LOCUS       BC040630                1402 bp    mRNA    linear   HUM 07-OCT-2003
DEFINITION  Homo sapiens aquaporin 8, mRNA (cDNA clone MGC:50607
            IMAGE:5759105), complete cds.
ACCESSION   BC040630
VERSION     BC040630.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1402)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 1402)
  AUTHORS   Strausberg,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (29-NOV-2002) National Institutes of Health, Mammalian
            Gene Collection (MGC), Cancer Genomics Office, National Cancer
            Institute, 31 Center Drive, Room 11A03, Bethesda, MD 20892-2590,
            USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: Life Technologies, Inc.
            cDNA Library Preparation: Life Technologies, Inc.
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Sequencing Group at the Stanford Human Genome
            Center, Stanford University School of Medicine, Stanford, CA  94305
            Web site:       http://www-shgc.stanford.edu
            Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
            Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
            R. M.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAK Plate: 88 Row: o Column: 1.
FEATURES             Location/Qualifiers
     source          1..1402
                     /db_xref="H-InvDB:HIT000052436"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:50607 IMAGE:5759105"
                     /tissue_type="Colon, Kidney, Stomach, adult, whole pooled"
                     /clone_lib="NIH_MGC_116"
                     /lab_host="DH10B"
                     /note="Vector: pCMV-SPORT6"
     gene            1..1402
                     /gene="AQP8"
                     /db_xref="GeneID:343"
                     /db_xref="MIM:603750"
     CDS             69..836
                     /gene="AQP8"
                     /codon_start=1
                     /product="AQP8 protein"
                     /protein_id="AAH40630.1"
                     /db_xref="GI:26251901"
                     /db_xref="GeneID:343"
                     /db_xref="MIM:603750"
                     /translation="MCEPEFGNDKAREPSVGGRWRVSWYERFVQPCLVELLGSALFIF
                     IGCLSVIENGTDTGLLQPALAHGLALGLVIATLGNISGGHFNPAVSLAAMLIGGLNLV
                     MLLPYWVSQLLGGMLGAALAKAVSPEERFWNASGAAFVTVQEQGQVAGALVAEIILTT
                     LLALAVCMGAINEKTKGPLAPFSIGFAVTVDILAGGPVSGGCMNPARAFGPAVVANHW
                     NFHWIYWLGPLLAGLLVGLLIRCFIGDGKTRLILKAR"
     misc_feature    150..743
                     /gene="AQP8"
                     /note="MIP; Region: Major intrinsic protein. MIP (Major
                     Intrinsic Protein) family proteins exhibit essentially two
                     distinct types of channel properties: (1) specific water
                     transport by the aquaporins, and (2) small neutral solutes
                     transport, such as glycerol by the glycerol facilitators"
                     /db_xref="CDD:pfam00230"
BASE COUNT          343 a          355 c          397 g          307 t
ORIGIN      
        1 tgtctgtgaa ggatcgtcat ctatacactc agtcctggct caggctgtca cggtgactgc
       61 agatagccat gtgtgagcct gaatttggca atgacaaggc cagggagccg agcgtgggtg
      121 gcaggtggcg agtgtcctgg tacgaacggt ttgtgcagcc atgtctggtc gaactgctgg
      181 gctctgctct cttcatcttc atcgggtgcc tgtcggtcat tgagaatggg acggacactg
      241 ggctgctgca gccggccctg gcccacgggc tggctttggg gctcgtgatt gccacgctgg
      301 ggaatatcag tggtggacac ttcaaccctg cggtgtccct ggcagccatg ctgatcggag
      361 gcctcaacct ggtgatgctc ctcccgtact gggtctcaca gctgctcggg gggatgctcg
      421 gggctgcctt ggccaaggcg gtgagtcctg aggagaggtt ctggaatgca tctggggcgg
      481 cctttgtgac agtccaggag caggggcagg tggcaggggc gttggtggca gagatcatcc
      541 tgacgacgct gctggccctg gctgtatgca tgggtgccat caatgagaag acaaagggcc
      601 ctctggcccc gttctccatc ggctttgccg tcaccgtgga tatcctggct gggggccctg
      661 tgtctggagg ctgcatgaat cccgcccgtg cttttggacc tgcggtggtg gccaaccact
      721 ggaacttcca ctggatctac tggctgggcc cactcctggc tggcctgctt gttggactgc
      781 tcattaggtg cttcattgga gatgggaaga cccgcctcat cctgaaggct cggtgaagca
      841 gagctcgtgg gattcctgct gctccaggtg tcctcagctc acctgtccca gactgaggac
      901 aggggagttc ctgcatttcc tgccagggca gaggcccaga ggagcgaccc cctgcttcca
      961 ctgcttgggc ctgctttctc agatagactg actgctgagg aggctctagg ttcttggaat
     1021 tcctttgtgc tcatcagaga ccccagcctg gggaacacgc tgcccgcact gcccagagag
     1081 cagtgcaaac accacaacac gagcgtgttt cttgagagga atgtccccga gttggacaag
     1141 gaggctgttt ctgcacatca gctcatttcc cgcaccccat ttcttgcttg attgctttgt
     1201 tgggggcctg gccacttcct tgcttctcaa gctgacaatt ctcactttgc aataaatagt
     1261 ccagtgtttc cttccaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa
     1321 aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa
     1381 aaaaaaaaaa aaaaaaaaaa aa
//