LOCUS       BC051756                3826 bp    mRNA    linear   HUM 15-JUL-2006
DEFINITION  Homo sapiens TYRO3 protein tyrosine kinase, mRNA (cDNA clone
            MGC:51900 IMAGE:6095596), complete cds.
ACCESSION   BC051756
VERSION     BC051756.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 3826)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 3826)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (01-MAY-2003) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC/DCTD/DTP
            cDNA Library Preparation: Life Technologies, Inc.
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Sequencing Group at the Stanford Human Genome
            Center, Stanford University School of Medicine, Stanford, CA  94305
            Web site:       http://www-shgc.stanford.edu
            Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
            Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
            R. M.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAK Plate: 98 Row: l Column: 22.
FEATURES             Location/Qualifiers
     source          1..3826
                     /db_xref="H-InvDB:HIT000053672"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:51900 IMAGE:6095596"
                     /tissue_type="Skin, melanotic melanoma."
                     /clone_lib="NIH_MGC_72"
                     /lab_host="DH10B"
                     /note="Vector: pCMV-SPORT6"
     gene            1..3826
                     /gene="TYRO3"
                     /gene_synonym="Brt"
                     /gene_synonym="BYK"
                     /gene_synonym="Dtk"
                     /gene_synonym="Sky"
                     /gene_synonym="Tif"
                     /db_xref="GeneID:7301"
                     /db_xref="HGNC:HGNC:12446"
                     /db_xref="MIM:600341"
     CDS             16..2688
                     /gene="TYRO3"
                     /gene_synonym="Brt"
                     /gene_synonym="BYK"
                     /gene_synonym="Dtk"
                     /gene_synonym="Sky"
                     /gene_synonym="Tif"
                     /codon_start=1
                     /product="TYRO3 protein tyrosine kinase"
                     /protein_id="AAH51756.1"
                     /db_xref="GeneID:7301"
                     /db_xref="HGNC:HGNC:12446"
                     /db_xref="MIM:600341"
                     /translation="MALRRSMGRPGLPPLPLPPPPRLGLLLAALASLLLPESAAAGLK
                     LMGAPVKLTVSQGQPVKLNCSVEGMEEPDIQWVKDGAVVQNLDQLYIPVSEQHWIGFL
                     SLKSVERSDAGRYWCQVEDGGETEISQPVWLTVEGVPFFTVEPKDLAVPPNAPFQLSC
                     EAVGPPEPVTIVWWRGTTKIGGPAPSPSVLNVTGVTQSTMFSCEAHNLKGLASSRTAT
                     VHLQALPAAPFNITVTKLSSSNASVAWMPGADGRALLQSCTVQVTQAPGGWEVLAVVV
                     PVPPFTCLLRDLVPATNYSLRVRCANALGPSPYADWVPFQTKGLAPASAPQNLHAIRT
                     DSGLILEWEEVIPEAPLEGPLGPYKLSWVQDNGTQDELTVEGTRANLTGWDPQKDLIV
                     RVCVSNAVGCGPWSQPLVVSSHDRAGQQGPPHSRTSWVPVVLGVLTALVTAAALALIL
                     LRKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPERIEATLDSLGISDELKEKL
                     EDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFL
                     REAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENP
                     FNLPLQTLIRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYS
                     GDYYRQGCASKLPVKWLALESLADNLYTVQSDVWAFGVTMWEIMTRGQTPYAGIENAE
                     IYNYLIGGNRLKQPPECMEDVYDLMYQCWSADPKQRPSFTCLRMELENILGQLSVLSA
                     SQDPLYINIERAEEPTAGGSLELPGRDQPYSGAGDGSGMGAVGGTPSDCRYILTPGGL
                     AEQPGQAEHQPESPLNETQRLLLLQQGLLPHSSC"
BASE COUNT          849 a         1067 c         1128 g          782 t
ORIGIN      
        1 gcggcgtcgc cgccgatggc gctgaggcgg agcatggggc ggccggggct cccgccgctg
       61 ccgctgccgc cgccaccgcg gctcgggctg ctgctggcgg ctctggcttc tctgctgctc
      121 ccggagtccg ccgccgcagg tctgaagctc atgggagccc cggtgaagct gacagtgtct
      181 caggggcagc cggtgaagct caactgcagt gtggagggga tggaggagcc tgacatccag
      241 tgggtgaagg atggggctgt ggtccagaac ttggaccagt tgtacatccc agtcagcgag
      301 cagcactgga tcggcttcct cagcctgaag tcagtggagc gctctgacgc cggccggtac
      361 tggtgccagg tggaggatgg gggtgaaacc gagatctccc agccagtgtg gctcacggta
