LOCUS       BC073831                2650 bp    mRNA    linear   HUM 06-DEC-2004
DEFINITION  Homo sapiens tripartite motif-containing 65, mRNA (cDNA clone
            IMAGE:4445318), partial cds.
ACCESSION   BC073831
VERSION     BC073831.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2650)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 2650)
  AUTHORS   Director MGC Project.
  TITLE     Direct Submission
  JOURNAL   Submitted (23-JUN-2004) National Institutes of Health, Mammalian
            Gene Collection (MGC), Cancer Genomics Office, National Cancer
            Institute, 31 Center Drive, Room 11A03, Bethesda, MD 20892-2590,
            USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC
            cDNA Library Preparation: Life Technologies, Inc.
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Sequencing Group at the Stanford Human Genome
            Center, Stanford University School of Medicine, Stanford, CA  94305
            Web site:       http://www-shgc.stanford.edu
            Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
            Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
            R. M.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAK Plate: 166 Row: d Column: 9
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 38679904.
FEATURES             Location/Qualifiers
     source          1..2650
                     /db_xref="H-InvDB:HIT000265057"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="IMAGE:4445318"
                     /tissue_type="Liver, adenocarcinoma"
                     /clone_lib="NIH_MGC_90"
                     /lab_host="DH10B"
                     /note="Vector: pCMV-SPORT6"
     gene            <1..2650
                     /gene="TRIM65"
                     /gene_synonym="4732463G12Rik"
                     /db_xref="GeneID:201292"
     CDS             <1..818
                     /gene="TRIM65"
                     /gene_synonym="4732463G12Rik"
                     /codon_start=3
                     /product="TRIM65 protein"
                     /protein_id="AAH73831.1"
                     /db_xref="GeneID:201292"
                     /translation="HASAQLLQPPGPLGPLTPLQWDEDQQLGDLKQLLSRLCGLLLEE
                     GSHPGAPAKPVDLAPVEAPGPLAPVPSTVCPLRRKLWQNYRNLTFDPVSANRHFYLSR
                     QDQQVKHCRQSRGPGGPGSFELWQVQCAQSFQAGHHYWEVRASDHSVTLGVSYPQLPR
                     CRLGPHTDNIGRGPCSWGLCVQEDSLQAWHNGEAQRLPGVSGRLLGMDLDLASGCLTF
                     YSLEPQTQPLYTFHALFNQPLTPVFWLLEGRTLTLCHQPGAVFPPGPQEEVLS"
BASE COUNT          583 a          694 c          737 g          636 t
ORIGIN      
        1 cccacgcgtc cgcgcagctc ctccagcccc cagggcctct tgggccactg acccctctgc
       61 agtgggatga agaccaacag ctgggtgacc tgaagcagtt gctaagccgg ctgtgtggcc
      121 tcctcttgga agaggggagc caccctgggg caccagccaa gcctgtggac ttagcccccg
      181 tggaggcccc aggtcccctg gcaccggtcc caagcacagt ttgtccactg aggaggaaac
      241 tctggcagaa ttatcgcaat ctgacctttg atccagtcag cgccaaccgt cacttctatc
      301 tgtcgcgcca ggaccagcag gtgaagcact gtcgtcagtc ccggggccca ggcgggcccg
      361 gcagctttga gctctggcag gtgcaatgtg cccagagctt ccaggccggg caccactact
      421 gggaggtgcg cgcgtcagac cactcggtga cactgggcgt ctcctacccg caactgccac
      481 ggtgcaggct ggggccccac acagacaaca ttggccgggg accctgctcc tgggggctct
      541 gcgtccagga ggacagcctc caggcctggc acaacgggga agcccagcgc ctcccagggg
      601 tgtcagggcg gctcctgggc atggatttgg acctggcctc aggctgcctc accttctaca
      661 gcctggagcc ccagacccag cccctgtaca ccttccatgc cctcttcaac cagcccctca
      721 cccccgtctt ctggctcctc gagggtagga ccctgaccct gtgccatcag ccaggggctg
      781 tgttccctcc ggggccccag gaagaggtgc tcagctgaag aaggcatggg atggagccct
      841 ggcatagctg ccaccatgcc tatgtgccaa gagctgccca gcttcagctt ggggactgga
      901 ggaccagctg ttggcctctc tgttaactca gaaagagatg ggaggttggg ggaggtgagc
      961 ataaacgcag agttcactgt tgcagccttt ttgaagggga cacagtctag gagggggata
     1021 aatgggatgc ccttgcccca gagagaaccc agttctaggt actgtctggg cctgggaggc
     1081 gagagcagtg cccaggggac ttctgggctt acaggacagc gtgtgtgaca aaattcagat
     1141 ctacctgaac ttgcctctgg agatgataag ggccaaagga gcagtcaggg aggggcggtg
     1201 agccagagta gtcccagggg gagacagatt cctccctcct ccccgcctgc agctctcttt
     1261 aattttttgt aacatttgga gagacgtccg tcctgtcttg tagtcttttt attttgtgca
     1321 tccttataat tgtattctac aaacaatttt gttttctgca tttaaacatt tttgtgtttt
     1381 taggagatgg tcttgctctg tcactcaggc tggggtacag tggcgcaatc atggctcact
     1441 gcagcctcga gctcctgggc tcaagggatc ctcccacctc agcctccaga gtagctcaga
     1501 ttacagtgtt ttctgaagtt tcctgactta acataagcat ttttcacatg attgaaaatt
     1561 ttcactgatt gctgtagtca ttctaatgac tatcaagttt atttatccat tattggacat
     1621 ttaaatttct ttctttttag ctatacaaac attgatgtgt tttttttgag acaggatctc
     1681 catctgtcac ccaggctggt gtgcaggggt gcggtcatgg gctcatggga ttctcctgcc
     1741 tcggcctcct gagtagctgg gattacaggt gtatgccacc acgcctggct tatgatgaat
     1801 atttctgagt gggatgtttg gccacattta tggtcatgta tgtaggctgt tacctcaagt
     1861 gagtcactca gagaacaatg agcacttgaa gattttttta tacaaaaggc cacagtgagg
     1921 ccaccttgag tcaagccgac taaggcccct caaccctgtc actaagcagc acgtgacact
     1981 ggcaggacct tcatctccag catcccaccc ctgggtgtgg gactttgggg cagccgtgtg
     2041 tgcaggtgtc ggcacaggct agctcctcct ggtttggtgt ggtgtttgcc attgcagagc
     2101 aagctgccac gaagacccct gggcatgatt ttgcttgtat ttccggaagt ggggttgctg
     2161 ggtcataggg caggtgtaat tttttttact tgaaatgttc cacttcttgt tctgggaggt
     2221 ggttccaagg gtgtctgctt ttggccaggc gcagtggctc acgcttgtaa tcccagcact
     2281 ttgggaggcc gaggcaggcg gatcacaagg tcaggagttc gagaccagcc tggccaacaa
     2341 ggcaaaaccc cgtctctact aaaaatacaa aaattagccg ggcatggtgg tgtgcgcctg
     2401 taatcccagc tactggggag gctgaggcgg aagaatcgct tgaacccagg aggtgaggtt
     2461 gcagtgagct gagattgcgc cactggacta cagcctgggt gacagagcga gactccgtct
     2521 caaaaaaaaa aaaaaaaagg gagggctgtc tgctttttgt aacttgaaaa actggacatc
     2581 tatgttatat gtactcatgg ataaatattt cacaataaaa ctttttaaaa ggaaaaaaaa
     2641 aaaaaaaaaa
//