LOCUS       BC049383                1918 bp    mRNA    linear   HUM 15-JUL-2006
DEFINITION  Homo sapiens nudix (nucleoside diphosphate linked moiety X)-type
            motif 10, mRNA (cDNA clone MGC:49885 IMAGE:5725355), complete cds.
ACCESSION   BC049383
VERSION     BC049383.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1918)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 1918)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (31-MAR-2003) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: Invitrogen
            cDNA Library Preparation: Life Technologies, Inc.
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Genome Sequence Centre,
            BC Cancer Agency, Vancouver, BC, Canada
            info@bcgsc.bc.ca
            Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
            Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
            Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
            Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
            Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
            Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
            Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
            Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
            Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAK Plate: 89 Row: e Column: 21
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 37221176.
FEATURES             Location/Qualifiers
     source          1..1918
                     /db_xref="H-InvDB:HIT000053371"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:49885 IMAGE:5725355"
                     /tissue_type="Ovary, pooled from 3 adults"
                     /clone_lib="NIH_MGC_125"
                     /lab_host="DH10B"
                     /note="Vector: pCMV-SPORT6"
     gene            1..1918
                     /gene="NUDT10"
                     /gene_synonym="DIPP3a"
                     /gene_synonym="hDIPP3alpha"
                     /db_xref="GeneID:170685"
                     /db_xref="HGNC:HGNC:17621"
                     /db_xref="MIM:300527"
     CDS             79..573
                     /gene="NUDT10"
                     /gene_synonym="DIPP3a"
                     /gene_synonym="hDIPP3alpha"
                     /codon_start=1
                     /product="nudix (nucleoside diphosphate linked moiety
                     X)-type motif 10"
                     /protein_id="AAH49383.1"
                     /db_xref="GeneID:170685"
                     /db_xref="HGNC:HGNC:17621"
                     /db_xref="MIM:300527"
                     /translation="MKCKPNQTRTYDPEGFKKRAACLCFRSEREDEVLLVSSSRYPDR
                     WIVPGGGMEPEEEPGGAAVREVYEEAGVKGKLGRLLGVFEQNQDPKHRTYVYVLTVTE
                     LLEDWEDSVSIGRKREWFKVEDAIKVLQCHKPMHAEYLEKLKLGGSPTNGNSMAPSSP
                     DSDP"
BASE COUNT          584 a          367 c          456 g          511 t
ORIGIN      
        1 cggctgctgc ccggcagcgg cagcagctgc gtcggcggcc cacacagcag cgagaggcga
       61 gaggaggctg cctcgaggat gaagtgcaaa cccaaccaga cacggaccta cgaccccgag
      121 gggttcaaga agcgggcggc gtgcctgtgc ttccggagcg agcgcgagga cgaggtcctg
      181 ttagtgagta gcagccggta cccggaccgc tggatcgtgc cgggcggggg catggagccc
      241 gaggaggagc cgggcggtgc ggcggtccga gaggtgtatg aagaggcggg agtcaagggg
      301 aagttaggcc ggctcctggg cgtcttcgaa cagaaccagg accccaagca cagaacgtac
      361 gtgtatgtac tgactgtcac ggagctgttg gaggattggg aagattcggt tagcattggg
      421 aggaagcgag agtggttcaa agtcgaagat gccatcaagg ttctccagtg ccacaagccc
      481 atgcacgccg aatatctgga gaaactaaag ctgggcggtt ccccaaccaa tggaaactcc
      541 atggccccat cctcgccaga tagcgatccc tagtgaatgg catagatgtt gttcagattt
      601 actttgaaag aatcaagtat gtgaatggat ggatgaatgg aattgtgaag cacagatgag
      661 ctctttcaca ctccaaggac acagctcatc ctatgctttt ggacacttct tccctgttta
      721 ttacaatgac tattctccag gttgttgcac taccgctgta tctgtacata attctaactt
      781 ggcacctgtg gccttttttg tgctcttatg tgtctgtatt tcccggcaga gtatacgccc
      841 ttgaatgcca ggaacttgtt tccttagtct tttttatata tctagcatat aagatattgc
      901 ttagaatatg gtagacatca ctgaagattt gtttcagtag ttcatatttt gtaatgatac
      961 tgaatggtta aacaatccct ttctaatctg tctagcatat atgtgacttt tgtttatcaa
     1021 gtgtcacaca actgcttcaa gacagctgtg agatactaga aagcaaaaat tcttactcct
     1081 atgtctgtgt catcccagat gtgtgcctcc agatggcagt atactacact atctgtaaaa
     1141 tatatttgca aagccaggca cagtgttacg cgtctgcctc aggaggctga ggcagaagaa
     1201 tagcttgagc ccaggagctt tagtctagcc tgagcaatat aatgagactc cgtctcttaa
     1261 aatatttgcc caaacattga acctaaattt gaccatgccc ctagaaataa ttcctaatct
     1321 ttagaaaata gggcagagaa acattatttt acaccatgga gatgagatca gcagaatcca
     1381 gactataaga aactacagga cacatgacct agtttcttct gtaaataact tgcaaggatg
     1441 aaagatggag gatgaaccta tagatttaaa gagacttaag agacatatta accaattgtt
     1501 aattggatct tatttgaatt gtgatttgac cgaactgtaa aacgaataca tttatgagac
     1561 aatcggggta atttgaacat tggtggggta tttggtatta gaataatggt tttatcatta
     1621 tgttagaaag aagggtcctc atctacattc tcaaacatct gtggctgata tgatatgatt
     1681 cttggaattt gcttcaaaat aataagtctg gatgttaagt gcattggaaa tattgatgaa
     1741 acgaaattgg ccttgataat tgttgaagct gggtgatggc taaaatgatg gttcattata
     1801 tatgttcatc tctatttttg tatgtttggc attttccgta ataaagttta taaaaataaa
     1861 aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaa
//