LOCUS       BC041167                4941 bp    mRNA    linear   HUM 15-JUL-2006
DEFINITION  Homo sapiens TBC1 domain family, member 14, mRNA (cDNA clone
            MGC:48919 IMAGE:5575580), complete cds.
ACCESSION   BC041167
VERSION     BC041167.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 4941)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 4941)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (16-DEC-2002) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC
            cDNA Library Preparation: Life Technologies, Inc.
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Institute for Systems Biology
            http://www.systemsbiology.org
            contact: amadan@systemsbiology.org
            Anup Madan, Jessica Fahey, Erin Helton, Mark Ketteman, Anuradha
            Madan, Stephanie Rodrigues, Amy Sanchez and Michelle Whiting
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAK Plate: 84 Row: h Column: 16
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 29789113.
FEATURES             Location/Qualifiers
     source          1..4941
                     /db_xref="H-InvDB:HIT000052531"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:48919 IMAGE:5575580"
                     /tissue_type="Testis, embryonal carcinoma"
                     /clone_lib="NIH_MGC_92"
                     /lab_host="DH10B"
                     /note="Vector: pCMV-SPORT6"
     gene            1..4941
                     /gene="TBC1D14"
                     /gene_synonym="KIAA1322"
                     /db_xref="GeneID:57533"
                     /db_xref="HGNC:HGNC:29246"
     CDS             170..2206
                     /gene="TBC1D14"
                     /gene_synonym="KIAA1322"
                     /codon_start=1
                     /product="TBC1 domain family, member 14"
                     /protein_id="AAH41167.1"
                     /db_xref="GeneID:57533"
                     /db_xref="HGNC:HGNC:29246"
                     /translation="MGILDGRPGNPLQNLQHVNLKAPRLLSAPEYGPKLKLRALEDRH
                     SLQSVDSGIPTLEIGNPEPVPCSAVHVRRKQSDSDLIPERAFQSACALPSCAPPAPSS
                     TEREQSVRKSSTFPRTGYDSVKLYSPTSKALTRSDDVSVCSVSSLGTELSTTLSVSNE
                     DILDLVVTSSSSAIVTLENDDDPQFTNVTLSSIKETRGLHQQDCVHEAEEGSKLKILG
                     PFSNFFARNLLARKQSARLDKHNDLGWKLFGKAPLRENAQKDSKRIQKEYEDKAGRPS
                     KPPSPKQNVRKNLDFEPLSTTALILEDRPANLPAKPAEEAQKHRQQYEEMVVQAKKRE
                     LKEAQRRKKQLEERCRVEESIGNAVLTWNNEILPNWETMWCSRKVRDLWWQGIPPSVR
                     GKVWSLAIGNELNITHELFDICLARAKERWRSLSTGGSEVENEDAGFSAADREASLEL
                     IKLDISRTFPNLCIFQQGGPYHDMLHSILGAYTCYRPDVGYVQGMSFIAAVLILNLDT
                     ADAFIAFSNLLNKPCQMAFFRVDHGLMLTYFAAFEVFFEENLPKLFAHFKKNNLTPDI
                     YLIDWIFTLYSKSLPLDLACRIWDVFCRDGEEFLFRTALGILKLFEDILTKMDFIHMA
                     QFLTRLPEDLPAEELFASIATIQMQSRNKKWAQVLTALQKDSREMEKGSPSLRH"
BASE COUNT         1188 a         1255 c         1298 g         1200 t
ORIGIN      
        1 tgcctaccgc gtgcccggcg tcctcgtcgc gcgagttgcc ggtcccgcgg ggcctgggct
