LOCUS       BC065575                2975 bp    mRNA    linear   HUM 03-NOV-2008
DEFINITION  Homo sapiens tripartite motif-containing 6, mRNA (cDNA clone
            MGC:61844 IMAGE:4609084), complete cds.
ACCESSION   BC065575
VERSION     BC065575.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2975)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 2975)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (26-JAN-2004) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: CLONTECH
            cDNA Library Preparation: CLONTECH Laboratories, Inc.
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: National Institutes of Health Intramural
            Sequencing Center (NISC),
            Gaithersburg, Maryland;
            Web site: http://www.nisc.nih.gov/
            Contact: nisc_mgc@nhgri.nih.gov
            Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
            Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
            Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
            Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
            Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
            McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
            Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
            Young,A., Zhang,L.-H. and Green,E.D.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 48 Row: d Column: 9
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 51477691.
FEATURES             Location/Qualifiers
     source          1..2975
                     /db_xref="H-InvDB:HIT000261981"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:61844 IMAGE:4609084"
                     /tissue_type="Kidney"
                     /clone_lib="NIH_MGC_75"
                     /lab_host="DH10B"
                     /note="Vector: pDNR-LIB"
     gene            1..2975
                     /gene="TRIM6"
                     /gene_synonym="RNF89"
                     /db_xref="GeneID:117854"
                     /db_xref="HGNC:HGNC:16277"
                     /db_xref="MIM:607564"
     CDS             153..1340
                     /gene="TRIM6"
                     /gene_synonym="RNF89"
                     /codon_start=1
                     /product="TRIM6 protein"
                     /protein_id="AAH65575.1"
                     /db_xref="GeneID:117854"
                     /db_xref="HGNC:HGNC:16277"
                     /db_xref="MIM:607564"
                     /translation="MCGSERPWRKTAALLSGGWEGHLLACERSQEHRGHHTFLVEEVA
                     QEYQEKFQESLKKLKNEEQEAEKLTAFIREKKTSWKNQMEPERCRIQTEFNQLRNILD
                     RVEQRELKKLEQEEKKGLRIIEEAENDLVHQTQSLRELISDLERRCQGSTMELLQDVS
                     DVTERSEFWTLRKPEALPTKLRSMFRAPDLKRMLRVCRELTDVQSYWVDVTLNPHTAN
                     LNLVLAKNRRQVRFVGAKVSGPSCLEKHYDCSVLGSQHFSSGKHYWEVDVAKKTAWIL
                     GVCSNSLGPTFSFNHFAQNHSAYSRYQPQSGYWVIGLQHNHEYRAYEDSSPSLLLSMT
                     VPPRRVGVFLDYEAGTVSFYNVTNHGFPIYTFSKYYFPTTLCPYFNPCNCVIPMTLRR
                     PSS"
BASE COUNT          848 a          592 c          657 g          878 t
ORIGIN      
        1 ggggcagagt cgtgcgtggt tgagtttaga taaaagccga gtgagcgcgc tctgttcctt
       61 aagattagtt taaggtgcct tggattgctc tgaagagctt tgaccacctg atattgctta
      121 catctggaac ttcttggctt ctcattcccc agatgtgcgg gtcagagaga ccatggagaa
      181 aaactgcagc tcttctgtca ggaggatggg aaggtcattt gctggcttgt gagcggtctc
