LOCUS       BC047773                1945 bp    mRNA    linear   HUM 07-OCT-2003
DEFINITION  Homo sapiens bone morphogenetic protein receptor, type IB, mRNA
            (cDNA clone MGC:54267 IMAGE:6202951), complete cds.
ACCESSION   BC047773
VERSION     BC047773.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1945)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 1945)
  AUTHORS   Strausberg,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) National Institutes of Health, Mammalian
            Gene Collection (MGC), Cancer Genomics Office, National Cancer
            Institute, 31 Center Drive, Room 11A03, Bethesda, MD 20892-2590,
            USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: Dr. James R. Lupski
            cDNA Library Preparation: Life Technologies, Inc.
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Sequencing Group at the Stanford Human Genome
            Center, Stanford University School of Medicine, Stanford, CA  94305
            Web site:       http://www-shgc.stanford.edu
            Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
            Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
            R. M.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAK Plate: 98 Row: n Column: 1
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 4502430.
FEATURES             Location/Qualifiers
     source          1..1945
                     /db_xref="H-InvDB:HIT000053249"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:54267 IMAGE:6202951"
                     /tissue_type="Peripheral Nervous System, sciatic nerve"
                     /clone_lib="Lupski_sciatic_nerve"
                     /lab_host="DH10B"
                     /note="Vector: pCMV-SPORT6"
     gene            1..1945
                     /gene="BMPR1B"
                     /gene_synonym="ALK-6"
                     /gene_synonym="ALK6"
                     /db_xref="GeneID:658"
                     /db_xref="MIM:603248"
     CDS             71..1579
                     /gene="BMPR1B"
                     /gene_synonym="ALK-6"
                     /gene_synonym="ALK6"
                     /codon_start=1
                     /product="BMPR1B protein"
                     /protein_id="AAH47773.1"
                     /db_xref="GeneID:658"
                     /db_xref="MIM:603248"
                     /translation="MLLRSAGKLNVGTKKEDGESTAPTPRPKVLRCKCHHHCPEDSVN
                     NICSTDGYCFTMIEEDDSGLPVVTSGCLGLEGSDFQCRDTPIPHQRRSIECCTERNEC
                     NKDLHPTLPPLKNRDFVDGPIHHRALLISVTVCSLLLVLIILFCYFRYKRQETRPRYS
                     IGLEQDETYIPPGESLRDLIEQSQSSGSGSGLPLLVQRTIAKQIQMVKQIGKGRYGEV
                     WMGKWRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGTGSWTQLY
                     LITDYHENGSLYDYLKSTTLDAKSMLKLAYSSVSGLCHLHTEIFSTQGKPAIAHRDLK
                     SKNILVKKNGTCCIADLGLAVKFISDTNEVDIPPNTRVGTKRYMPPEVLDESLNRNHF
                     QSYIMADMYSFGLILWEVARRCVSGGIVEEYQLPYHDLVPSDPSYEDMREIVCIKKLR
                     PSFPNRWSSDECLRQMGKLMTECWAHNPASRLTALRVKKTLAKMSESQDIKL"
     misc_feature    143..400
                     /gene="BMPR1B"
                     /gene_synonym="ALK-6"
                     /gene_synonym="ALK6"
                     /note="Activin_recp; Region: Activin types I and II
