LOCUS       BC051888                3268 bp    mRNA    linear   HUM 19-JUN-2006
DEFINITION  Homo sapiens tRNA-yW synthesizing protein 1 homolog (S.
            cerevisiae), mRNA (cDNA clone MGC:60291 IMAGE:6173301), complete
            cds.
ACCESSION   BC051888
VERSION     BC051888.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 3268)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 3268)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (01-MAY-2003) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC
            cDNA Library Preparation: Life Technologies, Inc.
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Sequencing Group at the Stanford Human Genome
            Center, Stanford University School of Medicine, Stanford, CA  94305
            Web site:       http://www-shgc.stanford.edu
            Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
            Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
            R. M.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAK Plate: 110 Row: m Column: 24
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 50726980.
FEATURES             Location/Qualifiers
     source          1..3268
                     /db_xref="H-InvDB:HIT000053733"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:60291 IMAGE:6173301"
                     /tissue_type="Uterus, leiomyosarcoma"
                     /clone_lib="NIH_MGC_71"
                     /lab_host="DH10B"
                     /note="Vector: pCMV-SPORT6"
     gene            1..3268
                     /gene="TYW1"
                     /gene_synonym="FLJ10900"
                     /gene_synonym="MGC23001"
                     /gene_synonym="MGC60291"
                     /gene_synonym="YPL207W"
                     /db_xref="GeneID:55253"
                     /db_xref="HGNC:HGNC:25598"
     CDS             127..1281
                     /gene="TYW1"
                     /gene_synonym="FLJ10900"
                     /gene_synonym="MGC23001"
                     /gene_synonym="MGC60291"
                     /gene_synonym="YPL207W"
                     /codon_start=1
                     /product="TYW1 protein"
                     /protein_id="AAH51888.1"
                     /db_xref="GeneID:55253"
                     /db_xref="HGNC:HGNC:25598"
                     /translation="MDPSADTWDLFSPLISLWINRFYIYLGFAVSISLWICVQIVIKT
                     QGKNLQEKSVPKAAQDLMTNGYVSLQEKDIFVSGVKIFYGSQTGTAKGFATVLAEAVT
                     SLDLPVAIINLKEYDPDDHLIEEVTSKNVCVFLVATYTDGLPTESAEWFCKWLEEASI
                     DFRFGKTYLKGMRYAVFGLGNSAYASHFNKVGKNVDKWLWMLGAHRVMSRGEGDCDVV
                     KSKHGSIEADFRAWKTKFISQLQALQKGERKKSCGGHCKKGKCESHQHGSEEREEGSH
                     EQDELHHRDTEEEEPFESSSEEEFGGEDHQSLNSIVDVEDLGKIMDHVKKEKREKEQQ
                     EEKSGLFRNMGRNEDGERRAMITPALREALTKQVHAPRERRLLQTHILWN"
BASE COUNT          947 a          688 c          811 g          822 t
ORIGIN      
        1 cacaggtctg caggcactcg gtacgccgct aacgcggcga ggtagctcgg tgcgtctcgc
       61 ggtaccagtg cgaatcatcg ggctatccag gtccgagatc ctagtctcct gtcggctctg
      121 aggaggatgg atccttctgc ggatacatgg gacctcttct cacctttaat atcattatgg
      181 ataaacaggt tttacattta tttgggcttt gctgttagca ttagcctttg gatttgtgtc
      241 cagattgtca tcaagacgca gggcaagaac ttacaggaaa aatctgttcc aaaagcagct
      301 caggatttga tgacaaatgg ttatgtctcc cttcaagaga aagacatctt tgtgtctgga
      361 gtgaagattt tttatggttc tcagactgga acagcgaagg gattcgcaac agttcttgct
      421 gaagcagtta catccctgga tctgcctgtg gccattatta atctaaaaga atatgatcca
