LOCUS       BC046929                2451 bp    mRNA    linear   HUM 04-NOV-2003
DEFINITION  Homo sapiens tuberous sclerosis 2, mRNA (cDNA clone IMAGE:3687567),
            partial cds.
ACCESSION   BC046929
VERSION     BC046929.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2451)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 2451)
  AUTHORS   Strausberg,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (14-FEB-2003) National Institutes of Health, Mammalian
            Gene Collection (MGC), Cancer Genomics Office, National Cancer
            Institute, 31 Center Drive, Room 11A03, Bethesda, MD 20892-2590,
            USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: Louis M. Staudt, M.D., Ph.D.
            cDNA Library Preparation: Rubin Laboratory
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: National Institutes of Health Intramural
            Sequencing Center (NISC),
            Gaithersburg, Maryland;
            Web site: http://www.nisc.nih.gov/
            Contact: nisc_mgc@nhgri.nih.gov
            Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
            Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
            Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
            Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
            Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
            McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
            Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
            Young,A., Zhang,L.-H. and Green,E.D.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 44 Row: b Column: 4.
FEATURES             Location/Qualifiers
     source          1..2451
                     /db_xref="H-InvDB:HIT000098399"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="IMAGE:3687567"
                     /tissue_type="Lymph, Burkitt lymphoma"
                     /clone_lib="NIH_MGC_8"
                     /lab_host="DH10B-R"
                     /note="Vector: pOTB7"
     gene            <1..2451
                     /gene="TSC2"
                     /gene_synonym="LAM"
                     /gene_synonym="TUBERIN"
                     /db_xref="GeneID:7249"
                     /db_xref="MIM:191092"
     CDS             <1..2343
                     /gene="TSC2"
                     /gene_synonym="LAM"
                     /gene_synonym="TUBERIN"
                     /codon_start=1
                     /product="TSC2 protein"
                     /protein_id="AAH46929.1"
                     /db_xref="GeneID:7249"
                     /db_xref="MIM:191092"
                     /translation="ENSVAQADDSLKNLHLELTETCLDMMARYVFSNFTAVPKRSPVG
                     EFLLAGGRTKTWLVGNKLVTVTTSVGTGTRSLLGLDSGELQSGPESSSSPGVHVRQTK
                     EAPAKLESQAGQQVSRGARDRVRSMSGGHGLRVGALDVPASQFLGSATSPGPRTAPAA
                     KPEKASAGTRVPVQEKTNLAAYVPLLTQGWAEILVRRPTGNTSWLMSLENPLSPFSSD
                     INNMPLQELSNALMAAERFKEHRDTALYKSLSVPAASTAKPPPLPRSNTDSAVVMEEG
                     SPGEVPVLVEPPGLEDVEAALGMDRRTDAYSRSSSVSSQEEKSLHAEELVGRGIPIER
                     VVSSEGGRPSVDLSFQPSQPLSKSSSSPELQTLQDILGDPGDKADVGRLSPEVKARSQ
                     SGTLDGESAAWSASGEDSRGQPEGPLPSSSPRSPSGLRPRGYTISDSAPSRRGKRVER
                     DALKSRATASNAEKVPGINPSFVFLQLYHSPFFGDESNKPILLPNESQSFERSVQLLD
                     QIPSYDTHKIAVLYVGEGQSNSELAILSNEHGSYRYTEFLTGLGRLIELKDCQPDKVY
                     LGGLDVCGEDGQFTYCWHDDIMQAVFHIATLMPTKDVDKHRCDKKRHLGNDFVSIVYN
                     DSGEDFKLGTIKGQFNFVHVIVTPLDYECNLVSLQCRKDMEGLVDTSVAKIVSDRNLP
