LOCUS       BC060785                2108 bp    mRNA    linear   HUM 21-JUL-2005
DEFINITION  Homo sapiens tripartite motif-containing 40, mRNA (cDNA clone
            MGC:71569 IMAGE:30340682), complete cds.
ACCESSION   BC060785
VERSION     BC060785.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2108)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 2108)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (03-NOV-2003) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: Dr. Stefan Hansson
            cDNA Library Preparation: Michael Brownstein /  Ted Usdin
            Laboratory
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Sequencing Group at the Stanford Human Genome
            Center, Stanford University School of Medicine, Stanford, CA  94305
            Web site:       http://www-shgc.stanford.edu
            Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
            Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
            R. M.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAK Plate: 133 Row: d Column: 7
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 33469990.
FEATURES             Location/Qualifiers
     source          1..2108
                     /db_xref="H-InvDB:HIT000260087_04"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:71569 IMAGE:30340682"
                     /tissue_type="Placenta, normal"
                     /clone_lib="NIH_MGC_147"
                     /lab_host="DH10B"
                     /note="Vector: pBluescriptR"
     gene            1..2108
                     /gene="TRIM40"
                     /gene_synonym="RNF35"
                     /db_xref="GeneID:135644"
     CDS             387..1163
                     /gene="TRIM40"
                     /gene_synonym="RNF35"
                     /codon_start=1
                     /product="TRIM40 protein"
                     /protein_id="AAH60785.1"
                     /db_xref="GeneID:135644"
                     /translation="MIPLQKDNQEEGVCPICQESLKEAVSTNCGHLFCRVCLTQHVEK
                     ASASGVFCCPLCRKPCSEEVLGTGYICPNHQKRVCRFCEESRLLLCVECLVSPEHMSH
                     HELTIENALSHYKERLNRRSRKLRKDIAELQRLKAQQEKKLQALQFQVDHGNHRLEAG
                     PESQHQTREQLGALPQQWLGQLEHMPAEAARILDISRAVTQLRSLVIDLERTAKELDT
                     NTLKNAGDLLNRSAPQKLEVIYPQLEKGVSELLLQPPQKL"
BASE COUNT          527 a          570 c          535 g          476 t
ORIGIN      
        1 ataagaacca ctcatctgct ggccatctct ccaggtctgg agccagagaa gatgatctga
       61 aattgtagca ggagaaattg aggtgtatga aaaataattt caagtttaac aaacacaagg
      121 aaaccgcagg gtccatgtca aagctgatga gctatttctg aaactcgtgc agaattgtgg
      181 tttgtgtggt ctatgtcacg gcacccttga gggagagtgg gcaattgcct gaacttggag
      241 gctgtgtcct gtccccaggc tgctccaggg ctgcctcctt ccgactgggc cttcttatct
      301 gggactgttg agggcaacag gccttccgaa gaccagtgaa gaaggaggcc ctgcaaacag
      361 gaggctgaca gggtaggaac gaggccatga tccctttgca gaaggacaac caggaggagg
      421 gtgtctgccc catctgccag gagagcctga aggaggccgt gagcaccaac tgcggacatc
      481 tcttctgtcg agtgtgcctg acacagcatg tggagaaggc ctcagcctct ggggtcttct
      541 gctgccccct ctgccggaag ccctgttctg aggaggtgct agggacaggc tatatctgcc
      601 ccaaccacca gaagagggtg tgcaggttct gtgaggagag cagacttctt ctatgtgtgg
      661 aatgcctggt gtcccctgaa cacatgtctc atcatgaact gaccattgaa aatgccctca
      721 gccactacaa ggaacgactc aatcgccgga gcaggaagct cagaaaggac attgcagaac
      781 ttcagcggct caaggctcag caggagaaga aactgcaggc tctgcagttt caggtagacc
      841 acgggaacca caggctggag gctgggccgg agagccagca ccaaaccagg gaacagctgg
      901 gtgccctccc tcagcagtgg ctgggccagc tggagcacat gccagcagaa gcggccagaa
      961 tccttgacat ctccagggca gtaacacagc tcagaagcct ggtcattgat ctggaaagga
     1021 cggccaagga attagacacc aacacactga agaatgctgg tgacttactg aacaggagtg
     1081 ctccacagaa attagaggtt atttatcccc agttggagaa aggagtcagt gaattgcttc
     1141 ttcagccccc tcagaagctc tgacctgttc atccctggga cacctcactt caggctcacc
     1201 tcagcctcct ctctctcctt cctccaacct gtccaggccc ccactgggtc tacccagtgc
     1261 atcttcgggc ctgccagctc ctgaacatgt caccatttct tcatgtccac agtcatcacc
     1321 tgatgcctga ccctctgact cttggacgat agccagcctc cttccaggac aggctcatgc
     1381 ttggggctgc cactgtggag gtcggggccc atggtctcca ggagcatttg tgaaatctcc
     1441 attttgcctg taaactgatg gtagtgccca tctctcacaa tctcattcaa ataggatcct
     1501 ccaggcctct gaatggcccg agctcatcag cagtgacacc acctcacatg tggagcccag
     1561 ctgagttcct gcagtacttg ttgtctgtac cactcacctg gcacttattt attattgttg
     1621 tggaagacag actcaaagac agcctccctt cgtgatcctc acctcttgga attcatgccc
     1681 ttgtttggtc ccctcccctt gagtgtaagt gggatctgtg acttgcttct aatgaatgga
     1741 ataaggcaaa ggtgataggg tgtcactctg gcaactgtgt tgcattgtat agaactcctc
     1801 cttgctggcc caccctttta gagcccctcc taggagccaa gagcagcttc cagccaacaa
     1861 caagcagagg ccctcagtct tgtggctgca agaacctgaa ttctgccaac aacccgagtg
     1921 agcttggaag cagattcctc cccaactgag ccggataaga acctagtcca gccaacacct
     1981 tgattatagt cttgtgagta cctaagctga ggacccagtg aagctgtgcc aaaatttccc
     2041 acccacagaa acagtgtgac aataaatgtg tgtgtgtttt tttgttaaaa aataaaaaaa
     2101 aaaaaaaa
//