      481 gatgatcatc tgatagaaga ggtgactagt aaaaatgtct gtgtcttcct ggttgcgaca
      541 tacactgacg gcctaccaac tgaaagtgca gagtggttct gcaaatggtt agaggaagca
      601 tccattgatt ttcgatttgg caaaacttac ctgaagggta tgagatatgc ggtatttggc
      661 ctgggaaatt ctgcctatgc tagccacttc aacaaggttg gcaaaaatgt tgacaagtgg
      721 ctctggatgc ttggcgcgca tcgtgtgatg agtcgagggg agggcgactg cgacgtggtt
      781 aaaagcaagc acggcagcat tgaggccgac ttcagagcat ggaagaccaa gttcatctcc
      841 cagctgcagg cacttcagaa aggggagaga aagaagtcct gtggcggcca ctgcaagaaa
      901 ggcaaatgtg aatctcacca acatggctca gaggagaggg aggaaggatc tcatgagcag
      961 gatgaattgc atcatagaga caccgaggag gaagaaccct ttgagagctc cagtgaagaa
     1021 gagtttggtg gtgaggacca tcagagccta aattccattg ttgatgttga agatttgggc
     1081 aaaattatgg atcatgtgaa gaaagaaaag agagaaaagg aacagcagga agagaagtct
     1141 ggtttgttca ggaacatggg gaggaatgaa gatggtgaaa gaagagctat gataactcct
     1201 gctctccgag aagcccttac taaacaagtc catgctccga gggagaggag gttgttacaa
     1261 acacacattc tatggaattg agagccatcg ctgcatggaa accaccccga gcttggcgtg
     1321 tgctaataaa tgtgtcttct gttggcggca ccacaccaac cccgtgggca ctgagtggcg
     1381 gtggaagatg gaccagcctg aaatgatctt gaaggaagcc attgaaaacc atcagaacat
     1441 gattaagcag tttaaaggag taccgggcgt caaagcagaa cgctttgaag aaggaatgac
     1501 ggtaaagcac tgtgcatttt ccctcgtggg agaaccaata atgtacccag agatcaacag
     1561 gtttttgaag ctactccacc agtgtaaaat ttccagcttc ctggtcacaa acgcacaatt
     1621 tcctgcggaa atcaggaacc tcgagccggt tactcagctg tatgtcagtg tggatgccag
     1681 taccaaagac agcctgaaga aaatcgaccg cccactcttc aaggatttct ggcagagatt
     1741 ccttgacagt ttaaaagcct tggcagtcaa gcaacaacga actgtctaca gactgacgct
     1801 cgtgaaagca tggaacgtgg acgagctcca ggcctacgcg cagctcgtgt ccctggggaa
     1861 tcctgacttc atcgaagtga agggcgttac ctactgcgga gaaagttcag caagcagtct
     1921 taccatggcc cacgtgccct ggcatgagga agtggtacag tttgtccacg agttggtgga
     1981 tctgatcccc gaatatgaaa ttgcatgtga acacgaacac tctaattgcc tcctgatagc
     2041 acacagaaag tttaaaattg gtggtgaatg gtggacatgg atcgattata accgcttcca
     2101 ggagctcatc caggaatatg aagatagtgg tggatcaaaa acgttcagcg caaaggatta
     2161 tatggccaga actcctcact gggcattatt tggtgccagt gaaagaggct ttgatcccaa
     2221 ggacacaaga catcagagaa agaacaaatc aaaggctatt tctggatgtt gagattatct
     2281 gatttcaagg tactgaagga caaaaacttg gatggcctca aaaggttctt gaacaccact
     2341 gtgattctcc aaggacgaat tacgtaaatt atactttcat acaaaggaga cgataaggca
     2401 gtaaacatgg agacacgggg gacagcgtcc acactcagag ggcctgggcc acagccccga
     2461 tgtttctttt cagaactcag cccctttcct gattttactt ctaagaggaa aattattttg
     2521 gggaggaact acacagtcgt gattagaatt tatctgatgg ttttgtatta taacttgtaa
     2581 gacctgccag aatgctagtc ccgagagtgt cagacaagga agaagtccct gggcctcttc
     2641 cccttacccg gcccttagat ttcatggagc agccacttag cattgaattg cactaccctg
     2701 agctaaacgt gtctgtgctt tctaagataa gagcttgatc cctttcttct atcttaagac
     2761 agcacctcct gaaaagaatc gaagttgtca caactctcaa ttatttttta aatactgcat
     2821 agattgagtt ttggtttatt accaaccctt cccagaattg cgttggatct aaaactacta
     2881 gatctcatcc cattcccatg taaattacca cagaccgcag taccggggct ggagcggagt
     2941 gaagctgtct gctgtaagag gagtggccat gtgagggcat ggagtcatta gtctcacaaa
     3001 cacactttgg actgaagagg atcatttctt tttgttcgtg aggtcactgt ccaggcctct
     3061 catatcatga ccagacggcg ggtctccatc ttctttcact cctgtggccc tggctgcttt
     3121 acacaatctg ttctataagg ttcaggtgtt ttcaagttgg aaagatcata aatactcaaa
     3181 attgttttca agttagcaag ttcttttaac agtcttttat gcaaaaattg aattaataaa
     3241 ataatctttt gtaaaaaaaa aaaaaaaa
//