LOCUS       BC051881                2639 bp    mRNA    linear   HUM 09-JUN-2008
DEFINITION  Homo sapiens SAM and SH3 domain containing 3, mRNA (cDNA clone
            MGC:60272 IMAGE:6011968), complete cds.
ACCESSION   BC051881
VERSION     BC051881.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2639)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 2639)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (01-MAY-2003) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC
            cDNA Library Preparation: Life Technologies, Inc.
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Sequencing Group at the Stanford Human Genome
            Center, Stanford University School of Medicine, Stanford, CA  94305
            Web site:       http://www-shgc.stanford.edu
            Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
            Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
            R. M.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAK Plate: 110 Row: h Column: 18
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 40254885.
FEATURES             Location/Qualifiers
     source          1..2639
                     /db_xref="H-InvDB:HIT000053730"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:60272 IMAGE:6011968"
                     /tissue_type="Testis, embryonal carcinoma"
                     /clone_lib="NIH_MGC_92"
                     /lab_host="DH10B"
                     /note="Vector: pCMV-SPORT6"
     gene            1..2639
                     /gene="SASH3"
                     /gene_synonym="753P9"
                     /gene_synonym="HACS2"
                     /gene_synonym="SH3D6C"
                     /gene_synonym="SLY"
                     /db_xref="GeneID:54440"
                     /db_xref="HGNC:HGNC:15975"
                     /db_xref="MIM:300441"
     CDS             115..1257
                     /gene="SASH3"
                     /gene_synonym="753P9"
                     /gene_synonym="HACS2"
                     /gene_synonym="SH3D6C"
                     /gene_synonym="SLY"
                     /codon_start=1
                     /product="SAM and SH3 domain containing 3"
                     /protein_id="AAH51881.1"
                     /db_xref="GeneID:54440"
                     /db_xref="HGNC:HGNC:15975"
                     /db_xref="MIM:300441"
                     /translation="MLRRKPSNASEKEPTQKKKLSLQRSSSFKDFAKSKPSSPVVSEK
                     EFNLDDNIPEDDSGVPTPEDAGKSGKKLGKKWRAVISRTMNRKMGKMMVKALSEEMAD
                     TLEEGSASPTSPDYSLDSPGPEKMALAFSEQEEHELPVLSRQASTGSELCSPSPGSGS
                     FGEEPPAPQYTGPFCGRARVHTDFTPSPYDHDSLKLQKGDVIQIIEKPPVGTWLGLLN
                     GKVGSFKFIYVDVLPEEAVGHARPSRRQSKGKRPKPKTLHELLERIGLEEHTSTLLLN
                     GYQTLEDFKELRETHLNELNIMDPQHRAKLLTAAELLLDYDTGSEEAEEGAESSQEPV
                     AHTVSEPKVDIPRDSGCFEGSESGRDDAELAGTEEQLQGLSLAGAP"
BASE COUNT          637 a          773 c          735 g          494 t
ORIGIN      
        1 gctgaaggct cggttcatgc cgtgcccccg ggcagttctg gtgaggctaa gcaagaggcc
       61 tctgcatctt gacacctagg agagcaggga cggagtctcc cagggtggag gaccatgctg
