LOCUS       BC048313                1867 bp    mRNA    linear   HUM 11-APR-2007
DEFINITION  Homo sapiens zinc finger protein 33B, mRNA (cDNA clone
            IMAGE:4417537), partial cds.
ACCESSION   BC048313
VERSION     BC048313.2
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1867)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 1867)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (07-MAR-2003) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     On Aug 25, 2003 this sequence version replaced BC048313.1.
            Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC
            cDNA Library Preparation: Life Technologies, Inc.
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: National Institutes of Health Intramural
            Sequencing Center (NISC),
            Gaithersburg, Maryland;
            Web site: http://www.nisc.nih.gov/
            Contact: nisc_mgc@nhgri.nih.gov
            Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
            Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
            Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
            Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
            Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
            McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
            Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
            Young,A., Zhang,L.-H. and Green,E.D.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAK Plate: 93 Row: b Column: 12
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 28274681.
FEATURES             Location/Qualifiers
     source          1..1867
                     /db_xref="H-InvDB:HIT000098970"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="IMAGE:4417537"
                     /tissue_type="Duodenum, adenocarcinoma"
                     /clone_lib="NIH_MGC_88"
                     /lab_host="DH10B"
                     /note="Vector: pCMV-SPORT6"
     gene            1..>1867
                     /gene="ZNF33B"
                     /gene_synonym="KOX2"
                     /gene_synonym="KOX31"
                     /db_xref="GeneID:7582"
                     /db_xref="HGNC:HGNC:13097"
                     /db_xref="MIM:194522"
     CDS             114..>1867
                     /gene="ZNF33B"
                     /gene_synonym="KOX2"
                     /gene_synonym="KOX31"
                     /codon_start=1
                     /product="ZNF33B protein"
                     /protein_id="AAH48313.1"
                     /db_xref="GeneID:7582"
                     /db_xref="HGNC:HGNC:13097"
                     /db_xref="MIM:194522"
                     /translation="MNKVDQKFQGSVSFKDVTVGFTQEEWQHLDPSQRALYRDVMLEN
                     YSNLVSVGYCAHKPEVIFRLEQGEEPWRLEEEFPSQSFPEVWTADHLKERSQENQSKH
                     LWEVVFINNEMLTKEQGNVIGIPFNMDVSSFPSRKMFCQYDSCGMSFNTVSELVISKI
                     NYLGKKSDEFNACGKLLLNIKHDETHTREKNEVLKNRNTLSHRENTLQHEKIQTLDHN
                     FEYSICQETLLEKAVFNTRKRENAEENNCDYNEFGRTFCDSSSLLFHQIPPSKDSHYE
                     FSDCEKFLCVKSTLSKHDGVPVKHYDCGESGNNFRRKLCLSQLQKGDKGEKHFECNEC
                     GKAFWEKSHLTRHQRVHTGEKHFQCNQCGKTFWEKSNLTKHQRSHTGEKPFECNECGK
                     AFSHKSALTLHQRTHTGEKPYQCNACGKTFYQKSDLTKHQRTHTGQKPYECYECGKSF
                     CMNSHLTVHQRTHTGEKPFECLECGKSFCQKSHLTQHQRTHIGDKPYECNACGKTFYH
                     KSVLTRHQIIHTGLKPYECYECGKTFCLKSDLTIHQRTHTGEKPFACPECGKFFSHKS
                     TLSQHYRTHTGDKKKKKK"
BASE COUNT          647 a          347 c          417 g          456 t
ORIGIN      
        1 gaggcggtcc cgggatttca ggggtctacc ggctctctta tggcgaatgc aacccgaaga
       61 gagagtgagc tgtatcttca gagttgtctc cgtctttcca agaacagaac aaaatgaaca
      121 aggtagatca gaagttccag gggtcagtat catttaaaga tgtgactgtg ggcttcaccc
      181 aggaggagtg gcagcacctg gaccctagtc agagggctct gtatagagat gtgatgctgg
      241 agaactacag caaccttgtc tcagtggggt attgtgctca caaaccagag gtgatcttca
      301 ggctggaaca aggagaagaa ccatggagac tggaggaaga attcccaagc cagagctttc
      361 cagaagtctg gacagctgat cacctgaaag agaggagcca agaaaatcaa tctaaacatt
      421 tgtgggaagt tgtattcatc aataatgaaa tgctgactaa ggaacaaggt aatgtaatag
      481 gaataccatt taacatggac gtaagttctt ttccttccag aaaaatgttc tgtcagtatg
      541 actcatgtgg aatgagtttc aacactgttt cagaattggt tatcagtaag ataaactatt
      601 taggaaaaaa gtctgacgaa tttaatgcat gtgggaaatt gttactcaat attaagcatg
      661 atgaaactca tactcgagag aaaaatgaag ttttgaaaaa taggaacact ctgagtcatc
      721 gtgagaacac tttgcagcat gagaagattc aaactttaga ccacaatttt gaatacagta
      781 tatgtcagga aaccctcctt gaaaaggcag tattcaatac acggaagaga gagaatgcag
      841 aagagaataa ctgtgactat aatgaatttg ggagaacttt ctgtgatagt tcatccctct
      901 tgttccatca gatacctcca tcaaaggaca gtcactatga atttagtgat tgtgagaagt
      961 tcttatgtgt gaagtccacc ctttctaaac atgatggggt acctgtgaaa cactatgatt
     1021 gtggtgaaag tgggaataat ttcaggagga aattgtgtct gtcacagctt cagaaaggtg
     1081 ataaaggaga gaaacacttt gaatgtaatg aatgtgggaa agctttctgg gagaagtcac
     1141 atctcactcg acatcagagg gtgcacacag gagagaaaca ctttcaatgt aatcaatgtg
     1201 gaaaaacttt ctgggagaag tcaaacctca ctaaacatca gagatcacac acaggggaga
     1261 aaccttttga atgcaatgaa tgtgggaaag cctttagcca taagtcagcc ctcacattac
     1321 accagagaac acatacaggg gagaaaccct atcaatgtaa tgcatgtggg aaaacttttt
     1381 accagaaatc tgacctcact aaacatcaga gaacacacac agggcagaaa ccctatgaat
     1441 gttatgaatg tggaaaatcc ttctgtatga attcacacct tacagtacac cagagaactc
     1501 acacaggtga gaaacctttt gaatgtcttg agtgtgggaa atccttttgt caaaagtcac
     1561 atcttacaca gcatcagaga actcacatag gagataaacc ttatgaatgt aatgcatgtg
     1621 ggaaaacttt ctaccacaag tcagtactca ccaggcatca gataattcat acagggttga
     1681 aaccttatga atgttatgaa tgtgggaaaa ccttctgctt gaagtcagac ctcacaatac
     1741 atcagagaac gcacacaggg gagaaaccct ttgcatgtcc tgaatgtggg aaattcttta
     1801 gccataagtc aaccctctct caacattata gaacacacac gggggacaaa aaaaaaaaaa
     1861 aaaaaaa
//