LOCUS       BC047901                3277 bp    mRNA    linear   HUM 11-AUG-2006
DEFINITION  Homo sapiens actinin, alpha 2, mRNA (cDNA clone MGC:57723
            IMAGE:6199155), complete cds.
ACCESSION   BC047901
VERSION     BC047901.2
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 3277)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 3277)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     On Aug 25, 2003 this sequence version replaced gi:28839057.
            Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: Dr. James R. Lupski
            cDNA Library Preparation: Life Technologies, Inc.
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Sequencing Group at the Stanford Human Genome
            Center, Stanford University School of Medicine, Stanford, CA  94305
            Web site:       http://www-shgc.stanford.edu
            Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
            Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
            R. M.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAK Plate: 107 Row: o Column: 22
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 4501892.
FEATURES             Location/Qualifiers
     source          1..3277
                     /db_xref="H-InvDB:HIT000053271"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:57723 IMAGE:6199155"
                     /tissue_type="Peripheral Nervous System, sympathetic
                     trunk"
                     /clone_lib="Lupski_sympathetic_trunk"
                     /lab_host="DH10B"
                     /note="Vector: pCMV-SPORT6"
     gene            1..3277
                     /gene="ACTN2"
                     /db_xref="GeneID:88"
                     /db_xref="HGNC:164"
                     /db_xref="MIM:102573"
     CDS             153..2837
                     /gene="ACTN2"
                     /codon_start=1
                     /product="actinin, alpha 2"
                     /protein_id="AAH47901.2"
                     /db_xref="GI:34194598"
                     /db_xref="GeneID:88"
                     /db_xref="HGNC:164"
                     /db_xref="MIM:102573"
                     /translation="MNQIEPGVQYNYVYDEDEYMIQEEEWDRDLLLDPAWEKQQRKTF
                     TAWCNSHLRKAGTQIENIEEDFRNGLKLMLLLEVISGERLPKPDRGKMRFHKIANVNK
                     ALDYIASKGVKLVSIGAEEIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLW
                     CQRKTAPYRNVNIQNFHTSWKDGLGLCALIHRHRPDLIDYSKLNKDDPIGNINLAMEI
                     AEKHLDIPKMLDAEDIVNTPKPDERAIMTYVSCFYHAFAGAEQAETAANRICKVLAVN
                     QENERLMEEYERLASELLEWIRRTIPWLENRTPEKTMQAMQKKLEDFRDYRRKHKPPK
                     VQEKCQLEINFNTLQTKLRISNRPAFMPSEGKMVSDIAGAWQRLEQAEKGYEEWLLNE
                     IRRLERLEHLAEKFRQKASTHETWAYGKEQILLQKDYESASLTEVRALLRKHEAFESD
                     LAAHQDRVEQIAAIAQELNELDYHDAVNVNDRCQKICDQWDRLGTLTQKRREALERME
                     KLLETIDQLHLEFAKRAAPFNNWMEGAMEDLQDMFIVHSIEEIQSLITAHEQFKATLP
                     EADGERQSIMAIQNEVEKVIQSYNIRISSSNPYSTVTMDELRTKWDKVKQLVPIRDQS
                     LQEELARQHANERLRRQFAAQANAIGPWIQNKMEEIARSSIQITGALEDQMNQLKQYE
                     HNIINYKNNIDKLEGDHQLIQEALVFDNKHTNYTMEHIRVGWELLLTTIARTINEVET
                     QILTRDAKGITQEQMNEFRASFNHFDRRKNGLMDHEDFRACLISMGYDLGEAEFARIM
                     TLVDPNGQGTVTFQSFIDFMTRETADTDTAEQVIASFRILASDKPYILAEELRRELPP
                     DQAQYCIKRMPAYSGPGSVPGALDYAAFSSALYGESDL"
BASE COUNT          922 a          806 c          903 g          646 t
ORIGIN      
        1 ccagcgccca ggcgtgtcgc cccgagagga gccgcgcgaa ggtcaccccg cgcccgccgc
       61 ccgccgcccg ccgcctccgt gggtccgttt gccagtcagc ccgtgcgtcc gagcccctcg
      121 cgccccgccg cagccccggc caaccgagcg ccatgaacca gatagagccc ggcgtgcagt
      181 acaactacgt gtacgacgag gatgagtaca tgatccagga ggaggagtgg gaccgcgacc
