LOCUS       BC044233                2488 bp    mRNA    linear   HUM 15-JUL-2006
DEFINITION  Homo sapiens leucine rich repeat containing 33, mRNA (cDNA clone
            MGC:50789 IMAGE:5725567), complete cds.
ACCESSION   BC044233
VERSION     BC044233.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2488)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 2488)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (13-JAN-2003) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: Invitrogen
            cDNA Library Preparation: Life Technologies, Inc.
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Genome Sequence Centre,
            BC Cancer Agency, Vancouver, BC, Canada
            info@bcgsc.bc.ca
            Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
            Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
            Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
            Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
            Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
            Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
            Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
            Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
            Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAK Plate: 89 Row: e Column: 20
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 38348405.
FEATURES             Location/Qualifiers
     source          1..2488
                     /db_xref="H-InvDB:HIT000052853"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:50789 IMAGE:5725567"
                     /tissue_type="Ovary, pooled from 3 adults"
                     /clone_lib="NIH_MGC_125"
                     /lab_host="DH10B"
                     /note="Vector: pCMV-SPORT6"
     gene            1..2488
                     /gene="LRRC33"
                     /gene_synonym="GARPL1"
                     /gene_synonym="MGC50789"
                     /gene_synonym="UNQ3030"
                     /db_xref="GeneID:375387"
                     /db_xref="HGNC:HGNC:24613"
     CDS             105..2183
                     /gene="LRRC33"
                     /gene_synonym="GARPL1"
                     /gene_synonym="MGC50789"
                     /gene_synonym="UNQ3030"
                     /codon_start=1
                     /product="leucine rich repeat containing 33"
                     /protein_id="AAH44233.1"
                     /db_xref="GeneID:375387"
                     /db_xref="HGNC:HGNC:24613"
                     /translation="MELLPLWLCLGFHFLTVGWRNRSGTATAASQGVCKLVGGAADCR
                     GQSLASVPSSLPPHARMLTLDANPLKTLWNHSLQPYPLLESLSLHSCHLERISRGAFQ
                     EQGHLRSLVLGDNCLSENYEETAAALHALPGLRRLDLSGNALTEDMAALMLQNLSSLR
                     SVSLAGNTIMRLDDSVFEGLERLRELDLQRNYIFEIEGGAFDGLAELRHLNLAFNNLP
                     CIVDFGLTRLRVLNVSYNVLEWFLATGGEAAFELETLDLSHNQLLFFPLLPQYSKLRT
                     LLLRDNNMGFYRDLYNTSSPREMVAQFLLVDGNVTNITTVSLWEEFSSSDLADLRFLD
                     MSQNQFQYLPDGFLRKMPSLSHLNLHQNCLMTLHIREHEPPGALTELDLSHNQLSELH
                     LAPGLASCLGSLRLFNLSSNQLLGVPPGLFANARNITTLDMSHNQISLCPLPAASDRV
                     GPPSCVDFRNMASLRSLSLEGCGLGALPDCPFQGTSLTYLDLSSNWGVLNGSLAPLQD
                     VAPMLQVLSLRNMGLHSSFMALDFSGFGNLRDLDLSGNCLTTFPRFGGSLALETLDLR
                     RNSLTALPQKAVSEQLSRGLRTIYLSQNPYDCCGVDGWGALQHGQTVADWAMVTCNLS
