LOCUS       BC069019                2015 bp    mRNA    linear   HUM 03-AUG-2004
DEFINITION  Homo sapiens zinc and ring finger 3, mRNA (cDNA clone
            IMAGE:3530674), partial cds.
ACCESSION   BC069019
VERSION     BC069019.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2015)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 2015)
  AUTHORS   Director MGC Project.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-APR-2004) National Institutes of Health, Mammalian
            Gene Collection (MGC), Cancer Genomics Office, National Cancer
            Institute, 31 Center Drive, Room 11A03, Bethesda, MD 20892-2590,
            USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC
            cDNA Library Preparation: Rubin Laboratory
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Genome Sequence Centre,
            BC Cancer Agency, Vancouver, BC, Canada
            info@bcgsc.bc.ca
            Steve Jones, Sarah Barber, Mabel Brown-John, Yaron Butterfield,
            Andy Chan, Steve S. Chand, William Chow, Alison Cloutier, Ruth
            Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
            Kim MacDonald, Amara Masson, Mike R. Mayo, Josh Moran, Ryan Morin,
            Teika Olson, Diana Palmquist, Anca Petrescu, Anna Liisa Prahbu,
            Parvaneh Saeedi, JR Santos, Angelique Schnerch, Ursula Skalska,
            Duane Smailus, Jeff Stott, Miranda Tsai, George Yang, Jacquie
            Schein, Asim Siddiqui, Rob Holt, Marco Marra.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 54 Row: a Column: 15
            This clone was selected for full length sequencing because it
            passed the following selection criteria: Similarity but not
            identity to protein.
FEATURES             Location/Qualifiers
     source          1..2015
                     /db_xref="H-InvDB:HIT000263202"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="IMAGE:3530674"
                     /tissue_type="Muscle, rhabdomyosarcoma"
                     /clone_lib="NIH_MGC_17"
                     /lab_host="DH10B-R"
                     /note="Vector: pOTB7"
     gene            <1..2015
                     /gene="ZNRF3"
                     /gene_synonym="BK747E2.3"
                     /gene_synonym="FLJ12747"
                     /gene_synonym="FLJ22057"
                     /gene_synonym="KIAA1133"
                     /db_xref="GeneID:84133"
     CDS             <1..1934
                     /gene="ZNRF3"
                     /gene_synonym="BK747E2.3"
                     /gene_synonym="FLJ12747"
                     /gene_synonym="FLJ22057"
                     /gene_synonym="KIAA1133"
                     /codon_start=3
                     /product="ZNRF3 protein"
                     /protein_id="AAH69019.1"
                     /db_xref="GeneID:84133"
                     /translation="AICLEKYIDGEELRVIPCTHRFHRKCVDPWLLQHHTCPHCRHNI
                     IEQKGNPSAVCVETSNLSRGRQQRVTLPVHYPGRVHRTNAIPAYPTRTSMDSHGNPVT
                     LLTMDRHGEQSLYSPQTPAYIRSYPPLHLDHSLAAHRCGLEHRAYSPAHPFRRPKLSG
                     RSFSKAACFSQYETMYQHYYFQGLSYPEQEGQSPPSLAPRGPARAFPPSGSGSLLFPT
