LOCUS       BC042617                3549 bp    mRNA    linear   HUM 23-JUL-2007
DEFINITION  Homo sapiens retinaldehyde binding protein 1-like 1, mRNA (cDNA
            clone MGC:34646 IMAGE:5192332), complete cds.
ACCESSION   BC042617
VERSION     BC042617.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 3549)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 3549)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (02-JAN-2003) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: Life Technologies, Inc.
            cDNA Library Preparation: Life Technologies, Inc.
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Baylor College of Medicine Human Genome
            Sequencing Center
            Center code: BCM-HGSC
            Web site: http://www.hgsc.bcm.tmc.edu/cdna/
            Contact: amg@bcm.tmc.edu
            Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
            Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
            A.N., Gibbs, R.A.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAK Plate: 50 Row: k Column: 22
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 27734848.
FEATURES             Location/Qualifiers
     source          1..3549
                     /db_xref="H-InvDB:HIT000052726"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:34646 IMAGE:5192332"
                     /tissue_type="Brain, adult, 6 pooled whole brains"
                     /clone_lib="NIH_MGC_114"
                     /lab_host="DH10B"
                     /note="Vector: pCMV-SPORT6"
     gene            1..3549
                     /gene="RLBP1L1"
                     /gene_synonym="CRALBPL"
                     /db_xref="GeneID:157807"
                     /db_xref="HGNC:HGNC:23139"
     CDS             300..1364
                     /gene="RLBP1L1"
                     /gene_synonym="CRALBPL"
                     /codon_start=1
                     /product="retinaldehyde binding protein 1-like 1"
                     /protein_id="AAH42617.1"
                     /db_xref="GeneID:157807"
                     /db_xref="HGNC:HGNC:23139"
                     /translation="MGPVSLLPKYQKLNTWNGDLAKMTHLQAGLSPETIEKARLELNE
                     NPDVLHQDIQQVRDMIITRPDIGFLRTDDAFILRFLRARKFHQADAFRLLAQYFQYRQ
                     LNLDMFKNFKADDPGIKRALIDGFPGVLENRDHYGRKILLLFAANWDQSRNSFTDILR
                     AILLSLEVLIEDPELQINGFILIIDWSNFSFKQASKLTPSILKLAIEGLQDSFPARFG
                     GVHFVNQPWYIHALYTLIKPFLKDKTRKRIFLHGNNLNSLHQLIHPEFLPSEFGGTLP
                     PYDMGTWARTLLGPDYSDENDYTHTSYNAMHVKHTSSNLERECSPKLMKRSQSVVEAG
                     TLKHEEKGENENTQPLLALD"
BASE COUNT         1165 a          738 c          665 g          981 t
ORIGIN      
        1 cccttgtgga gcccgagctc tcattcacag ctttctagag aaatctgagc ccgaacctgc
       61 cagaataggg gatctcaccc acccagttca gcagcgagga cacctgcaga aatacattcc
      121 caaagcaagg ctgggcggcc gtgtgaagta agcaatggcc tcagttttgc ttctgttttg
      181 gatgaacacc accacatagg gcctgaatgt gaaagaagac cctctatttg tctgttccgg
      241 ggcagcctgg tagtaaaaca ctgttgaatg ggccacagtt tcagcagacc atcaggtgaa
      301 tgggaccagt ctctcttctt ccaaaatatc agaagttaaa cacttggaac ggagatttgg
      361 ccaagatgac ccatttacag gctggactca gtccagagac tatagagaaa gctcgcctgg
      421 aactgaatga aaaccccgat gttttacatc aggatattca gcaagtcagg gacatgatca
      481 tcaccaggcc tgacattgga tttttacgta cagatgatgc cttcatcctg agatttctcc
      541 gagccaggaa gtttcaccaa gcggatgcct ttagactcct ggctcagtat ttccagtacc
      601 gccagctaaa cctggacatg ttcaaaaact tcaaggcaga tgatcccggc attaagaggg
      661 ctctgatcga tgggttcccc ggggtgctgg aaaaccgaga ccattacggc aggaagattc