      241 tgctcctgga cccagcctgg gagaagcagc agaggaagac cttcactgcc tggtgtaact
      301 cccacctaag gaaagccggc acccagattg agaacatcga ggaagacttc aggaatggcc
      361 ttaagctcat gctgcttttg gaagtcatct caggggaaag gctgcccaaa cctgaccggg
      421 gaaaaatgcg gttccacaaa attgctaatg tcaacaaagc tttggattac atagccagca
      481 aaggggtgaa actggtgtcc atcggcgctg aagaaattgt tgatggcaat gtgaaaatga
      541 ccctgggtat gatctggacc atcatccttc gctttgctat tcaggatatt tcggttgaag
      601 aaacatctgc caaagaaggt ctgctgcttt ggtgtcagag gaaaactgct ccttatagaa
      661 atgtgaacat tcagaacttc catactagct ggaaagatgg ccttggactc tgtgccctca
      721 tccaccgaca ccggcctgac ctcattgact actcaaagct taacaaggat gaccccatag
      781 gaaatattaa cctggccatg gaaatcgctg agaagcacct ggatattcct aaaatgttgg
      841 atgctgaaga catcgtgaac acccctaaac ccgatgaaag agccatcatg acgtacgtct
      901 cttgcttcta ccacgctttt gcgggcgcgg agcaggccga gacagcggct aacaggatat
      961 gtaaggttct tgctgtgaat caagagaatg agaggctgat ggaagaatat gagaggctag
     1021 cgagtgagct tttggaatgg attcgtcgca cgatcccctg gctggagaac cggactcccg
     1081 agaagaccat gcaagccatg cagaagaagc tggaggactt ccgggattac cgccggaagc
     1141 acaagccacc caaggtgcag gagaaatgcc agctggagat caacttcaac acgctgcaga
     1201 ccaagctgcg gatcagcaac cgtcctgcct tcatgccctc cgagggcaag atggtgtcgg
     1261 atattgctgg tgcctggcag aggctggagc aggctgagaa gggttacgag gagtggttgc
     1321 tcaatgagat tcggagactg gagcgcttgg aacacctggc tgagaagttc aggcagaagg
     1381 cctcaacgca cgagacttgg gcttatggca aagagcagat cttgctgcag aaggattacg
     1441 agtcggcgtc gctgacagag gtgcgggctc tgctgcggaa gcacgaggcg ttcgagagcg
     1501 acctggcagc gcaccaggac cgcgtggagc agatcgcagc catcgcgcag gagctcaatg
     1561 aactggacta tcacgacgct gtgaatgtca atgatcggtg ccagaaaatt tgtgaccagt
     1621 gggaccgact gggaacgctt actcagaaga ggagagaagc cctagagaga atggagaaat
     1681 tgctagaaac cattgatcag cttcacctgg agtttgccaa gagggctgct cctttcaaca
     1741 attggatgga gggcgctatg gaggatctgc aagatatgtt cattgtccac agcattgagg
     1801 agatccagag tctgatcact gcgcatgagc agttcaaggc cacgctgccc gaggcggacg
     1861 gagagcggca gtccatcatg gccatccaga acgaggtgga gaaggtgatt cagagctaca
     1921 acatcagaat cagctcaagc aacccgtaca gcactgtcac catggatgag ctccggacca
     1981 agtgggacaa ggtgaagcaa ctcgtgccca tccgcgatca atccctgcag gaggagctgg
     2041 ctcgccagca tgctaacgag cgtctgaggc gccagtttgc tgcccaagcc aatgccattg
     2101 ggccctggat ccagaacaag atggaggaga ttgcccggag ctccatccag atcacaggag
     2161 ccctggaaga ccagatgaac cagctgaagc agtatgagca caacatcatc aactataaga
     2221 acaacatcga caagctggag ggagaccatc agctcatcca ggaggccctt gtctttgaca
     2281 acaagcacac gaactacacg atggagcaca ttcgtgttgg atgggagctg ctgctgacaa
     2341 ccatcgccag aaccatcaat gaggtggaga ctcagatcct gacgagagat gcgaagggca
     2401 tcacccagga gcagatgaat gagttcagag cctccttcaa ccactttgac aggaggaaga
     2461 atggcctgat ggatcatgag gatttcagag cctgcctgat ttccatgggt tatgacctgg
     2521 gtgaagccga atttgcccgc attatgaccc tggtagatcc caacgggcaa ggcaccgtca
     2581 ccttccaatc cttcatcgac ttcatgacta gagagacggc tgacaccgac actgccgagc
     2641 aggtcatcgc ctccttccgg atcctggctt ctgataagcc atacatcctg gcggaggagc
     2701 tgcgtcggga gctgcccccg gatcaggccc agtactgcat caagaggatg cccgcctact
     2761 cgggcccagg cagtgtgcct ggtgcactgg attacgctgc gttctcttcc gcactctacg
     2821 gggagagcga tctgtgatgc tgagcttctg taatcactca tcccatcaga atgcaataaa
     2881 agcggaagtc acagtttgtt tcctggaaac tttgacaagc tttattaagt tgagagagag
     2941 agagggggaa aaaaaaagcc tttcgtagtt cagtaattgc cagcaatata acacggctaa
     3001 aatgaagttt ttacagtata tgacatagtg cgcttcataa ataggtttat ttctgagttt
     3061 ttagcaaaat gtaatgaaat atcaggttga tttctttgat taaacagaac aaattacttg
     3121 agtaatagga aattaggagg atctagggac agaaggaaag tgaaaaatgt gaaaatacaa
     3181 aatacccaag atttaagacc ggggggaaaa aaccacaaat tggtaaataa aggtttgcta
     3241 tttgtaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaa
//