                     SKIIRVTELPGGVPRDCKWERLDLGLLYLVLILPSCLTLLVACTVIVLTFKKPLLQVI
                     KSRCHWSSVY"
BASE COUNT          486 a          814 c          667 g          521 t
ORIGIN      
        1 ggtagcccag ccccgcgttc ggctgctctc gaggaggccg gagcccccgg agacgatgcg
       61 ccccgcgcag ccgcctgcgc ctgcgggagc cggctgccct tgagatggag ttgctgcctc
      121 tttggctctg cctgggtttt cacttcctga ccgtgggctg gaggaacaga agcggaacag
      181 ccacagcagc ctcccaagga gtctgcaagt tggtgggtgg agccgctgac tgccgagggc
      241 agagcctcgc ttcggtgccc agcagcctcc cgccccacgc ccggatgctc accctggatg
      301 ccaaccctct caagaccctg tggaatcact ccctccagcc ttaccctctc ctggagagcc
      361 tcagcctgca cagctgccac ctggagcgca tcagccgcgg cgccttccag gagcaaggtc
      421 acctgcgcag cctggtactg ggggacaact gcctctcaga gaactacgaa gagacggcag
      481 ccgccctcca cgccctgccg ggcctgcgga ggctggactt gtcaggaaac gccctgacgg
      541 aggacatggc agcgctcatg ctccagaacc tctcctcgct gcggtccgtg tccctggcgg
      601 ggaacaccat catgcggctg gacgactccg tcttcgaggg cctggagcgt ctccgggagc
      661 tggatctgca gaggaactac atcttcgaga tcgagggcgg cgctttcgac ggcctggctg
      721 agctgaggca cctcaacctg gccttcaaca acctcccctg catcgtggac ttcgggctca
      781 cgcggctgcg ggtcctcaac gtcagctaca acgtcctgga gtggttcctc gcgaccgggg
      841 gagaggctgc cttcgagctg gagacgctgg acctgtctca caaccagctg ctgttcttcc
      901 cgctgctgcc ccagtacagc aagttgcgga ccctcctgct gcgcgacaac aacatgggct
      961 tctaccggga cctgtacaac acctcgtcgc cgagggagat ggtggcccag ttcctcctcg
     1021 tggacggcaa cgtgaccaac atcaccaccg tcagcctctg ggaagaattc tcctccagcg
     1081 acctcgcaga tctccgcttc ctggacatga gccagaacca gttccagtac ctgccagacg
     1141 gcttcctgag gaaaatgcct tccctctccc acctgaacct ccaccagaat tgcctgatga
     1201 cgcttcacat tcgggagcac gagccccccg gagcgctcac cgagctggac ctgagccaca
     1261 accagctgtc ggagctgcac ctggctccgg ggctggccag ctgcctgggc agcctgcgct
     1321 tgttcaacct gagctccaac cagctcctgg gcgtcccccc tggcctcttc gccaatgcta
     1381 ggaacatcac tacacttgac atgagccaca atcagatctc actttgtccc ctgccagctg
     1441 cctcggaccg ggtgggcccc cctagctgtg tggatttcag gaatatggca tctttaagga
     1501 gcctgtctct ggagggctgt ggcctggggg cattgccaga ctgcccattc caagggacct
     1561 ccctgaccta cttagacctc tcaagcaact ggggggttct gaatgggagc ctcgccccac
     1621 tccaggatgt tgcccccatg ttacaggtcc tgtctctcag gaacatgggc ctccactcca
     1681 gctttatggc gttggacttc tctgggtttg ggaatctcag ggacttagat ctgtcgggga
     1741 attgcttgac caccttccca aggtttgggg gcagcctggc cctggagacc ctggatctcc
     1801 gtagaaactc gctcacagcc cttccccaga aggctgtgtc tgagcagctc tcgagaggtc
     1861 tgcggaccat ctacctcagt cagaatccat atgactgctg tggggtggat ggctgggggg
     1921 ccctgcagca tgggcagacg gtggccgact gggccatggt cacctgcaac ctctcctcca
     1981 agatcatccg cgtgacggag ctgcccggag gtgtgcctcg ggactgcaag tgggagcggc
     2041 tggacctggg cctgctctac ctcgtgctca tcctccccag ctgcctcacc ctgctggtgg
     2101 cctgcactgt catcgtcctc acttttaaga agcctctgct tcaggtcatc aagagccgct
     2161 gccactggtc ctccgtttac tgacctggct gtgtgccaag actcgaaatt cggtccgcac
     2221 acaacaggac actttctctg ccagctttca agatgtgatg cagaggccaa gtctgacgaa
     2281 ttgaagtttc aattaaaatt taatatgttt ccattcctca tcgcccaccc cacccccgcc
     2341 cccaccaccg cccaagttct ttttccatca ttataattca tccttattat cttggtaaaa
     2401 tatttattaa gtgacttttt cagaaataaa aggcaacgtg tctcataaat attttttaaa
     2461 ttaaaaaaaa aaaaaaaaaa aaaaaaaa
//