                     FVARQMALHANMASQVHHSRSNPTDIYPSKWIARLRHIKRLRQRICEEAAYSNPSLPL
                     VHPPSHSKAPAQTPAEPTPGYEVGQRKRLISSVEDFTEFV"
     misc_feature    1600..2151
                     /gene="TSC2"
                     /gene_synonym="LAM"
                     /gene_synonym="TUBERIN"
                     /note="Rap_GAP; Region: Rap/ran-GAP"
                     /db_xref="CDD:pfam02145"
BASE COUNT          504 a          803 c          727 g          417 t
ORIGIN      
        1 gagaactccg tggcccaggc tgacgatagc ctgaaaaacc tccacctgga gctcacggaa
       61 acctgtctgg acatgatggc tcgatacgtc ttctccaact tcacggctgt cccgaagagg
      121 tctcctgtgg gcgagttcct cctagcgggt ggcaggacca aaacctggct ggttgggaac
      181 aagcttgtca ctgtgacgac aagcgtggga accgggaccc ggtcgttact aggcctggac
      241 tcgggggagc tgcagtccgg cccggagtcg agctccagcc ccggggtgca tgtgagacag
      301 accaaggagg cgccggccaa gctggagtcc caggctgggc agcaggtgtc ccgtggggcc
      361 cgggatcggg tccgttccat gtcggggggc catggtcttc gagttggcgc cctggacgtg
      421 ccggcctccc agttcctggg cagtgccact tctccaggac cacggactgc accagccgcg
      481 aaacctgaga aggcctcagc tggcacccgg gttcctgtgc aggagaagac gaacctggcg
      541 gcctatgtgc ccctgctgac ccagggctgg gcggagatcc tggtccggag gcccacaggg
      601 aacaccagct ggctgatgag cctggagaac ccgctcagcc ctttctcctc ggacatcaac
      661 aacatgcccc tgcaggagct gtctaacgcc ctcatggcgg ctgagcgctt caaggagcac
      721 cgggacacag ccctgtacaa gtcactgtcg gtgccggcag ccagcacggc caaaccccct
      781 cctctgcctc gctccaacac agactccgcc gtggtcatgg aggagggaag tccgggcgag
      841 gttcctgtgc tggtggagcc cccagggttg gaggacgttg aggcagcgct aggcatggac
      901 aggcgcacgg atgcctacag caggtcgtcc tcagtctcca gccaggagga gaagtcgctc
      961 cacgcggagg agctggttgg caggggcatc cccatcgagc gagtcgtctc ctcggagggt
     1021 ggccggccct ctgtggacct ctccttccag ccctcgcagc ccctgagcaa gtccagctcc
     1081 tctcccgagc tgcagactct gcaggacatc ctcggggacc ctggggacaa ggccgacgtg
     1141 ggccggctga gccctgaggt taaggcccgg tcacagtcag ggaccctgga cggggaaagt
     1201 gctgcctggt cggcctcggg cgaagacagt cggggccagc ccgagggtcc cttgccttcc
     1261 agctcccccc gctcgcccag tggcctccgg ccccgaggtt acaccatctc cgactcggcc
     1321 ccatcacgca ggggcaagag agtagagagg gacgccttaa agagcagagc cacagcctcc
     1381 aatgcagaga aagtgccagg catcaacccc agtttcgtgt tcctgcagct ctaccattcc
     1441 cccttctttg gcgacgagtc aaacaagcca atcctgctgc ccaatgagtc acagtccttt
     1501 gagcggtcgg tgcagctcct cgaccagatc ccatcatacg acacccacaa gatcgccgtc
     1561 ctgtatgttg gagaaggcca gagcaacagc gagctcgcca tcctgtccaa tgagcatggc
     1621 tcctacaggt acacggagtt cctgacgggc ctgggccggc tcatcgagct gaaggactgc
     1681 cagccggaca aggtgtacct gggaggcctg gacgtgtgtg gtgaggacgg ccagttcacc
     1741 tactgctggc acgatgacat catgcaagcc gtcttccaca tcgccaccct gatgcccacc
     1801 aaggacgtgg acaagcaccg ctgcgacaag aagcgccacc tgggcaacga ctttgtgtcc
     1861 attgtctaca atgactccgg tgaggacttc aagcttggca ccatcaaggg ccagttcaac
     1921 tttgtccacg tgatcgtcac cccgctggac tacgagtgca acctggtgtc cctgcagtgc
     1981 aggaaagaca tggagggcct tgtggacacc agcgtggcca agatcgtgtc tgaccgcaac
     2041 ctgcccttcg tggcccgcca gatggccctg cacgcaaata tggcctcaca ggtgcatcat
     2101 agccgctcca accccaccga catctacccc tccaagtgga ttgcccggct ccgccacatc
     2161 aagcggctcc gccagcggat ctgcgaggaa gccgcctact ccaaccccag cctacctctg
     2221 gtgcaccctc cgtcccatag caaagcccct gcacagactc cagccgagcc cacacctggc
     2281 tatgaggtgg gccagcggaa gcgcctcatc tcctcggtgg aggacttcac cgagtttgtg
     2341 tgaggccggg gccctccctc ctgcactggc cttggacggt attgcctgtc agtgaaataa
     2401 ataaagtcct gaccccagtg cacagaaaaa aaaaaaaaaa aaaaaaaaaa a
//