      241 aggagcaccg tggtcaccac acgttcctcg tggaggaggt tgcccaggag taccaggaga
      301 agtttcagga gtctctaaag aagctgaaga acgaggagca ggaagctgag aagctaacag
      361 cttttatcag agagaagaag acatcctgga agaatcagat ggagcctgag agatgcagga
      421 tccagacaga gtttaatcag ctgcgaaata tcctagacag agtggagcaa cgggagctga
      481 aaaagctgga acaggaagag aagaaggggc tacgaattat agaagaggct gagaatgatc
      541 tggtccacca gacccagtcg ctgcgagagc tcatctcgga tctggagcgt cgatgtcagg
      601 ggtcaacaat ggagctgctg caggatgtga gtgatgtcac agaaaggagt gagttctgga
      661 ccctgaggaa gccagaagct ctccctacaa agctgagaag tatgttccga gccccagatc
      721 tgaaaaggat gctgcgagtg tgtagagagc tgacagatgt ccaaagctac tgggttgacg
      781 tgaccctgaa tccacacaca gctaatttaa atcttgtcct ggctaaaaac cggagacaag
      841 tgaggtttgt gggagctaaa gtatctggac cttcctgtct ggaaaagcat tatgactgta
      901 gtgtcctggg ctcccagcac ttctcctctg gtaagcatta ctgggaggta gatgtggcca
      961 agaagactgc ctggatccta ggggtatgca gcaattcact gggacctaca ttctctttca
     1021 accattttgc tcaaaatcac agtgcttact ccaggtatca gcctcagagt ggatactggg
     1081 tgattgggtt acagcataac catgaatata gggcctatga ggattcttcc ccttccctgc
     1141 ttctctccat gacagtgccc cctcgccgtg ttggggtttt cttagattat gaggctggta
     1201 ctgtctcctt ttataatgtc acaaaccatg gcttccccat ctacactttc tctaaatatt
     1261 actttcccac tactctttgt ccatatttta atccttgcaa ctgtgtaatt cctatgaccc
     1321 tgcgtcgtcc aagctcttga atattcttct gttcccaccc acttctgata agtaccctga
     1381 ggcttatcag catgtgattc tcccttctga tcttctgttt ttctgtgttc tcaattcttt
     1441 tgttgtttct tggtttttga atcttttttg agatggaatc tcgctctgtc gcccaggctg
     1501 gagtgcactg gcgcaatctc ggctcactgc aacctctgcc tcctgggttc aagcgaacct
     1561 cctgcctcag catcccaagt agctgggatt acaggcaccc accaccatgc ccaactaatt
     1621 tttgtatttt tatagagata gggtttcacc gtgttggcca ggctgatctc gaactcctga
     1681 ccgcaagtga tccacccgcc tcggtctccc aaagtgctgg gattacagat gtgagccgcc
     1741 gcgcccagac agttctttcg ttttaaacag ttactcagta ctaggatgca cccagtggtg
     1801 agagtaagca tctttgactg atgacaggtc ttgaggtgga tagggggcgc tttcagtatt
     1861 ttgccattaa gcatagtatt tgatgcaggt tttttttgat tgatgcaggg gatcaaattt
     1921 aggaagttct gatctgttaa tttactacaa gtttttgtat aaaatgaaaa ctcgtattct
     1981 acctatgtct tttctgtaaa ttattgagac aattgtgtat catttttgtt ctgttaatgt
     2041 ggcttagtac attgatttac ttcaatttgt taccacaact tgctgaaata caccattatt
     2101 atttgttgta tgcaatactg gatttatttt gataacgtat tgtttagatt ttgttctcat
     2161 ctatgttaat gaaagaaatt ggcctgtatt tttacattct tgtaatatct ttgccaggtt
     2221 ctataaaatg caataataag caaataaatt actttgtttt tgtataagta tgtataggat
     2281 tgagctctaa aaccaaacca ttataatgat aatttgggta gcttcaaact caaattgaag
     2341 agagtcttca ctacaatctt cactacaacc tttggccttc ctctctacat ttaagagtag
     2401 caatagaaca ataaaaaaaa atacgtcttt caaattaatt gcagtaaaaa caaaagagta
     2461 gtggggagag aaaaacaatc caatacatat ttttctctca gaatagaaag aaaacacaaa
     2521 gagaaaatat gaacaatata aagcacttaa aggaagagga tgatttcttc cagcttttcc
     2581 acactctctt tatgcgcagg aacaaacagc tgttgagtga gctgctatga ctttggtaga
     2641 gaggtgcaat atgttttttg aaccagctat aaaagaaatt aagaggtaca tgtgagggta
     2701 gaaacaaata tcaaggatga gaatggcact ggctgtccca tatggtatcc aggagccacc
     2761 aatgtctgtt gagtacttca tacatgccta gtctgaattg agatgtgctc aatgtataaa
     2821 atatatacca gatttcaaat acctacttca aaaaataatg taaaatatct cactaataac
     2881 ttttcctttg tgtattgcaa tgataatatg ttggctctat tggattaaat aaagtatgtt
     2941 attcatttta aaaaaaaaaa aaaaaaaaaa aaaaa
//