LOCUS       BC040361                4310 bp    mRNA    linear   HUM 15-JUL-2006
DEFINITION  Homo sapiens nuclear receptor interacting protein 1, mRNA (cDNA
            clone MGC:9257 IMAGE:3918685), complete cds.
ACCESSION   BC040361
VERSION     BC040361.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 4310)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 4310)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (27-NOV-2002) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC/DCTD/DTP
            cDNA Library Preparation: Life Technologies, Inc.
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Baylor College of Medicine Human Genome
            Sequencing Center
            Center code: BCM-HGSC
            Web site: http://www.hgsc.bcm.tmc.edu/cdna/
            Contact: amg@bcm.tmc.edu
            Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
            Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
            A.N., Gibbs, R.A.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAK Plate: 26 Row: b Column: 11
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 57232745.
FEATURES             Location/Qualifiers
     source          1..4310
                     /db_xref="H-InvDB:HIT000052382"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:9257 IMAGE:3918685"
                     /tissue_type="Skin, melanotic melanoma."
                     /clone_lib="NIH_MGC_72"
                     /lab_host="DH10B"
                     /note="Vector: pCMV-SPORT6"
     gene            1..4310
                     /gene="NRIP1"
                     /gene_synonym="RIP140"
                     /db_xref="GeneID:8204"
                     /db_xref="HGNC:HGNC:8001"
                     /db_xref="MIM:602490"
     CDS             293..3769
                     /gene="NRIP1"
                     /gene_synonym="RIP140"
                     /codon_start=1
                     /product="nuclear receptor interacting protein 1"
                     /protein_id="AAH40361.1"
                     /db_xref="GeneID:8204"
                     /db_xref="HGNC:HGNC:8001"
                     /db_xref="MIM:602490"
                     /translation="MTHGEELGSDVHQDSIVLTYLEGLLMHQAAGGSGTAVDKKSAGH
                     NEEDQNFNISGSAFPTCQSNGPVLNTHTYQGSGMLHLKKARLLQSSEDWNAAKRKRLS
                     DSIMNLNVKKEALLAGMVDSVPKGKQDSTLLASLLQSFSSRLQTVALSQQIRQSLKEQ
                     GYALSHDSLKVEKDLRCYGVASSHLKTLLKKSKVKDQKPDTNLPDVTKNLIRDRFAES
                     PHHVGQSGTKVMSEPLSCAARLQAVASMVEKRASPATSPKPSVACSQLALLLSSEAHL
                     QQYSREHALKTQNANQAASERLAAMARLQENGQKDVGSYQLPKGMSSHLNGQARTSSS
                     KLMASKSSATVFQNPMGIIPSSPKNAGYKNSLERNNIKQAANNSLLLHLLKSQTIPKP
                     MNGHSHSERGSIFEESSTPTTIDEYSDNNPSFTDDSSGDESSYSNCVPIDLSCKHRTE
                     KSESDQPVSLDNFTQSLLNTWDPKVPDVDIKEDQDTSKNSKLNSHQKVTLLQLLLGHK
                     NEENVEKNTSPQGVHNDVSKFNTQNYARTSVIESPSTNRTTPVSTPPLLTSSKAGSPI
                     NLSQHSLVIKWNSPPYVCSTQSEKLTNTASNHSMDLTKSKDPPGEKPAQNEGAQNSAT
                     FSASKLLQNLAQCGMQSSMSVEEQRPSKQLLTGNTDKPIGMIDRLNSPLLSNKTNAVE