                     VVHVAPPSHLESGSTSSFSCYHGHRSVCSGYLADCPGSDSSSSSSSGQCHCSSSDSVV
                     DCTEVSNQGVYGSCSTFRSSLSSDYDPFIYRSRSPCRASEAGGSGSSGRGPALCFEGS
                     PPPEELPAVHSHGAGRGEPWPGPASPSGDQVSTCSLEMNYSSNSSLEHRGPNSSTSEV
                     GLEASPGAAPDLRRTWKGGHELPSCACCCEPQPSPAGPSAGAAGSSTLFLGPHLYEGS
                     GPAGGEPQSGSSQGLYGLHPDHLPRTDGVKYEGLPCCFYEEKQVARGGGGGSGCYTED
                     YSVSVQYTLTEEPPPGCYPGARDLSQRIPIIPEDVDCDLGLPSDCQGTHSLGSWGGTR
                     GPDTPRPHRGLGATREEERALCCQARALLRPGCPPEEAGAVRANFPSALQDTQESSTT
                     ATEAAGPRSHSADSSSPGA"
BASE COUNT          372 a          711 c          616 g          316 t
ORIGIN      
        1 gtgccatctg tctggagaag tacattgatg gagaggagct gcgggtcatc ccctgtactc
       61 accggtttca caggaagtgc gtggacccct ggctgctgca gcaccacacc tgcccccact
      121 gtcggcacaa catcatagaa caaaagggaa acccaagcgc ggtgtgtgtg gagaccagca
      181 acctctcacg tggtcggcag cagagggtga ccctgccggt gcattacccc ggccgcgtgc
      241 acaggaccaa cgccatccca gcctacccta cgaggacaag catggactcc cacggcaacc
      301 ccgtcacctt gctgaccatg gaccggcacg gggagcagag cctctattcc ccgcagaccc
      361 ccgcctacat ccgcagctac ccacccctcc acctggacca cagcctggcc gctcaccgct
      421 gcggcctgga gcaccgggcc tactccccag cccacccctt ccgcaggccc aagttgagtg
      481 gccgcagctt ctccaaggca gcttgcttct cccagtatga gaccatgtac cagcactact
      541 acttccaggg cctcagctac ccggagcagg aggggcagtc cccacctagc ctcgcacccc
      601 ggggcccggc ccgtgccttt cctccgagcg gcagtggcag cctgctcttc cccaccgtgg
      661 tgcacgtggc cccgccctcc cacctggaga gcggcagcac gtccagcttc agctgctatc
      721 acggccaccg ctcggtgtgc agtggctacc tggccgactg cccaggcagc gacagcagca
      781 gcagcagcag ctccggccag tgccactgtt cctccagtga ctctgtggta gactgcactg
      841 aggtcagcaa ccagggcgtg tacgggagct gctccacctt ccgcagctcc ctcagcagcg
      901 actatgaccc cttcatctac cgcagccgga gcccctgtcg tgccagtgag gcggggggct
      961 cgggcagctc gggccgggga cctgccctgt gcttcgaggg ctccccgcct cccgaggagc
     1021 tcccggcggt gcacagtcat ggtgctgggc ggggcgagcc ttggccgggc cctgcctctc
     1081 cctcggggga tcaggtgtcc acctgcagcc tggagatgaa ctacagcagc aactcctccc
     1141 tggagcacag ggggcccaat agctctacct cagaagtggg gctcgaggct tctcctgggg
     1201 ccgcccctga cctcaggagg acctggaagg ggggccacga gttgccgtcg tgtgcctgct
     1261 gctgcgagcc ccagccctcc ccagccgggc ctagcgccgg agcagctggc agcagcacct
     1321 tgttcctggg gccccacctc tacgagggct ctggcccggc gggtggggag ccccagtcag
     1381 gaagctccca gggcttgtac ggccttcacc ccgaccattt gcccaggaca gatggggtga
     1441 aatacgaggg tctgccctgc tgcttctatg aagagaagca ggtggcccgc gggggcggag
     1501 ggggcagcgg ctgctacact gaggactact cggtgagtgt gcagtacacg ctcaccgagg
     1561 aacccccgcc cggctgctac cccggggccc gggacctgag ccagcgcatc cccatcattc
     1621 cagaggatgt ggactgtgat ctgggcctac cctcggactg ccaagggacc cacagcctcg
     1681 gctcctgggg tgggacgcga ggcccggata ccccacggcc ccacaggggc ctgggagcaa
     1741 cccgggaaga ggagcgggct ctgtgctgcc aggctagggc cctactgcgg cctggctgcc
     1801 ctccggagga ggcgggtgct gtcagggcca acttccctag tgccctccag gacactcagg
     1861 agtccagcac cactgccact gaggctgcag gaccgagatc tcactcagca gacagcagca
     1921 gcccgggagc ctgagctcag gaggaactct tacctggaaa ttgggaactg tatggagact
     1981 ccaaactgac ttctttcaaa aaaaaaaaaa aaaaa
//