LOCUS       BC068078                 950 bp    mRNA    linear   HUM 03-AUG-2004
DEFINITION  Homo sapiens nucleophosmin/nucleoplasmin, 2, mRNA (cDNA clone
            MGC:78655 IMAGE:6087597), complete cds.
ACCESSION   BC068078
VERSION     BC068078.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 950)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 950)
  AUTHORS   Director MGC Project.
  TITLE     Direct Submission
  JOURNAL   Submitted (24-MAR-2004) National Institutes of Health, Mammalian
            Gene Collection (MGC), Cancer Genomics Office, National Cancer
            Institute, 31 Center Drive, Room 11A03, Bethesda, MD 20892-2590,
            USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: DCTD/DTP
            cDNA Library Preparation: Rubin Laboratory
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Genome Sequence Centre,
            BC Cancer Agency, Vancouver, BC, Canada
            info@bcgsc.bc.ca
            Steve Jones, Sarah Barber, Mabel Brown-John, Yaron Butterfield,
            Andy Chan, Steve S. Chand, William Chow, Alison Cloutier, Ruth
            Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
            Kim MacDonald, Amara Masson, Mike R. Mayo, Josh Moran, Ryan Morin,
            Teika Olson, Diana Palmquist, Anca Petrescu, Anna Liisa Prahbu,
            Parvaneh Saeedi, JR Santos, Angelique Schnerch, Ursula Skalska,
            Duane Smailus, Jeff Stott, Miranda Tsai, George Yang, Jacquie
            Schein, Asim Siddiqui, Rob Holt, Marco Marra.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 54 Row: h Column: 6
            This clone was selected for full length sequencing because it
            passed the following selection criteria: Hexamer frequency ORF
            analysis.
FEATURES             Location/Qualifiers
     source          1..950
                     /db_xref="H-InvDB:HIT000262937"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:78655 IMAGE:6087597"
                     /tissue_type="Skin, melanoma, melanotic"
                     /clone_lib="NIH_MGC_112"
                     /lab_host="DH10B-R"
                     /note="Vector: pOTB7"
     gene            1..950
                     /gene="NPM2"
                     /db_xref="GeneID:10361"
                     /db_xref="MIM:608073"
     CDS             233..643
                     /gene="NPM2"
                     /codon_start=1
                     /product="NPM2 protein"
                     /protein_id="AAH68078.1"
                     /db_xref="GeneID:10361"
                     /db_xref="MIM:608073"
                     /translation="MNLSSASSTEEKAVTTVLWGCELSQERRTWTFRPQLEGKQSCRL
                     LLHTICLGEKAKEEMHRVEILPPANQEDKKMQPVTIASLQASVLPMVSMVGVQLSPPV
                     TFQLRAGSGPVFLSGQERYEKKAGKRRRGNKSQR"
BASE COUNT          230 a          285 c          279 g          156 t
ORIGIN      
        1 ctgggaccta agccgcgcgc acaccccttt ctctgcgtct ggtggaggtg cacagaggct
       61 tttgagtcag gcccaagcgc agccaggtga cctccccgcg gcctttcaag cctgagctcg
      121 gtggacagct ccctctcccg tgagtcccgc tgtcctgtac gcgcccggtc gagccccggg
      181 ctgcgcaccc cgctaggagc tgcccggcca gcccgcttct ctgcccggag ccatgaatct
      241 cagtagcgcc agtagcacgg aggaaaaggc agtgacgacc gtgctctggg gctgcgagct
      301 cagtcaggag aggcggactt ggaccttcag accccagctg gaggggaagc agagctgcag
      361 gctgttgctt catacgattt gcttggggga gaaagccaaa gaggagatgc atcgcgtgga
      421 gatcctgccc ccagcaaacc aggaggacaa gaagatgcag ccggtcacca ttgcctcact
      481 ccaggcctca gtcctcccca tggtctccat ggtaggagtg cagctttctc ccccagttac
      541 tttccagctc cgggctggct caggacccgt gttcctcagt ggccaggaac gttatgaaaa
      601 aaaagctgga aaaagaagaa gaggaaataa gagccagcgt tagagacaag agccctgtga
      661 aaaaggccaa agccacagcc agagccaaga agccaggatt caagaaatga ggagccacgc
      721 cttggggggc acggtgcaaa gtgggccttc cctgggctgt gctgcaggca cagggtgccc
      781 ctgtccagcc cctccacctg tgtctgaatg caacaggggt gttgcggggg caacatgaga
      841 gcccctcacc cccaactctc cactttcagg aggcccccag tgaagagccc cacctcgggg
      901 tcacaataaa gttgcctggt caggaaaaaa aaaaaaaaaa aaaaaaaaaa
//