                     ENKAFSSQPTGPEPGLSGSEIENLLERRTVLQLLLGNPNKGKSEKKEKTPLRDESTQE
                     HSERALSEQILMVKIKSEPCDDLQIPNTNVHLSHDAKSAPFLGMAPAVQRSAPALPVS
                     EDFKSEPVSPQDFSFSKNGLLSRLLRQNQDSYLADDSDRSHRNNEMALLESKNLCMVP
                     KKRKLYTEPLENPFKKMKNNIVDAANNHSAPEVLYGSLLNQEELKFSRNDLEFKYPAG
                     HGSASESEHRSWARESKSFNVLKQLLLSENCVRDLSPHRINSVADSKKKGHKNNVTNS
                     KPEFSISSLNGLMYSSTQPSSCMDNRTFSYPGVVKTPVSPTFPEHLGCAGSRPESGLL
                     NGCSMPSEKGPIKWVITDAEKNEYEKDSPRLTKTNPILYYMLQKGGNSVTSRETQDKD
                     IWREASSAESVSQVTAKEELLPTAETKASFFNLRSPYNSHMGNNASRPHSANGEVYGL
                     LGSVLTIKKESE"
BASE COUNT         1466 a          864 c          861 g         1119 t
ORIGIN      
        1 ggaaaaggaa tatattcact aaggattcta tctgcttact gctacagacc tatgtgttaa
       61 ggaattcttc tcctcctcct tgcgtagaag ttgatcagca ctgtggtcag actgcattta
      121 tcttgtcatt gccagaagaa atcttggaca gaatgtaaca gtacgtctct ctctgattgc
      181 gatggaaggt gataaactga tactccttta ttaaagttac atcgcactca ccacagaaaa
      241 ccattcttta aagtgaatag aaaccaagcc cttgtgaaca cttctattga acatgactca
      301 tggagaagag cttggctctg atgtgcacca ggattctatt gttttaactt acctagaagg
      361 attactaatg catcaggcag cagggggatc aggtactgcc gttgacaaaa agtctgctgg
      421 gcataatgaa gaggatcaga actttaacat ttctggcagt gcatttccca cctgtcaaag
      481 taatggtcca gttctcaata cacatacata tcaggggtct ggcatgctgc acctcaaaaa
      541 agccagactg ttgcagtctt ctgaggactg gaatgcagca aagcggaaga ggctgtctga
      601 ttctatcatg aatttaaacg taaagaagga agctttgcta gctggcatgg ttgacagtgt
      661 gcctaaaggc aaacaggata gcacattact ggcctctttg cttcagtcat tcagctctag
      721 gctgcagact gttgctctgt cacaacaaat caggcagagc ctcaaggagc aaggatatgc
      781 cctcagtcat gattctttaa aagtggagaa ggatttaagg tgctatggtg ttgcatcaag
      841 tcacttaaaa actttgttga agaaaagtaa agttaaagat caaaagcctg atacgaatct
      901 tcctgatgtg actaaaaacc tcatcagaga taggtttgca gagtctcctc atcatgttgg
      961 acaaagtgga acaaaggtca tgagtgaacc gttgtcatgt gctgcaagat tacaggctgt
     1021 tgcaagcatg gtggaaaaaa gggctagtcc tgccacctca cctaaaccta gtgttgcttg
     1081 tagccagtta gcattacttc tgtcaagcga agcccatttg cagcagtatt ctcgagaaca
     1141 cgctttaaaa acgcaaaatg caaatcaagc agcaagtgaa agacttgctg ctatggccag
     1201 attgcaagaa aatggccaga aggatgttgg cagttaccag ctcccaaaag gaatgtcaag
     1261 ccatcttaat ggtcaggcaa gaacatcatc aagcaaactg atggctagca aaagtagtgc
     1321 tacagtgttt caaaatccaa tgggtatcat tccttcttcc cctaaaaatg caggttataa
     1381 gaactcactg gaaagaaaca atataaaaca agctgctaac aatagtttgc ttttacatct
     1441 tcttaaaagc cagactatac ctaagccaat gaatggacac agtcacagtg agagaggaag
     1501 catttttgag gaaagtagta cacctacaac tattgatgaa tattcagata acaatcctag
     1561 ttttacagat gacagcagtg gtgatgaaag ttcttattcc aactgtgttc ccatagactt
     1621 gtcttgcaaa caccgaactg aaaaatcaga atctgaccaa cctgtttccc tggataactt
     1681 cactcaatcc ttgctaaaca cttgggatcc aaaagtccca gatgtagata tcaaagaaga
     1741 tcaagatacc tcaaagaatt ctaagctaaa ctcacaccag aaagtaacac ttcttcaatt
     1801 gctacttggc cataagaatg aagaaaatgt agaaaaaaac accagccctc agggagtaca
