LOCUS       BC043391                2357 bp    mRNA    linear   HUM 15-JUL-2006
DEFINITION  Homo sapiens TAF7-like RNA polymerase II, TATA box binding protein
            (TBP)-associated factor, 50kDa, mRNA (cDNA clone MGC:50682
            IMAGE:6154641), complete cds.
ACCESSION   BC043391
VERSION     BC043391.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2357)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 2357)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-JAN-2003) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC
            cDNA Library Preparation: Life Technologies, Inc.
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Genome Sequence Centre,
            BC Cancer Agency, Vancouver, BC, Canada
            info@bcgsc.bc.ca
            Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
            Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
            Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
            Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
            Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
            Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
            Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
            Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
            Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAK Plate: 89 Row: p Column: 21
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 51477717.
FEATURES             Location/Qualifiers
     source          1..2357
                     /db_xref="H-InvDB:HIT000052806"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:50682 IMAGE:6154641"
                     /tissue_type="Eye, retinoblastoma"
                     /clone_lib="NIH_MGC_67"
                     /lab_host="DH10B"
                     /note="Vector: pCMV-SPORT6"
     gene            1..2357
                     /gene="TAF7L"
                     /gene_synonym="dJ738A13.1"
                     /gene_synonym="FLJ23157"
                     /db_xref="GeneID:54457"
                     /db_xref="HGNC:HGNC:11548"
                     /db_xref="MIM:300314"
     CDS             13..1401
                     /gene="TAF7L"
                     /gene_synonym="dJ738A13.1"
                     /gene_synonym="FLJ23157"
                     /codon_start=1
                     /product="TAF7-like RNA polymerase II, TATA box binding
                     protein (TBP)-associated factor, 50kDa"
                     /protein_id="AAH43391.1"
                     /db_xref="GeneID:54457"
                     /db_xref="HGNC:HGNC:11548"
                     /db_xref="MIM:300314"
                     /translation="MECPEGQLPISSENDSTPTVSTSEVTSQQEPQIPVDRGSETTYE
                     SSADIAGDEGTQIPADEDTQTDADSSAQAAAQAPENFQEGKDMSESQDEVPDEVENQF
                     ILRLPLEHACTVRNLARSQSVKMKDKLKIDLLPDGRHAVVEVEDVPLAAKLVDLPCVI
                     ESLRTLDKKTFYKTADISQMLVCTADGDIHLSPEEPAASTDPNIVRKKERGREEKCVW
                     KHGITPPLKNVRKKRFRKTQKKVPDVKEMEKSSFTEYIESPDVENEVKRLLRSDAEAV
                     STRWEVIAEDGTKEIESQGSIPGFLISSGMSSHKQGHTSSEYDMLREMFSDSRSNNDD
                     DEDEDDEDEDEDEDEDEDEDKEEEEEDCSEEYLERQLQAEFIESGQYRANEGTSSIVM
                     EIQKQIEKKEKKLHKIQNKAQRQKDLIMKVENLTLKNHFQSVLEQLELQEKQKNEKLI
                     SLQEQLQRFLKK"
BASE COUNT          735 a          450 c          552 g          620 t
ORIGIN      
        1 acgaggtggg ccatggagtg ccccgaggga cagctcccca tttcttcaga aaatgattca
       61 acaccaacag tttcaacatc ggaagtaact agccaacaag aaccccaaat tcctgtcgac
      121 cgtgggtctg aaaccaccta tgaaagcagc gccgacattg ctggcgacga aggcacccag
      181 attcctgccg acgaggacac tcaaacggat gcggacagca gcgcccaggc tgctgcccag
      241 gccccagaaa acttccagga agggaaagac atgagtgaaa gccaggatga agttcctgat
      301 gaagttgaga accagtttat attgcgtctg cctctggaac atgcttgtac tgtcaggaac
      361 ctagcacgtt ctcaaagtgt caagatgaag gataaactaa aaattgactt attgcctgat
      421 gggcgccatg cagttgttga agtagaagat gtcccactag ctgctaagct ggttgacttg
      481 ccttgtgtta ttgaaagcct gagaacgctt gataaaaaaa ccttttataa aacagcagac
      541 atttctcaga tgcttgtgtg cactgctgat ggtgatatcc acctttctcc agaagaacca
      601 gctgcctcta ctgatcctaa tatagtcagg aaaaaagaaa gggggagaga agaaaaatgt
      661 gtctggaagc atggcattac gccaccactt aagaatgtca gaaagaaaag gttccggaaa
      721 acacaaaaaa aggtccctga tgtcaaagaa atggaaaaaa gcagctttac tgagtacatt
      781 gaatctccag acgtggaaaa tgaagtaaag agactgctgc gttcggatgc tgaagccgta
      841 agtacccgtt gggaagtcat tgctgaagat ggaaccaagg aaatagaaag tcaaggctcc
      901 atcccaggat ttttgatatc ctcgggaatg agcagccaca agcagggtca tacctcgtca
      961 gaatatgata tgcttcggga gatgttcagt gattctagaa gtaacaatga tgatgatgag
     1021 gatgaggatg atgaagatga ggatgaggat gaggatgagg atgaagatga agacaaagaa
     1081 gaggaggagg aagattgttc tgaagagtat ctggaaaggc agctgcaggc cgagtttatt
     1141 gaatctggcc agtatagggc aaatgaaggt accagttcaa tagtcatgga aattcagaag
     1201 cagattgaga aaaaggagaa aaagctccat aagattcaga ataaagcaca aagacagaag
     1261 gatctcatca tgaaagtgga aaacctgaca ctcaagaatc attttcagtc tgtgctggag
     1321 cagcttgagt tacaggaaaa acaaaaaaat gagaagctca tttccctaca ggaacagttg
     1381 cagcgttttc tgaagaagtg aggagagcca ttggcgtggc ccacaaacct tggattcacc
     1441 atccagactg cagattggat gaaactgtgc acgtttttgt cccttcagtt gccttatgtt
     1501 gaatcagtta tatttatctg taccttcttt gctacttaaa atatgctcac agtttgtagt
     1561 catgtagaaa aggccagtat aaaaatgtag tagacttaaa gaccccactc gaccatgaga
     1621 ctttctcttt gtcaatttgg gaattattat tattaattta gaaatggggt cttgttatgt
     1681 tgcccaggct gaattcagac tcctgggctt aagggatcct tccgcctcag cctcctgagt
     1741 agctgggact acagttgtgc accaccacac caaacaagaa ttgattatat tgcttctgtg
     1801 ctatggtacc agcagattat tcagccatgc ttctaaaggc agtctagcct agaggccgta
     1861 cagctgtttg gtttgcatat gttttagctt ttcttttggt ttttagtatt tcctaaaaca
     1921 taggggaaaa aacgaggtca tttctactaa gcactaggac ctgccatagt gagtttaagt
     1981 gcctaccttg cagcagttaa tactagattg tgttctgtct ctgttcaggt aacaggactg
     2041 cattcctgct caaggatgat tccttgctgc tgcttatgtt ctgttgtttt taggatggag
     2101 ctggttgtta ttcaccaact aagggaacag ttagagcaga gatgaagaaa ttatgaactg
     2161 ttatccttat tctgagcctt ctcctcctaa ccctcatcag ttaaggttag gaagaacaag
     2221 atgccataat gcctatgaag acttctttaa caatcttgtt tgggtttttt tctaggtata
     2281 ttattagtgt tttatggtct atgttcttta agcaataaat aaattgttca ttttaaatgg
     2341 aaaaaaaaaa aaaaaaa
//