      721 ttttgctgtt tgcagccaat tgggatcaga gtaggaactc cttcacagac atccttcgtg
      781 ccatcctgct gtcattggaa gtcctaatcg aagatccgga gcttcagata aatggcttca
      841 ttttaattat agactggagt aatttttcct tcaaacaagc ctccaaactg acaccttcaa
      901 tccttaaact ggccattgaa gggttgcagg acagctttcc tgcccgcttt ggaggagtcc
      961 actttgtcaa ccagccctgg tacattcatg ccctctacac actcatcaag ccatttctta
     1021 aagacaagac caggaaacgg attttcctgc atggaaacaa tttaaacagc cttcaccagc
     1081 taatacaccc tgaatttttg ccctctgaat ttggaggaac tcttcctcct tatgacatgg
     1141 gaacttgggc ccggacgtta ctcggtcccg actacagcga tgaaaatgac tatactcaca
     1201 catcctataa tgcaatgcac gtgaagcata cgtcctcgaa tctggagaga gaatgctcac
     1261 ccaagctgat gaaaagatct cagtctgtgg tagaagctgg gaccctgaaa catgaggaga
     1321 agggagagaa tgagaacacc cagccactcc tggctctgga ctgaaccctg agtcacccca
     1381 atgctcctgc acactggcct tcagtggtat cagccaccca ggaagcacat gcacaactga
     1441 cccatgcaga cacgtgtgtt ctgcttgaca caaggtcctc cactcctgaa cccctgcagt
     1501 gactgtcacc agccatcggt ctgagcagcc aaagttggac aaagacttga gagatgcttt
     1561 tttttccccc cagtgagggg actggaggat gatgcaaggc atttatgtaa aaaagattct
     1621 ccctcctttc atatttattg tagtaaattg aaaaaataaa gactaaattt gatggacaca
     1681 ctgcattagg acaagaattt ttctgaggta tcacacaggg accctctcca gtttttgaaa
     1741 attaagtgca tttccaagta aatgtatcag agttaaactg tacagacacc actgtcaagt
     1801 ttcatgtagt acaaagccct gagacaatag tatctccagt aatttccatt cttactgaat
     1861 tatttccttt gacctcatca ccagcatcga attgttcagc ctaagagcat gttctcatag
     1921 gtctgggtat ttgcaaagtt tgcttatttt gatgatatcc tgcaaaaaat tattttgatg
     1981 tcacatctct tgtcaggtca ctagctgact gtcatgagct gacgttaaag gaagacacat
     2041 ggacgtgaaa tacgattatt tcatctgagc aatgtgagtt accacaggca gctcaaaagc
     2101 ccattagtgc agcatgtgtc tgcagaggag atgtctcatg aaaatcacat gtcagtgatt
     2161 aatgaatcca ttccagttgc ctcaactggg tcactacagc aaagaaaagt gctatcaaac
     2221 catttaccct tgcccccaca accctcctgc aaccattaaa gatgtggaga aagaccatgg
     2281 ttgttgctga gagggtaaat attcaatcat ggagcatgac ccatatggat ggctaaatat
     2341 gcaagtactg aagtaagaga agactagaaa tgcaggatga aatgtcaaag gtcattttat
     2401 ttacctagtc tccttagaaa tggagtcccc aactactcat tcaaaagaaa tcagacataa
     2461 aatagacatc atatatgata tccttacttg tgccatgttt tccaagacca gtgcatattt
     2521 ttagacatct cttattcgcc cagccatctg catgacatgg gtatttatta gtattaccag
     2581 ttggtgctca aagtcaaaca aaaatatttt agttaataat gggcagtaaa atatgatttt
     2641 acattatttt aaatatttgg gagagttaat ttgttagcta aataattcaa gggaaagaga
     2701 ttattcaact ggtcataatc acccctgata atattattac taatcttaat tatttattac
     2761 atcatctctt tctcaatgga tctaatgttt taattttttc ccctattggt agagaacaat
     2821 aacagaagta atttttatat tatacacttg gagaaataaa gttgaaacag aattaaaaat
     2881 atttctcaaa caactgtatc acaatataaa ttaaactaat tcatttttgt gtagacatac
     2941 gaaatcacaa aaataataac actgaaataa ttctaccaat gcagtgatgg aaacactttt
     3001 cttatgtacc aagacataga taggtaagag aaataaagaa ttgaagtgaa ttagaaaatc
     3061 cattttattg cttgggttta aaatagttgt gggatacaag tatttacaat gctattggag
     3121 tcaattattg acaacacttt gcaacagtaa taccatttct agcttttcaa ttggcaatac
     3181 ttagaacctt actgtagtga cctgatttta aataccatat tatatttact aagttaagag
     3241 ctagttttta ctctcttcca taatttcatt acatgaatgt aagatgatgg ctcaaaaatg
     3301 acgacttata gtttgaattt atgtgtatgc aatatacata tgagaaccaa attcaacaag
     3361 tgacatgaat gttactacat gaacattgaa ttgtattgcc cttgtcagtt atttcctctg
     3421 ttcaataaat actgaaggtc acaaacacct ttttactttt caaaaaaaaa aaaaaaaaaa
     3481 aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa
     3541 aaaaaaaaa
//