                     receptor domain. This Pfam entry consists of both TGF-beta
                     receptor types. This is an alignment of the hydrophilic
                     cysteine-rich ligand-binding domains, Both receptor types,
                     (type I and II) posses a 9 amino acid cysteine box, with
                     the the consensus CCX{4-5}CN. The type I receptors also
                     possess 7 extracellular residues preceding the cysteine
                     box"
                     /db_xref="CDD:pfam01064"
     misc_feature    680..1543
                     /gene="BMPR1B"
                     /gene_synonym="ALK-6"
                     /gene_synonym="ALK6"
                     /note="pkinase; Region: Protein kinase domain"
                     /db_xref="CDD:pfam00069"
BASE COUNT          591 a          409 c          447 g          498 t
ORIGIN      
        1 gactggggta gtctacccca cagatgccta actctcacta tttcttcttt cagcaaactt
       61 ccttgataac atgcttttgc gaagtgcagg aaaattaaat gtgggcacca agaaagagga
      121 tggtgagagt acagccccca ccccccgtcc aaaggtcttg cgttgtaaat gccaccacca
      181 ttgtccagaa gactcagtca acaatatttg cagcacagac ggatattgtt tcacgatgat
      241 agaagaggat gactctgggt tgcctgtggt cacttctggt tgcctaggac tagaaggctc
      301 agattttcag tgtcgggaca ctcccattcc tcatcaaaga agatcaattg aatgctgcac
      361 agaaaggaac gaatgtaata aagacctaca ccctacactg cctccattga aaaacagaga
      421 ttttgttgat ggacctatac accacagggc tttacttata tctgtgactg tctgtagttt
      481 gctcttggtc cttatcatat tattttgtta cttccggtat aaaagacaag aaaccagacc
      541 tcgatacagc attgggttag aacaggatga aacttacatt cctcctggag aatccctgag
      601 agacttaatt gagcagtctc agagctcagg aagtggatca ggcctccctc tgctggtcca
      661 aaggactata gctaagcaga ttcagatggt gaaacagatt ggaaaaggtc gctatgggga
      721 agtttggatg ggaaagtggc gtggcgaaaa ggtagctgtg aaagtgttct tcaccacaga
      781 ggaagccagc tggttcagag agacagaaat atatcagaca gtgttgatga ggcatgaaaa
      841 cattttgggt ttcattgctg cagatatcaa agggacaggg tcctggaccc agttgtacct
      901 aatcacagac tatcatgaaa atggttccct ttatgattat ctgaagtcca ccaccctaga
      961 cgctaaatca atgctgaagt tagcctactc ttctgtcagt ggcttatgtc atttacacac
     1021 agaaatcttt agtactcaag gcaaaccagc aattgcccat cgagatctga aaagtaaaaa
     1081 cattctggtg aagaaaaatg gaacttgctg tattgctgac ctgggcctgg ctgttaaatt
     1141 tattagtgat acaaatgaag ttgacatacc acctaacact cgagttggca ccaaacgcta
     1201 tatgcctcca gaagtgttgg acgagagctt gaacagaaat cacttccagt cttacatcat
     1261 ggctgacatg tatagttttg gcctcatcct ttgggaggtt gctaggagat gtgtatcagg
     1321 aggtatagtg gaagaatacc agcttcctta tcatgaccta gtgcccagtg acccctctta
     1381 tgaggacatg agggagattg tgtgcatcaa gaagttacgc ccctcattcc caaaccggtg
     1441 gagcagtgat gagtgtctaa ggcagatggg aaaactcatg acagaatgct gggctcacaa
     1501 tcctgcatca aggctgacag ccctgcgggt taagaaaaca cttgccaaaa tgtcagagtc
     1561 ccaggacatt aaactctgat aggagaggaa aagtaagcat ctctgcagaa agccaacagg
     1621 tactcttctg tttgtgggca gagcaaaaga catcaaataa gcatccacag tacaagcctt
     1681 gaacatcgtc ctgcttccca gtgggttcag acctcacctc tcagggagcg acctgggcaa
     1741 agacagagaa gctcccagaa ggagagattg atccatgtct gtttgtagga cggagaaacc
     1801 gcttgggtaa cttgttcaag atatgatgca tgttgctttc taagaaagcc ctgtattttg
     1861 tgattgcctt tttttttttt taagatgctt tcattttgcc aaaataaaac agataatgtg
     1921 gaaaaaaaaa aaaaaaaaaa aaaaa
//