       61 gcgggcccac gggtcccggg gatggcgtcg gagccgcgct aactccgttt ctccttggac
      121 caagatgact gatggaaaac tctccacctc tacaaatggc gtagccttca tgggtattct
      181 ggatggtcga ccaggaaacc cccttcagaa cctgcaacac gtcaatctca aggcgccccg
      241 actcctctcc gcgcctgagt acgggcccaa gctgaaactc agggctttag aagaccggca
      301 cagcctccag tccgtggact cggggattcc taccctggag atcgggaacc cggagcctgt
      361 accctgcagc gcggtccacg tgaggaggaa gcagtccgac tccgacctca tccccgagcg
      421 ggccttccag agcgcctgcg cgctgccatc ctgtgcgcca ccagctccta gcagcaccga
      481 gcgggaacag agcgtgcgca aatcctccac gtttcccagg acaggctatg actcggtaaa
      541 gctctatagc ccgacctcca aagccctgac ccgcagcgat gatgtctccg tctgcagcgt
      601 gtccagtctt gggacagagc tgtccaccac gctgtccgtc agcaatgagg acatcttgga
      661 ccttgtggtc acgagcagct ccagtgccat tgtgaccctg gagaatgacg atgacccaca
      721 gtttaccaac gtcaccttga gctctatcaa ggaaacccgt ggcttacacc agcaggactg
      781 tgttcatgaa gctgaggagg ggagtaaatt gaaaatattg gggccattta gtaacttctt
      841 tgcaaggaac ttgcttgcta gaaaacaaag tgcaaggctt gacaaacaca atgacttggg
      901 atggaagtta tttgggaaag cgccactccg agagaatgcc cagaaggatt caaagagaat
      961 acagaaggaa tatgaagaca aggctggaag acctagcaag ccaccctctc caaagcagaa
     1021 tgtgaggaag aatcttgact ttgaaccact ttccaccacc gcactcatcc tcgaggacag
     1081 accagcaaat ctcccagcaa aaccagctga agaagctcag aagcacagac agcagtatga
     1141 agaaatggtg gttcaggcca aaaagcgaga gctgaaagaa gcccagcgaa ggaagaagca
     1201 gctggaagaa agatgcagag tcgaggaaag cattggaaac gctgtgctca cctggaataa
     1261 tgagatctta cctaactggg aaacaatgtg gtgctctaga aaagttcgag atttatggtg
     1321 gcagggaatc cctccaagtg tgagaggcaa agtctggagc ttagccattg gcaacgagtt
     1381 aaatatcacc cacgagctct ttgacatctg tcttgcccga gccaaggaga ggtggcggtc
     1441 ccttagcaca ggaggctctg aagtggagaa cgaagatgct ggtttttcag cagcagacag
     1501 agaagccagt ctggagctta ttaaactgga catttctaga acatttccta atctctgcat
     1561 tttccagcaa ggtggtccat atcatgacat gttgcacagt attttgggcg cttatacttg
     1621 ttaccggcca gatgtgggtt atgtccaggg catgtccttc atagcagcag tgttgatctt
     1681 gaacttagat actgcagatg cctttattgc cttttctaac cttctgaata aaccctgtca
     1741 aatggcgttt tttagagtgg accatggcct tatgttgact tattttgctg catttgaagt
     1801 attctttgaa gaaaatttgc cgaaattatt tgcgcatttc aagaagaaca acctaactcc
     1861 agatatctac ctaattgatt ggatctttac cttatatagt aaatctctgc ccctcgacct
     1921 ggcctgtcgt atctgggacg tgttctgtcg cgatggggaa gagttcctgt tccgcacggc
     1981 cctgggcatc ctgaagctgt tcgaggacat cctgaccaag atggacttca ttcacatggc
     2041 ccagttcctg acccggctgc ccgaggacct gcccgccgag gagctgtttg cctccatcgc
     2101 cacgatccag atgcagagcc gaaacaagaa gtgggctcag gtactgactg cattgcagaa
     2161 agacagccgg gaaatggaga agggaagtcc atccctccga cactgaggct gcagcgggaa
     2221 ttcgcactcg gcaccaatca gagccccatg ccgcggcccc tctgttgttt cagactgaca
     2281 cccgggcagc cgagaagaac agacgctctt taagtttgat tcctaacact ggagttggcc
     2341 ttaaacaaaa caaacacaaa aacttttaaa gaattaaacc aaggcttagc cttaagcagc
     2401 tcagtggaag gatgagctgc tgcggaccac agccagccac tgcatctgct gcacagttga
     2461 acgatgggca gtggctcacc cccactcctt tatttcagca aaagctaatt aaattgtaat
