LOCUS       BC063136                2068 bp    mRNA    linear   HUM 30-MAR-2005
DEFINITION  Homo sapiens nebulin, mRNA (cDNA clone IMAGE:4272057), partial cds.
ACCESSION   BC063136
VERSION     BC063136.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2068)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 2068)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (02-DEC-2003) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: CLONTECH
            cDNA Library Preparation: CLONTECH Laboratories, Inc.
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Genome Sequence Centre,
            BC Cancer Agency, Vancouver, BC, Canada
            info@bcgsc.bc.ca
            Steve Jones, Sarah Barber, Mabel Brown-John, Yaron Butterfield,
            Andy Chan, Steve S. Chand, William Chow, Alison Cloutier, Ruth
            Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
            Kim MacDonald, Amara Masson, Mike R. Mayo, Josh Moran, Ryan Morin,
            Teika Olson, Diana Palmquist, Anca Petrescu, Anna Liisa Prahbu,
            Parvaneh Saeedi, JR Santos, Angelique Schnerch, Ursula Skalska,
            Duane Smailus, Jeff Stott, Miranda Tsai, George Yang, Jacquie
            Schein, Asim Siddiqui, Rob Holt, Marco Marra.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 51 Row: f Column: 22
            This clone was selected for full length sequencing because it
            passed the following selection criteria: Hexamer frequency ORF
            analysis.
FEATURES             Location/Qualifiers
     source          1..2068
                     /db_xref="H-InvDB:HIT000260783"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="IMAGE:4272057"
                     /tissue_type="Skeletal Muscle"
                     /clone_lib="NIH_MGC_81"
                     /lab_host="DH10B"
                     /note="Vector: pDNR-LIB"
     gene            <1..2068
                     /gene="NEB"
                     /gene_synonym="NEM2"
                     /db_xref="GeneID:4703"
                     /db_xref="MIM:161650"
     CDS             <1..1619
                     /gene="NEB"
                     /gene_synonym="NEM2"
                     /codon_start=3
                     /product="NEB protein"
                     /protein_id="AAH63136.1"
                     /db_xref="GeneID:4703"
                     /db_xref="MIM:161650"
                     /translation="ATTVTPEIERVKRNQENFSSVLYKENLGKGIPTPITPEMERVKR
                     NQENFSSVLYKENLGTGIPIPITPEMQRVKHNQENLSSVLYKENMGKGTPLPVTPEME
                     RVKHNQENISSVLYKENMGKGTPLPVTPEMERVKHNQENISSVLYKENMGKGTPLPVT
                     PEMERVKHNQENISSVLYKENVGKATATPVTPEMQRVKRNQENISSVLYKENLGKATP
                     TPFTPEMERVKRNQENFSSVLYKENMRKATPTPVTPEMERAKRNQENISSVLYSDSFR
                     KQIQGKAAYVLDTPEMRRVRETQRHISTVKYHEDFEKHKGCFTPVVTDPITERVKKNM
                     QDFSDINYRGIQRKVVEMEQKRNDQDQETITGLRVWRTNPGSVFDYDPAEDNIQSRSL
                     HMINVQAQRRSREQSRSASALSISGGEEKSEHSEAPDHHLSTYSDGGVFAVSTAYKHA
                     KTTELPQQRSSSVATQQTTVSSIPSHPSTAGKIFRAMYDYMAADADEVSFKDGDAIIN
                     VQAIDEGWMYGTVQRTGRTGMLPANYVEAI"
BASE COUNT          701 a          451 c          432 g          484 t
ORIGIN      
        1 gggcaaccac tgtgactcca gagattgaga gagtcaaacg caatcaagag aactttagct
       61 cggttttgta caaagaaaat ttggggaaag gaatcccaac acctatcact ccagagatgg
      121 agagagtcaa acgcaatcaa gagaacttta gctcggtgct atacaaagaa aacctgggga
      181 caggaattcc aatccccatc actcctgaga tgcagagagt caaacacaat caagaaaacc
      241 ttagctcggt gttatacaaa gaaaacatgg gcaagggaac ccctttacct gtcactcccg
      301 agatggaaag agtcaaacac aatcaagaaa atattagctc ggtgttatac aaagaaaaca
      361 tgggcaaggg aacccctcta cctgtcactc ctgagatgga gagagtcaaa cacaatcaag
      421 aaaatattag ctcggtgtta tacaaagaaa acatgggcaa gggaactcct ttacctgtca
      481 ctcccgagat ggagcgagtc aaacacaatc aagaaaatat tagctcggtt ttgtacaaag
      541 aaaatgtggg gaaagccacc gcaacccctg tcactcctga gatgcagaga gtcaaacgca
      601 atcaagaaaa cattagctcg gtgttataca aagagaacct ggggaaagca acccccacac
      661 cctttactcc tgagatggaa agagtgaaac gcaatcaaga aaactttagc tcggtattgt
      721 acaaagagaa catgagaaaa gcaactccga cacctgttac tccagagatg gagagagcta
      781 agcgcaacca agaaaacatt agctcggttc tttattctga tagtttccgg aaacaaatac
      841 aaggcaaagc tgcctatgta ttggataccc ccgagatgag acgggtgagg gagacccaac
      901 ggcacatctc aacggtgaaa tatcatgaag actttgagaa acacaagggt tgcttcacac
      961 cagtggtgac agatcctatc actgaacgag taaagaagaa catgcaggac ttcagtgaca
     1021 ttaactaccg aggtattcag aggaaagtgg tagaaatgga acaaaaacgg aatgaccaag
     1081 atcaggagac tattacaggt ttacgtgtct ggcgtactaa tcctggttcg gtttttgact
     1141 atgatccagc agaagacaac atccagtccc gaagcttaca catgattaat gtccaagctc
     1201 agcgccggag ccgggagcag tcacgatctg ccagtgcact aagcatcagt gggggtgagg
     1261 agaagtctga gcattcagaa gcaccagacc accacctttc gacttacagc gacgggggtg
     1321 tctttgcagt ctcaacagct tacaaacatg caaaaaccac agagctccca caacaacgat
     1381 catcttcagt tgctacccaa cagacaacgg tatcttccat cccatctcat ccatctactg
     1441 ctggaaaaat cttccgtgcc atgtatgact atatggctgc tgatgcagat gaggtgtcct
     1501 tcaaggatgg agatgccatc ataaatgttc aagcaattga tgaaggctgg atgtatggca
     1561 ctgtgcagag gactggcagg accggaatgc tcccagccaa ctacgttgaa gctatttagg
     1621 catttcaaag catcacactt gtctgcagga cttacagatc ctgcagtcaa tgtttcggtt
     1681 tagactctcc actgttacct aagttctcaa gctgcctatg gtttttctgt gtcaatgtga
     1741 tttatggtag taccatcctt tctcctttgg gttttaaaat aagttgcaga acagacactt
     1801 taaaagcttc tgcaatatta tttctgtgcc tagagtcttt ctccattata aacatgtttt
     1861 aacattattt cttttctaaa acagggattt tgaatatgcc aaacacatta aaggaaaaat
     1921 agcagagatg ttcacctttt ccttgctgat tgctaatgct tattatttct aattcagttc
     1981 tgaagttata aacttataat caatacaaac cagcaactaa taaaacctct aattctgtaa
     2041 aaaaaaaaaa aaaaaaaaaa aaaaaaaa
//