      421 gaaggtgtgc catttttcac agtggagcca aaagatctgg cagtgccacc caatgcccct
      481 ttccaactgt cttgtgaggc tgtgggtccc cctgaacctg ttaccattgt ctggtggaga
      541 ggaactacga agatcggggg acccgctccc tctccatctg ttttaaatgt aacaggggtg
      601 acccagagca ccatgttttc ctgtgaagct cacaacctaa aaggcctggc ctcttctcgc
      661 acagccactg ttcaccttca agcactgcct gcagccccct tcaacatcac cgtgacaaag
      721 ctttccagca gcaacgctag tgtggcctgg atgccaggtg ccgatggccg agctctgcta
      781 cagtcctgta cagttcaggt gacacaggcc ccaggaggct gggaagtcct ggctgttgtg
      841 gtccctgtgc ccccctttac ctgcctgctc cgggacctgg tgcctgccac caactacagc
      901 ctcagggtgc gctgtgccaa tgccttgggg ccctctccct atgctgactg ggtgcccttt
      961 cagaccaagg gtctagcccc agccagcgct ccccaaaacc tccatgccat ccgcacagat
     1021 tcaggcctca tcttggagtg ggaagaagtg atccccgagg cccctttgga aggccccctg
     1081 ggaccctaca aactgtcctg ggttcaagac aatggaaccc aggatgagct gacagtggag
     1141 gggaccaggg ccaatttgac aggctgggat ccccaaaagg acctgatcgt acgtgtgtgc
     1201 gtctccaatg cagttggctg tggaccctgg agtcagccac tggtggtctc ttctcatgac
     1261 cgtgcaggcc agcagggccc tcctcacagc cgcacatcct gggtacctgt ggtccttggt
     1321 gtgctaacgg ccctggtgac ggctgctgcc ctggccctca tcctgcttcg aaagagacgg
     1381 aaagagacgc ggtttgggca agcctttgac agtgtcatgg cccggggaga gccagccgtt
     1441 cacttccggg cagcccggtc cttcaatcga gaaaggcccg agcgcatcga ggccacattg
     1501 gacagcttgg gcatcagcga tgaactaaag gaaaaactgg aggatgtgct catcccagag
     1561 cagcagttca ccctgggccg gatgttgggc aaaggagagt ttggttcagt gcgggaggcc
     1621 cagctgaagc aagaggatgg ctcctttgtg aaagtggctg tgaagatgct gaaagctgac
     1681 atcattgcct caagcgacat tgaagagttc ctcagggaag cagcttgcat gaaggagttt
     1741 gaccatccac acgtggccaa acttgttggg gtaagcctcc ggagcagggc taaaggccgt
     1801 ctccccatcc ccatggtcat cttgcccttc atgaagcatg gggacctgca tgccttcctg
     1861 ctcgcctccc ggattgggga gaaccccttt aacctacccc tccagaccct gatccggttc
     1921 atggtggaca ttgcctgcgg catggagtac ctgagctctc ggaacttcat ccaccgagac
     1981 ctggctgctc ggaattgcat gctggcagag gacatgacag tgtgtgtggc tgacttcgga
     2041 ctctcccgga agatctacag tggggactac tatcgtcaag gctgtgcctc caaactgcct
     2101 gtcaagtggc tggccctgga gagcctggcc gacaacctgt atactgtgca gagtgacgtg
     2161 tgggcgttcg gggtgaccat gtgggagatc atgacacgtg ggcagacgcc atatgctggc
     2221 atcgaaaacg ctgagattta caactacctc attggcggga accgcctgaa acagcctccg
     2281 gagtgtatgg aggacgtgta tgatctcatg taccagtgct ggagtgctga ccccaagcag
     2341 cgcccgagct ttacttgtct gcgaatggaa ctggagaaca tcttgggcca gctgtctgtg
     2401 ctatctgcca gccaggaccc cttatacatc aacatcgaga gagctgagga gcccactgcg
     2461 ggaggcagcc tggagctacc tggcagggat cagccctaca gtggggctgg ggatggcagt
     2521 ggcatggggg cagtgggtgg cactcccagt gactgtcggt acatactcac ccccggaggg
     2581 ctggctgagc agccagggca ggcagagcac cagccagaga gtcccctcaa tgagacacag
     2641 aggcttttgc tgctgcagca agggctactg ccacacagta gctgttagcc cacaggcaga
     2701 gggcatcggg gccatttggc cggctctggt ggccactgag ctggctgact aagccccgtc
     2761 tgaccccagc ccagacagca aggtgtggag gctcctgtgg tagtcctccc aagctgtgct
     2821 gggaagcccg gactgaccaa atcacccaat cccagttctt cctgcaacca ctctgtggcc
     2881 agcctggcat cagtttaggc cttggcttga tggaagtggg ccagtcctgg ttgtctgaac
     2941 ccaggcagct ggcaggagtg gggtggttat gtttccatgg ttaccatggg tgtggatggc
     3001 agtgtgggga gggcaggtcc agctctgtgg gccctaccct cctgctgagc tgcccctgct
     3061 gcttaagtgc atgcattgag ctgcctccag cctggtggcc cagctattac cacacttggg
     3121 gtttaaatat ccaggtgtgc ccctccaagt cacaaagaga tgtccttgta atattccctt
     3181 ttaggtgagg gttggtaagg ggttggtatc tcaggtctga atcttcacca tctttctgat
     3241 tccgcaccct gcctacgcca ggagaagttg aggggagcat gcttccctgc agctgaccgg
     3301 gtcacacaaa ggcatgctgg agtacccagc ctatcaggtg cccctcttcc aaaggcagcg
     3361 tgccgagcca gcaagaggaa ggggtgctgt gaggcttgcc caggagcaag tgaggccgga
     3421 gaggagttca ggaacccttc tccataccca caatctgagc acgctaccaa atctcaaaat
     3481 atcctaagac taacaaaggc agctgtgtct gagcccaacc cttctaaacg gtgaccttta
     3541 gtgccaactt cccctctaac tggacagcct cttctgtccc aagtctccag agagaaatca
     3601 ggcctgatga gggggaattc ctggaacctg gaccccagcc ttggtggggg agcctctgga
     3661 atgcatgggg cgggtcctag ctgttaggga catttccaag ctgttagttg ctgtttaaaa
     3721 tagaaataaa attgaagact aaagacctaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa
     3781 aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaa
//