LOCUS       BC063842                2840 bp    mRNA    linear   HUM 15-JUL-2006
DEFINITION  Homo sapiens thrombospondin, type I, domain containing 1, mRNA
            (cDNA clone MGC:74971 IMAGE:6181100), complete cds.
ACCESSION   BC063842
VERSION     BC063842.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2840)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 2840)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (08-DEC-2003) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: Dr. James R. Lupski
            cDNA Library Preparation: Life Technologies, Inc.
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Genome Sequence Centre,
            BC Cancer Agency, Vancouver, BC, Canada
            info@bcgsc.bc.ca
            Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
            Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
            Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
            Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
            Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
            Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
            Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
            Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
            Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAK Plate: 141 Row: b Column: 3
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 40805851.
FEATURES             Location/Qualifiers
     source          1..2840
                     /db_xref="H-InvDB:HIT000261218"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:74971 IMAGE:6181100"
                     /tissue_type="Peripheral Nervous System, dorsal root
                     ganglion"
                     /clone_lib="Lupski_dorsal_root_ganglion"
                     /lab_host="DH10B"
                     /note="Vector: pCMV-SPORT6"
     gene            1..2840
                     /gene="THSD1"
                     /gene_synonym="MGC74971"
                     /gene_synonym="TMTSP"
                     /gene_synonym="UNQ3010"
                     /db_xref="GeneID:55901"
                     /db_xref="HGNC:HGNC:17754"
     CDS             179..2578
                     /gene="THSD1"
                     /gene_synonym="MGC74971"
                     /gene_synonym="TMTSP"
                     /gene_synonym="UNQ3010"
                     /codon_start=1
                     /product="thrombospondin, type I, domain containing 1"
                     /protein_id="AAH63842.1"
                     /db_xref="GeneID:55901"
                     /db_xref="HGNC:HGNC:17754"
                     /translation="MKPMLKDFSNLLLVVLCDYVLGEAEYLLLREPGHVALSNDTVYV
                     DFQYFDGANGTLRNVSVLLLEANTNQTVTTKYLLTNQSQGTLKFECFYFKEAGDYWFT
                     MTPEATDNSTPFPWWEKSAFLKVEWPVFHVDLNRSAKAAEGTFQVGLFTSQPLCPFPV
                     DKPNIVVDVIFTNSLPEARRNSRQPLEIRTSKRTELAQGQWVEFGCAPLGPEAYVTVV
                     LKLLGRDSVITSTGPIDLAQKFGYKLVMVPELTCESGVEVTVLPPPCTFVQGVVTVFK
                     EAPRYPGKRTIHLAENSLPLGERRTIFNCTLFDMGKNKYCFDFGISSRSHFSAKEECM
                     LIQRNTAFQPSSPSPLQPQGPVKSNNIVTVTGISLCLFIIIATVLITLWRRFGRPAKC
                     STPARHNSIHSPSFRKNSDEENICELSEQRGSFSDGGDGPTGSPGDTGIPLTYRRSGP
                     VPPEDDASGSESFQSNAQKIIPPLFSYRLAQQQLKEMKKKGLTETTKVYHVSQSPLTD
                     TAIDAAPSAPLDLESPEEAAANKFRIKSPFPEQPAVSAGERPPSRLDLNVTQASCAIS
                     PSQTLIRKSQARHVGSRGGPSERSHARNAHFRRTASFHEARQARPFRERSMSTLTPRQ
                     APAYSSRTRTCEQAEDRFRPQSRGAHLFPEKLEHFQEASGTRGPLNPLPKSYTLGQPL
                     RKPDLGDHQAGLVAGIERTEPHRARRGPSPSHKSVSRKQSSPISPKDNYQRVSSLSPS
                     QCRKDKCQSFPTHPEFAFYDNTSFGLTEAEQRMLDLPGYFGSNEEDETTSTLSVEKLV
