LOCUS       BC071636                2476 bp    mRNA    linear   HUM 18-AUG-2005
DEFINITION  Homo sapiens transmembrane protein 68, mRNA (cDNA clone MGC:87778
            IMAGE:5193338), complete cds.
ACCESSION   BC071636
VERSION     BC071636.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2476)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 2476)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (01-JUN-2004) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: Life Technologies, Inc.
            cDNA Library Preparation: Life Technologies, Inc.
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Sequencing Group at the Stanford Human Genome
            Center, Stanford University School of Medicine, Stanford, CA  94305
            Web site:       http://www-shgc.stanford.edu
            Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
            Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
            R. M.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAK Plate: 166 Row: i Column: 22
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 22748882.
FEATURES             Location/Qualifiers
     source          1..2476
                     /db_xref="H-InvDB:HIT000264464"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:87778 IMAGE:5193338"
                     /tissue_type="Brain, adult, 6 pooled whole brains"
                     /clone_lib="NIH_MGC_114"
                     /lab_host="DH10B"
                     /note="Vector: pCMV-SPORT6"
     gene            1..2476
                     /gene="TMEM68"
                     /gene_synonym="FLJ32370"
                     /db_xref="GeneID:137695"
     CDS             214..621
                     /gene="TMEM68"
                     /gene_synonym="FLJ32370"
                     /codon_start=1
                     /product="TMEM68 protein"
                     /protein_id="AAH71636.1"
                     /db_xref="GeneID:137695"
                     /translation="MIDKNQTCGVGQDSVPYMICLIHILEEWFGVEQLEDYLNFANYL
                     LWVFTPLILLILPYFTIFLLYLTIIFLHIYKRKNVLKEAYSHNLWDGARKTVATLWDG
                     HAAVWHGKQGYFHLCVAIHVCCIGTVLPFHFID"
BASE COUNT          831 a          382 c          464 g          799 t
ORIGIN      
        1 ggcttctttc acacgggttg cttcggagga atccgccgtg caaatctgtc cgcccccttg
       61 gccactgatc ccccgaagag cttctgtcgc cgctctagga atacagacat tgaagtttgg
      121 gacaagatat ttatctaact tctgtgtcaa aattagcgac ctgctatggc aatgaagaaa
      181 gaaactgaat ttgtcatttt cacctgaaga aaaatgatag acaaaaatca aacctgtggt
      241 gtaggacagg attctgtgcc ctatatgatt tgtctgattc acatactcga agaatggttt
      301 ggtgtggagc agttggagga ctatttgaat tttgcaaact atctcttgtg ggtttttaca
      361 ccactaatac ttttaatact tccttacttt actatctttc ttctctacct tactattatt
      421 ttcttacaca tttataagag aaagaatgta ttgaaagaag cctactctca taatttatgg
      481 gatggtgcaa ggaaaacagt ggcaactctg tgggatggac atgcagccgt ttggcatggt
      541 aagcaaggat actttcacct ttgtgttgcc attcatgtgt gctgcattgg aactgtgtta
      601 ccattccatt ttattgattg agaagatact gaaaaatata atagaagtga tatttactat
      661 tccctgttac ctgtttgcat gcattgtgca tatgtatgtg tctttcttaa aatgagtttt
      721 cccatagacg ttggtttcca ttaaacaaag aaccacgcag cactgtagac tataagttga
      781 aataagaaaa tttatattta aaacatctaa aagagtaaga gactaaataa agctgtagaa
      841 aactgcttta aaaatgcttc aattatttag catttacttc tgttcaaaat aagtttgact
      901 ctaccagtgt ggatttaaaa aaatgaaata ttaaataata ttacattaaa tataatttgc
      961 ataccaaaat ttatgcattt tctgttgatt cattcctgag gttggtgtgt ctttctgaat
     1021 aaataagata gcaatagatt tctctccagg atagtcattc ttttctttat tactcgagaa
     1081 attttgatgt tgtatactta atgattggtg gttcttcttt gtttggccat catgaaaatt
     1141 gccttctggt ggcctatttt taagtggtta gtgtttcact ctaccaactt ttacttcatt
     1201 attccaacaa tatctagttt gttggtctct tttgttttta gactacacaa aaatactgaa
     1261 gattcaatag gcaggtaaca aacattggct ttctgtatta tgttgttgag catcacagtg
     1321 gtttcataga aggacatgga aggaagcaca gactttaaaa gacacttgag gatatatatc
     1381 actgaactat taggctgcta ttagcagaaa tcaccagtga catgcttatt agactaatgt
     1441 attttcattt taatactaca tacatactta acgaacctac aaattttttt tgagcaccta
     1501 cctatgccag acactgtcaa ttgcttaata taaattaact gctttaaatc tcattaacat
     1561 aatggagtct atgtggtacc ccgattatac tcatgaggaa actgaggcac agagaggttg
     1621 ttatttgccc aaggtatact aggaataggg ccaggttaca accccagata cctgggagta
     1681 tacatttgag agagctcttg gaggtaaaat aaacagaact tggggactga gtgtagagtc
     1741 ttgagggagg aggagttaaa gtccagtaag atttctactg ctagacaggg aaacatgaac
     1801 tggaagtgct ccaagtaata gcaaccatgt gagcagaagc acaaaggtgg aaaagtactc
     1861 tgggagccac agttagttca tatgatacat gaaataatgt aatgtcactt tataggcaat
     1921 tggggcctca aggggcttga aaatgttgga ctagagtggt aatgcactga tactttctca
     1981 gcagggagta gtatgatcac atctgcttta agagtgacac agttaaatag ccctaggttt
     2041 taaggtttac tggcactata gtaaactatt ttttttaaat atttgattag ttggattttt
     2101 ctgctttcaa ccaggtggtt tggtattatg tgagtagttc aattgtttat tatttaaaaa
     2161 aatactctgt aaaaccagag agaaccttgg taatattctg tatagaatcc ttcaaaggag
     2221 tttctttaat gctcagaaaa tgtatttgat gggacagttg atcctcaaac tcagtgactg
     2281 ttttgtagag cttaaagtaa attgaattac ttgagttaga attatgtaat tggaaagaaa
     2341 tgatataata tggaaacata caaaatcttg gaatatcatt aaattatttt tcaaaacatt
     2401 aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa
     2461 aaaaaaaaaa aaaaaa
//