     2521 gtttctatgt caactactgg gaagtatgtt acagtcttag ccaggatgca tgagagatgt
     2581 tatttgggag acttgagatg ctttggctga tatttacatg ttttcgataa gaaagggatc
     2641 gctgattgag ttattgagat agtttttcca gagctggagg tcacgtttct aaaactcacc
     2701 tacgaaagat agcattaaag gaacaggggc tctctgagga tggccactga tgtgtgtttg
     2761 tggatacctg ggcatcgacc cagcctgcag gtgagctctg ggccatgttg ccttgacaca
     2821 gtcacagtgt agaggctgca ggtgcacacg tgggctccag tgggactgcg ctctgggaga
     2881 ctgctccctg gcatcggtcc tgcggaggtg gaaagttcga gaggaggagc tatttgcgag
     2941 gaagccctgt ggcaatagag ataggcttaa aagcggagag aacacagagt ggaatcagcc
     3001 ccctgtaagt taaagggtag agaaagagat gtgtggctgg gccctctccc acctgcctgt
     3061 tcagtggagg ccagggcagc agcccagaac agcacatgtg ggggaggtgg ccccttgtgc
     3121 cagcagtggc tcctctctgc ctttgagccc tgcacagctg gacccatcct aagtgccagt
     3181 gagtccctca cacatttgac tttagaacgt gtgcttcatg acccgttgta cagacggagg
     3241 agcgagcaac acacgtctaa cagcctagac aatctcgtca gatgctcata ctggaccatc
     3301 agcctcccca ttttagctga ctttcccagg gtcgttggca aattttttgt tctgtctttt
     3361 ccttgactaa ttgtagaact ttgtgtgagg actttggtta tccaaaatca cagaaatgaa
     3421 ccgttttgca gctgcgcagt ctaaagggca ggccagtgtc tggaagcagg gcccacgtgg
     3481 cggtccgctg gcaggctggt cctggggagc attctgcgga cccggtcacg ggcttggtta
     3541 gtcatgcgta catgtgtgcc ttggggtgct ctgcactcca cggcccttct cagccacact
     3601 tcccacccca gggggtgccc ccaggctgat ctcatttctg atgttgaggg ctgtttggct
     3661 ctgtctgtat agcttgtaac aggagccttg ggctaggggc tggggaagga aagccgagct
     3721 ggcattcgtt ctctggactt tttatgcctg ccatacccgc taatgctcct cgaggtgcag
     3781 gagcaggttg ctgagccagt ggctgccccg tgccctcctt cccagcacta tcatgtgtca
     3841 cgtttcccgg actctgcccc tacatctcag ctgaatctcc agggaggctg cagagcatcg
     3901 tggagaccac tttctgcctc ggcctttaaa tgctgactca cctcctctcg gaggaggcgt
     3961 cctgtcttca cgggggggtc ccggtggcct ccagacgtag ccatttcctg acatcaagat
     4021 gttgaatgta atctggtctg agctgggcct gtgggagggg ccgcctgagg cctgtgcgct
     4081 gttgtcctcg cagatgtact tatttttgtt catgatacgg gcgttccgtt ccttaaagat
     4141 gtatatattt tcttactgta cataaagatg ttccttaagt cgtacagaag gtggcgcggc
     4201 aaagggcctc gtgcagtgtg ttcagattgc ccctggggat cttctgtgtc ttcagcgccc
     4261 agccctgcgt gttcctggtg aagcagtttc acatcagtct ctccagatag cactacgatg
     4321 tattccgctt ctgaacagga tcccatgcca gtgtggaaca ccttcccaat cttagttcag
     4381 aagtggcttg tatgacctgt tcaggggtca catgaggtct cgccagtttc ctgggtcctc
     4441 ttcagaggcc agaaagttct aagttctgag tccccggcca gggtccctta acacctcggc
     4501 acagaggctg ttggcaagtg tagaggctgc ctctgtgtgt ggtttaagta aactggaaat
     4561 gagacattga cgtgctgctc ctccagaggt ctgcacactc cacttcacat gccgttgact
     4621 ctcacagtct aagacttcag ggccgggacc tttgtccagc ctgcacagta gagtgaggct
     4681 gcctctcccg ccaggcattg ggatcccatt tagaaacggc attcacttca gaaggtactt
     4741 tttaactgct cagtttttga ctattttaaa tagtttgctg aaaactcctg ataacacttg
     4801 ctacatatca tgttttaatt gcttgtacag ttaaccttta attttattta gtaaagtgta
     4861 tcaaagtagg actttttgaa ttgtaaatag gtggttttat taaataaaag tcaatgtaaa
     4921 attgaaaaaa aaaaaaaaaa a
//