LOCUS       BC043399                2220 bp    mRNA    linear   HUM 18-MAR-2009
DEFINITION  Homo sapiens ets variant 6, mRNA (cDNA clone MGC:50884
            IMAGE:6014394), complete cds.
ACCESSION   BC043399
VERSION     BC043399.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2220)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 2220)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-JAN-2003) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC
            cDNA Library Preparation: Life Technologies, Inc.
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Genome Sequence Centre,
            BC Cancer Agency, Vancouver, BC, Canada
            info@bcgsc.bc.ca
            Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
            Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
            Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
            Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
            Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
            Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
            Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
            Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
            Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAK Plate: 89 Row: k Column: 18
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 41872473.
FEATURES             Location/Qualifiers
     source          1..2220
                     /db_xref="H-InvDB:HIT000052808"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:50884 IMAGE:6014394"
                     /tissue_type="Testis, embryonal carcinoma"
                     /clone_lib="NIH_MGC_92"
                     /lab_host="DH10B"
                     /note="Vector: pCMV-SPORT6"
     gene            1..2220
                     /gene="ETV6"
                     /gene_synonym="TEL"
                     /gene_synonym="TEL/ABL"
                     /db_xref="GeneID:2120"
                     /db_xref="HGNC:HGNC:3495"
                     /db_xref="MIM:600618"
     CDS             275..1633
                     /gene="ETV6"
                     /gene_synonym="TEL"
                     /gene_synonym="TEL/ABL"
                     /codon_start=1
                     /product="ets variant 6"
                     /protein_id="AAH43399.1"
                     /db_xref="GI:27695076"
                     /db_xref="GeneID:2120"
                     /db_xref="HGNC:HGNC:3495"
                     /db_xref="MIM:600618"
                     /translation="MSETPAQCSIKQERISYTPPESPVPSYASSTPLHVPVPRALRME
                     EDSIRLPAHLRLQPIYWSRDDVAQWLKWAENEFSLRPIDSNTFEMNGKALLLLTKEDF
                     RYRSPHSGDVLYELLQHILKQRKPRILFSPFFHPGNSIHTQPEVILHQNHEEDNCVQR
                     TPRPSVDNVHHNPPTIELLHRSRSPITTNHRPSPDPEQRPLRSPLDNMIRRLSPAERA
                     QGPRPHQENNHQESYPLSVSPMENNHCPASSESHPKPSSPRQESTRVIQLMPSPIMHP
                     LILNPRHSVDFKQSRLSEDGLHREGKPINLSHREDLAYMNHIMVSVSPPEEHAMPIGR
                     IADCRLLWDYVYQLLSDSRYENFIRWEDKESKIFRIVDPNGLARLWGNHKNRTNMTYE
                     KMSRALRHYYKLNIIRKEPGQRLLFRFMKTPDEIMSGRTDRLEHLESQELDEQIYQED
                     EC"
BASE COUNT          555 a          651 c          546 g          468 t
ORIGIN      
        1 gcgtcccggg tccccgcgcc gcgccgcgac ctgcagaccc cgccgccgcg ctcgggcccg
       61 tctcccacgc ccccgccgcc ccgcgcgccc aactccgccg gccgccccgc cccgccccgc
      121 gcgctccaga cccccggggc ggctgccggg agagatgctg gaagaaactt cttaaatgac
      181 cgcgtctggc tggccgtgga gcctttctgg gttggggaga ggaaaggaaa gtggaaaaaa
      241 cctgagaact tcctgatctc tctcgctgtg agacatgtct gagactcctg ctcagtgtag
      301 cattaagcag gaacgaattt catatacacc tccagagagc ccagtgccga gttacgcttc
      361 ctcgacgcca cttcatgttc cagtgcctcg agcgctcagg atggaggaag actcgatccg
      421 cctgcctgcg cacctgcgct tgcagccaat ttactggagc agggatgacg tagcccagtg
      481 gctcaagtgg gctgaaaatg agttttcttt aaggccaatt gacagcaaca cgtttgaaat
      541 gaatggcaaa gctctcctgc tgctgaccaa agaggacttt cgctatcgat ctcctcattc
      601 aggtgatgtg ctctatgaac tccttcagca tattctgaag cagaggaaac ctcggattct
      661 tttttcacca ttcttccacc ctggaaactc tatacacaca cagccggagg tcatactgca
      721 tcagaaccat gaagaagata actgtgtcca gaggaccccc aggccatccg tggataatgt
      781 gcaccataac cctcccacca ttgaactgtt gcaccgctcc aggtcaccta tcacgacaaa
      841 tcaccggcct tctcctgacc ccgagcagcg gcccctccgg tcccccctgg acaacatgat
      901 ccgccgcctc tccccggctg agagagctca gggacccagg ccgcaccagg agaacaacca
      961 ccaggagtcc taccctctgt cagtgtctcc catggagaat aatcactgcc cagcgtcctc
     1021 cgagtcccac ccgaagccat ccagcccccg gcaggagagc acacgcgtga tccagctgat
     1081 gcccagcccc atcatgcacc ctctgatcct gaacccccgg cactccgtgg atttcaaaca
     1141 gtccaggctc tccgaggacg ggctgcatag ggaagggaag cccatcaacc tctctcatcg
     1201 ggaagacctg gcttacatga accacatcat ggtctctgtc tccccgcctg aagagcacgc
     1261 catgcccatt gggagaatag cagactgtag actgctttgg gattacgtct atcagttgct
     1321 ttctgacagc cggtacgaaa acttcatccg atgggaggac aaagaatcca aaatattccg
     1381 gatagtggat cccaacggac tggctcgact gtggggaaac cataagaaca gaacaaacat
     1441 gacctatgag aaaatgtcca gagccctgcg ccactactac aaactaaaca ttatcaggaa
     1501 ggagccagga caaaggcttt tgttcaggtt tatgaaaacc ccagatgaaa tcatgagtgg
     1561 ccgaacagac cgtctggagc acctagagtc ccaggagctg gatgaacaaa tataccaaga
     1621 agatgaatgc tgaaggaacc aacagtccac ctcagcgggc cagcagccca gggaacccct
     1681 gcccaccagg attgctggaa gtgtgacgga gcaggcgggc tgaggagagt ggaaaaggaa
     1741 gcgacccaga aatggcaggg acacttctct tgcagaccaa gagggaccct ggagcacctt
     1801 agacaaacta cccagcacag gcggggctgg aattctggcg gagggcacga gcctgggact
     1861 ccatgtcacg tttccttctg atttggaatc tctccatctg taattcctca ccctcaccct
     1921 tccaccgttg ttagtatcat ggtgtttttg tttttgtttt tgttttaaga acctgcagtt
     1981 tgactcttca tcgttcatct aggggaagac atctgatgtt gttttcctat ggaaatatat
     2041 atctattata tatatatttt ttgcaaatct cacaaagtgc ggcaagccca gctggtcagg
     2101 aaagagaata cttgcagagg ggttcaggtt cctctttttc ctgccacgtg gatcaggtct
     2161 gttcctgtta ctgttgggtc ttggctgaaa aaaaaaatgc ttttaaaaaa aaaaaaaaaa
//