LOCUS       BC052582                1024 bp    mRNA    linear   HUM 15-JUL-2006
DEFINITION  Homo sapiens natural cytotoxicity triggering receptor 3, mRNA (cDNA
            clone MGC:59970 IMAGE:5934651), complete cds.
ACCESSION   BC052582
VERSION     BC052582.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1024)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 1024)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (16-MAY-2003) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: Dr. Daniel McVicar, DBS/NCI
            cDNA Library Preparation: Rubin Laboratory
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: National Institutes of Health Intramural
            Sequencing Center (NISC),
            Gaithersburg, Maryland;
            Web site: http://www.nisc.nih.gov/
            Contact: nisc_mgc@nhgri.nih.gov
            Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
            Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
            Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
            Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
            Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
            McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
            Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
            Young,A., Zhang,L.-H. and Green,E.D.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 47 Row: f Column: 19
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 24475831.
FEATURES             Location/Qualifiers
     source          1..1024
                     /db_xref="H-InvDB:HIT000053800_10"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:59970 IMAGE:5934651"
                     /tissue_type="Blood, natural killer cell"
                     /clone_lib="NIH_MGC_106"
                     /lab_host="DH10B-R"
                     /note="Vector: pOTB7"
     gene            1..1024
                     /gene="NCR3"
                     /gene_synonym="1C7"
                     /gene_synonym="CD337"
                     /gene_synonym="NKp30"
                     /db_xref="GeneID:259197"
                     /db_xref="HGNC:HGNC:19077"
     CDS             209..814
                     /gene="NCR3"
                     /gene_synonym="1C7"
                     /gene_synonym="CD337"
                     /gene_synonym="NKp30"
                     /codon_start=1
                     /product="natural cytotoxicity triggering receptor 3"
                     /protein_id="AAH52582.1"
                     /db_xref="GeneID:259197"
                     /db_xref="HGNC:HGNC:19077"
                     /translation="MAWMLLLILIMVHPGSCALWVSQPPEIRTLEGSSAFLPCSFNAS
                     QGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHD
                     ASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGTVLLLRAGFYAVSFLSVAVGSTV
                     YYQGKCLTWKGPRRQLPAVVPAPLPPPCGSSAHLLPPVPGG"
BASE COUNT          220 a          296 c          278 g          230 t
ORIGIN      
        1 gtcctctctc ctcagggagg caagcatttg atgctcgagg tccctggcag ttgtggtcct
       61 tggcaagtga tgtgtgagtc ccgtgtgtca taggaagctc cccatcccca tctggtgacc
      121 aaaggcctgg ctacaagtag tgagtccttc ctcctccacc cagacctcac tgctcagatc
      181 cccttcgcca actgggacat cttccgacat ggcctggatg ctgttgctca tcttgatcat
      241 ggtccatcca ggatcctgtg ctctctgggt gtcccagccc cctgagattc gtaccctgga
      301 aggatcctct gccttcctgc cctgctcctt caatgccagc caagggagac tggccattgg
      361 ctccgtcacg tggttccgag atgaggtggt tccagggaag gaggtgagga atggaacccc
      421 agagttcagg ggccgcctgg ccccacttgc ttcttcccgt ttcctccatg accaccaggc
      481 tgagctgcac atccgggacg tgcgaggcca tgacgccagc atctacgtgt gcagagtgga
      541 ggtgctgggc cttggtgtcg ggacagggaa tgggactcgg ctggtggtgg agaaagaaca
      601 tcctcagcta ggggctggta cagtcctcct ccttcgggct ggattctatg ctgtcagctt
      661 tctctctgtg gccgtgggca gcaccgtcta ttaccagggc aaatgtctga cctggaaagg
      721 tccaagaagg cagctgccgg ctgtggtccc agcgcccctc ccaccaccat gtgggagctc
      781 agcacatctg cttcccccag tcccaggagg ctgagcctga ttgtcctgag aaatgggaag
      841 gatcagatat gactcctcct tggcaactgc cctttcctgc caggcccaca cataccctct
      901 tctggctgtt aggggagctt gggtccctga acactgtcat tcacccaata aattactatt
      961 tgaccccaga gtgggtggaa gggtgaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa
     1021 aaaa
//