                     I"
BASE COUNT          746 a          729 c          743 g          622 t
ORIGIN      
        1 gcgggatgct tggcgctcta cctcgccgcc cctgagcctt cccgtccgcc tcgccacgcg
       61 cccggacggc ctggggttgc tgcccgtcag tctcgaggtg tttttgggga aaaaaatcac
      121 aatctggacg tgagaaagga catgaggaga ctaaagacct gggattttgt caatcagaat
      181 gaaaccaatg ttgaaagact tttcaaatct attgttggtg gtactctgtg actatgttct
      241 tggagaagct gaatatcttc tcttgagaga gccaggccat gtagcactaa gcaacgacac
      301 agtgtatgtg gatttccagt attttgatgg tgctaatggg acactgagga atgtatctgt
      361 cctgctgttg gaggccaaca ccaatcagac tgtaactacc aagtacctcc tgaccaacca
      421 gtcccaggga acactaaagt ttgagtgctt ctatttcaag gaggctggtg actactggtt
      481 cacaatgact ccagaagcaa cagacaacag cactccattc ccctggtggg agaaaagtgc
      541 ctttctgaag gtggaatggc ctgtctttca cgttgacttg aataggagtg ccaaggcagc
      601 agaaggcacc ttccaagtgg gcctatttac cagtcaacca ctgtgcccgt ttcctgtgga
      661 caagcccaac atcgtagtgg atgtcatctt caccaacagt cttcctgagg caagaagaaa
      721 ttcaagacag ccgctggaaa taagaaccag caaaaggaca gaacttgctc aaggtcagtg
      781 ggttgagttt ggctgtgcac ccttggggcc agaagcctat gtcaccgtgg tgctgaagct
      841 gcttgggcga gactcagtca ttacctccac aggacccatt gacctggccc agaaatttgg
      901 atacaaactg gtgatggtgc cagaactcac atgtgagtcc ggggtagagg tgacagtgct
      961 gcctccacca tgcaccttcg tccaaggagt ggtcactgtc ttcaaggagg cccccagata
     1021 ccctgggaag aggaccattc acttggctga aaacagcctg cccctgggag agaggaggac
     1081 aatttttaac tgtactttgt ttgacatggg gaagaataag tactgctttg actttggcat
     1141 ttcaagcaga agccattttt ctgcaaagga ggagtgcatg ctaattcaga gaaatacagc
     1201 tttccagcca tccagcccat ctcctcttca gccccagggt ccagtgaagt ccaacaacat
     1261 cgtgactgtc actggtatat ccttgtgctt gttcatcatc attgccactg tgctcatcac
     1321 gctgtggagg aggttcggcc ggccagccaa gtgcagcaca cctgctcgac acaactccat
     1381 ccactccccc agcttccgga agaactcgga cgaggagaat atctgcgagc tgagcgagca
     1441 gcgcgggagc ttctcggatg ggggagacgg gcccacgggg agtccagggg acacaggcat
     1501 ccctctgacc tacaggcgga gcgggccggt acctcccgag gatgatgcct ctggcagcga
     1561 gagcttccag tccaacgccc agaagataat cccacctctg ttcagctacc gccttgccca
     1621 gcagcagtta aaggagatga aaaagaaagg tctgacggaa actaccaaag tgtatcacgt
     1681 gtctcagagt cccctgacag acactgccat tgatgcggcc cccagcgctc ccttagattt
     1741 ggaaagcccg gaagaagctg cagcaaacaa gttccggatc aaatccccat ttccggagca
     1801 gcccgcggtc agtgccgggg aaaggcctcc ctccaggctg gatctaaatg tgactcaggc
     1861 cagttgtgcc ataagcccca gccagactct gatccgcaag tcacaggcaa ggcacgtggg
     1921 cagcagaggg ggcccgtccg aaaggagcca tgccaggaac gcccatttca ggaggacagc
     1981 gagtttccat gaagccaggc aggcccggcc gttccgagag aggagcatgt ccactctgac
     2041 tccacggcag gcccctgcct acagctctag gacgcggacc tgcgagcagg cagaggacag
     2101 atttaggcct cagagtcgag gtgcccacct gtttcctgaa aaactggagc atttccaaga
     2161 ggcaagtgga acccgtggtc cattaaaccc tctccctaaa tcctacactt tggggcagcc
     2221 cttgaggaaa ccagaccttg gggatcacca ggcaggatta gtggccggaa ttgagagaac
     2281 agagccccac agagctcgtc ggggaccgtc ccccagtcac aagagtgtct caaggaagca
     2341 gtcttctccc atatccccca aagataacta ccagagggtc agttctctga gcccttctca
     2401 gtgtagaaaa gacaagtgtc aaagcttccc cactcaccct gagtttgcct tctatgacaa
     2461 tacgtcgttt ggcctcactg aggctgagca gaggatgctg gacctcccag gatattttgg
     2521 gtcaaatgaa gaggatgaaa ccacaagtac acttagcgtg gagaagctgg tgatctagac
     2581 tgagaatcag cctgagcttt acacagctgg ggtctgctac tcgcgttttg tagacttttg
     2641 tgtaactatt tgtaccgtag gacagaatgt gaggaggaag taacacacag aggaggatgt
     2701 gtgtgtatgc atgtgtttga attcacaagg aagaaattat ttatcttgag ctttttcctt
     2761 tgttattcaa tttctattga tttattagta ataacaatga taataaaatg taaatgagca
     2821 aaaaaaaaaa aaaaaaaaaa
//