatattgctt catttacttc tttgcttttg gctttgttat tagaaaaaat
     2341 aattatgagg tctgttgtgc atgttgactg tgatattaag ttatggcatg ccattaagtt
     2401 ttccagacga tgttggatgt atctgattag ttcatgtcat ctgtaaatac aattcttttt
     2461 tgtagtactt tggaatggag cctttttctg gtgtactgta tgccatttaa gtttcacata
     2521 caagctgctt tcggcaaagg cttgaatatt tataaatttc agatggttat cctcacttta
     2581 tagtacactt aagtggctac catatatttt ttatatgaca attggctgaa tagctgatgt
     2641 gtatgacact tttacacaga tttgcacttt ggaactattt tatagttgta atgcatcaat
     2701 caaatacatt tcaagcacat ttcttgatca atttaccagc aaccctctga aggaatgaag
     2761 gagagttgtg attgctatgt caatgagtga aatatactta aaaatggcag agatatatag
     2821 tacattattg tagcaacctt atatctgatt tgagatactg tgttgccaaa tgtccatgtt
     2881 atgtttattt ctctattggt tgtatttatt aatttttaga agcctttaaa ctgtgttaga
     2941 atctttttga aaaatgttga ttttgcatca taaagtttca atttatcaag gatatctttt
     3001 cagttacact tttagaaaga gtgaataaaa agggcagtga gttatgctct tggacttggt
     3061 gaaaaaaaaa aaaaaaaaaa aaaaaaa
//