      121 cgccgcaagc cctccaatgc cagtgagaag gagcccactc agaagaaaaa gctctccctt
      181 cagcgctcca gcagcttcaa ggattttgcc aaatccaaac ccagctcccc cgtggtgagc
      241 gagaaggagt ttaatctgga tgataacatt ccagaagatg actcaggtgt ccccacccca
      301 gaagatgctg ggaagagtgg caaaaagctg gggaagaagt ggagggcagt gatttcccga
      361 accatgaaca ggaagatggg caagatgatg gtgaaggccc tgtcagaaga gatggcagac
      421 actctggagg agggctctgc ctccccgaca tctccagact acagcctgga cagccctggc
      481 cctgagaaga tggcgctggc cttttctgag caagaggagc atgaacttcc ggtgctcagc
      541 cgccaggcat caacaggcag tgagctctgc agccccagcc caggttctgg cagcttcggg
      601 gaggaaccac ctgcccccca gtacacaggg cctttctgtg gccgggcacg agtccacacc
      661 gacttcactc ccagccccta tgaccacgac tcgctgaaac tgcagaaagg agatgtgatc
      721 cagatcattg aaaagccacc tgtgggcacg tggctgggcc tactcaatgg caaggtgggc
      781 tctttcaaat tcatctatgt ggatgtgctg cccgaggagg ccgtggggca tgcccgcccc
      841 agccgccgac agagcaaggg caagaggccc aagcctaaga ccctgcatga gctgctggag
      901 cgcatcggcc tggaggagca cacatccacc ctcctgctca atggctacca gacactggaa
      961 gacttcaaag agctgcgaga aacacacctc aatgagctga acatcatgga tccacagcac
     1021 cgggccaagc tgctcacggc cgccgagctg ctgctggact atgacactgg cagtgaggag
     1081 gctgaagagg gcgccgagag cagccaggag ccagtggcac acacagtgtc ggaacccaag
     1141 gtggacatcc cgcgcgactc aggctgcttt gagggctcgg agagcgggcg cgatgacgca
     1201 gagctggcag gcactgagga gcagctgcaa ggcctctccc tggccggggc accttgaggt
     1261 ggcggtggca ataggccaag gctgggaccc agctgcaaag gctgtaggag tgggcccagc
     1321 ctcccgtggt ggcccaggtc ctgaggactg gcactgagcc tggccctgct tccccaggga
     1381 cacttagggc cacagaggcc aggccagggc cctacaggtt ccaggctcag ctggagtggt
     1441 tggggagtcg cccaagggca catcccacct gcctgagccc cgccctccac cagcgactga
     1501 cagcgcagcc cctcctggca ccaactgctc ccctgccatg gccacggcca cagcaagtgg
     1561 ggcactggga aaccctgccc atgtccctca ccaacaaggc ctccaaatcc tcctcacccc
     1621 cacaccacct acccctgtcg cactgctcct gaaaaggggg ccaagtcaat gtttcaggtc
     1681 agtctaaaaa ccctagggaa gctggccatt taaaagaacc caaactgacc atgggtaaat
     1741 ccagttcccc taaataaggc ctgaagaaat ccacaggtac cattcccact ttccttctcc
     1801 ctagctttct tagaggtttg gccactaaat cttatgagac ttgaaccaag tggcttcctc
     1861 tttctaggct taggacgggt tggggttaga aagggtgatc actgaaggcc ttgcctgctc
     1921 tgacattctg tgacattaaa tgtctattct cctgttacct gtggcctggg acaccagtgg
     1981 ggtttatcga ggggaccaga ggggcctcag gctttcagat gaaatggctc ctcctactca
     2041 cccactttat tcctctccat gtaattcagg acaagctgca acttccccca gcttaacaca
     2101 atgcccatac ctcatacgat atgcgccctc ccgttccatc cctggccccc tcaaacgaga
     2161 cttctcacaa ggctgattac agatggtcaa acctggcttc caaggacaga attgcctctc
     2221 ggaagccagc tgtggatctg agtccagagt tggccacttg tgtgggtcct cacaagcaaa
     2281 gagagcacta aacttgacat tgggggtcca ccactccaac tttgctttct gaaggttttg
     2341 gtgtacattg agccccagaa ggaaaggaga gtatctgtga gtgggggcct cccttgaccc
     2401 cagtacgaag tctatgccct gaatccccag agtagccctt cctggtgccc aactggcctg
     2461 gggacaaaca gcgtccacta catctaggac tgccggctaa gtggacacac ttcttgacct
     2521 cctaccagga actttggtaa aagctagctt tggggaaggg gttgggtgta aatatgagag
     2581 ggtggaggga gaccagctgg tagcaataaa catgggtaga actaaaaaaa aaaaaaaaa
//