     1861 caatgatgtg agcaagttca atacacaaaa ttatgcaagg acttctgtga tagaaagccc
     1921 cagtacaaat cggactactc cagtgagcac tccaccttta cttacatcaa gcaaagcagg
     1981 gtctcccatc aatctctctc aacactctct ggtcatcaaa tggaattccc caccatatgt
     2041 ctgcagtact cagtctgaaa agctaacaaa tactgcatct aaccactcaa tggaccttac
     2101 aaaaagcaaa gacccaccag gagagaaacc agcccaaaat gaaggtgcac agaactctgc
     2161 aacgtttagt gccagtaagc tgttacaaaa tttagcacaa tgtggaatgc agtcatccat
     2221 gtcagtggaa gagcagagac ccagcaaaca gctgttaact ggaaacacag ataaaccgat
     2281 aggtatgatt gatagattaa atagcccttt gctctcaaat aaaacaaatg cagttgaaga
     2341 aaataaagca tttagtagtc aaccaacagg tcctgaacca gggctttctg gttctgaaat
     2401 agaaaatctg cttgaaagac gtactgtcct ccagttgctc ctggggaacc ccaacaaagg
     2461 gaagagtgaa aaaaaagaga aaactccctt aagagatgaa agtactcagg aacactcaga
     2521 gagagcttta agtgaacaaa tactgatggt gaaaataaaa tctgagcctt gtgatgactt
     2581 acaaattcct aacacaaatg tgcacttgag ccatgatgct aagagtgccc cattcttggg
     2641 tatggctcct gctgtgcaga gaagcgcacc tgccttacca gtgtccgaag actttaaatc
     2701 ggagcctgtt tcacctcagg atttttcttt ctccaagaat ggtctgctaa gtcgattgct
     2761 aagacaaaat caagatagtt acctggcaga tgattcagac aggagtcaca gaaataatga
     2821 aatggcactt ctagaatcaa agaatctttg catggtccct aagaaaagga agctttatac
     2881 tgagccatta gaaaatccat ttaaaaagat gaaaaacaac attgttgatg ctgcaaacaa
     2941 tcacagtgcc ccagaagtac tgtatgggtc cttgcttaac caggaagagc tgaaatttag
     3001 cagaaatgat cttgaattta aatatcctgc tggtcatggc tcagccagcg aaagtgaaca
     3061 caggagttgg gccagagaga gcaaaagctt taatgttctg aaacagctgc ttctctcaga
     3121 aaactgtgtg cgagatttgt ccccgcacag aattaactct gtggctgaca gtaaaaagaa
     3181 aggacacaaa aataatgtga ccaacagcaa acctgaattt agcatttctt ctttaaatgg
     3241 actgatgtac agttccactc agcccagcag ttgcatggat aacaggacat tttcataccc
     3301 aggtgtagta aaaactcctg tgagtcctac tttccctgag cacttgggct gtgcagggtc
     3361 tagaccagaa tctgggcttt tgaatgggtg ttccatgccc agtgagaaag gacccattaa
     3421 gtgggttatc actgatgcgg agaagaatga gtatgaaaaa gactctccaa gattgaccaa
     3481 aaccaaccca atactatatt acatgcttca aaaaggaggc aattctgtta ccagtcgaga
     3541 aacacaagac aaggacattt ggagggaggc ttcatctgct gaaagtgtct cacaggtcac
     3601 agccaaagaa gagttacttc ctactgcaga aacgaaagct tctttcttta atttaagaag
     3661 cccttacaat agccatatgg gaaataatgc ttctcgccca cacagcgcaa atggagaagt
     3721 ttatggactt ctgggaagcg tgctaacgat aaagaaagaa tcagaataaa atgtacctgc
     3781 catccagttt tggatctttt taaaactaat gagtatgaac ttgagatctg tataaataag
     3841 agcatgattt gaaaaaaagc atggtataat tgaaactttt ttcattttga aaagtattgg
     3901 ttactggtga tgttgaaata tgcatactaa tttttgctta acattagatg tcatgaggaa
     3961 actactgaac tagcaattgg ttgtttaaca cttctgtatg cgtcagataa caactgtgag
     4021 tagcctatga atgaaattct tttataaata ttaggcataa attaaaatgt aaaactccat
     4081 tcatagtgga ttaatgcatt ttgctgcctt tattagggta ctttattttg cttttcagaa
     4141 gtcagcctac ataacacatt tttaaagtct aaactgttaa acaactcttt aaaggataat
     4201 tatccaataa aaaaaaacct agtgctgatt cacagcttat tatccaattc aaaaataaat
     4261 tagaaaaata tatgcttaca tttttcactt ttgctaaaaa aaaaaaaaaa
//