LOCUS       BC037738                2808 bp    mRNA    linear   HUM 17-JUL-2006
DEFINITION  Homo sapiens translocation associated membrane protein 1, mRNA
            (cDNA clone MGC:33851 IMAGE:5261490), complete cds.
ACCESSION   BC037738
VERSION     BC037738.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2808)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 2808)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (13-SEP-2002) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: Miklos Palkovits, M.D., Ph.D.
            cDNA Library Preparation: Michael J. Brownstein (NHGRI) &  Shiraki
            Toshiyuki and Piero Carninci (RIKEN)
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Institute for Systems Biology
            http://www.systemsbiology.org
            contact: amadan@systemsbiology.org
            Anup Madan, Jessica Fahey, Erin Helton, Mark Ketteman, Anuradha
            Madan, Stephanie Rodrigues, Amy Sanchez and Michelle Whiting
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAK Plate: 47 Row: f Column: 2
            This clone was selected for full length sequencing because it
            passed the following selection criteria: GenomeScan gene
            prediction, Similarity but not identity to protein.
FEATURES             Location/Qualifiers
     source          1..2808
                     /db_xref="H-InvDB:HIT000051947"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:33851 IMAGE:5261490"
                     /tissue_type="Brain, hippocampus"
                     /clone_lib="NIH_MGC_95"
                     /lab_host="DH10B"
                     /note="Vector: pBluescriptR"
     gene            1..2808
                     /gene="TRAM1"
                     /gene_synonym="TRAM"
                     /gene_synonym="TRAMP"
                     /db_xref="GeneID:23471"
                     /db_xref="HGNC:HGNC:20568"
                     /db_xref="MIM:605190"
     CDS             173..1297
                     /gene="TRAM1"
                     /gene_synonym="TRAM"
                     /gene_synonym="TRAMP"
                     /codon_start=1
                     /product="translocation associated membrane protein 1"
                     /protein_id="AAH37738.1"
                     /db_xref="GeneID:23471"
                     /db_xref="HGNC:HGNC:20568"
                     /db_xref="MIM:605190"
                     /translation="MAIRKKSTKSPPVLSHEFVLQNHADIVSCVAMVFLLGLMFEITA
                     KASIIFVTLQYNVTLPATEEQATESVSLYYYGIKDLATVFFYMLVAIIIHAVIQEYML
                     DKINRRMHFSKTKHSKFNESGQLSAFYLFACVWGTFILISENYISDPTILWRAYPHNL
                     MTFQMKFFYISQLAYWLHAFPELYFQKTKKEDIPRQLVYIGLYLFHIAGAYLLNLNHL
                     GLVLLVLHYFVEFLFHISRLFYFSNEKYQKGFSLWAVLFVLGRLLTLILSVLTVGFGL
                     ARAENQKLDFSTGNFNVLAVRIAVLASICVTQAFMMWKFINFQLRRWREHSAFQAPAV
                     KKKPTVTKGRSSKKGTENGVNGTLTSNVADSPRNKKEKSS"
BASE COUNT          846 a          508 c          519 g          935 t
ORIGIN      
        1 agcgggcggc ccggcggctg cgtactggct gtgggatggg aagtgaagcc ccagcgagcg
       61 gctgcagcgg ggccgtgagg agcagccagc gggaggcggc ggcgagtcgg tgagcagctg
      121 ggaagagcag aaccggggcg gagcacctgc aggcgcgggc ggcggcccca ccatggcgat
      181 tcgcaagaaa agcaccaaga gccccccagt gctgagccac gaattcgtcc tgcagaatca
      241 cgcggacatc gtctcctgtg tggcgatggt cttcctgctg gggctcatgt ttgagataac
      301 ggcaaaagct tctatcattt ttgttactct tcagtacaat gtcaccctcc cagcaacaga
      361 agaacaagct actgaatcag tgtcccttta ttactatggc atcaaagatt tggctactgt
      421 tttcttctac atgctagtgg cgataattat tcatgccgta attcaagagt atatgttgga
      481 taaaattaac aggcgaatgc acttctccaa aacaaaacac agcaagttta atgaatctgg
      541 tcagcttagt gcgttctacc tttttgcctg tgtttggggc acattcattc tcatctctga
      601 aaactacatc tcagacccaa ctatcttatg gagggcttat ccccataacc tgatgacatt
      661 tcaaatgaag tttttctaca tatcacagct ggcttactgg cttcatgctt ttcctgaact
      721 ctacttccag aaaaccaaaa aagaagatat tcctcgtcag cttgtctaca ttggtcttta
      781 cctcttccac attgctggag cttacctttt gaacttgaat catctaggac ttgttcttct
      841 ggtgctacat tattttgttg aatttctttt ccacatttcc cgcctgtttt attttagcaa
      901 tgaaaagtat cagaaaggat tttctctgtg ggcagttctt tttgttttgg gaagacttct
      961 gactttaatt ctttcagtac tgactgttgg ttttggcctt gcaagagcag aaaatcagaa
     1021 gctggatttc agtactggaa acttcaatgt gttagctgtt agaatcgctg ttctggcatc
     1081 catttgcgtt actcaggcat ttatgatgtg gaagttcatt aattttcagc ttcgaaggtg
     1141 gagggaacat tctgcttttc aggcaccagc tgtgaagaag aaaccaacag taactaaagg
     1201 cagatcttct aaaaaaggaa cagaaaatgg tgtgaatgga acattaactt caaatgtagc
     1261 agactctccc cggaataaaa aagagaaatc ttcataatga attataaact aattgattaa
     1321 tgtccccaaa gaaatctgct ttctactata tctttcagca ttagagattt ttctgttctt
     1381 gaaaatacag tctgtgctct ttgatttttg ctattgtacg gtttcatgca tttttttaaa
     1441 gggcatttga ggggaggatt attgctatga atgaaaaaaa tattttagct tagactaagc
     1501 tacctgcctt caaaatagtt tagggaccac caccatattt tattttgttt ttatttttga
     1561 acatttttct aatgatttgg agagaaaact atttacaaaa attccacata tcagtgatac
     1621 aatttcttgc tgtcaccaat tttttataat agcagagtgg cctgttctaa gaaggccata
     1681 ttttttaagt tatctttcag ggtaacatgg aaatactata aagttggatg tcaaacttta
     1741 atatgttttc agtgttctct aattttttgg aatttttgta gactttacac ctggaaaaaa
     1801 agatttgtaa aatcaccgga acaattgtgt gctttatttt ataggtagtg gttattagta
     1861 ttacatcccc attttaaaaa caaaaacata ataatggtta caacacgtgg agttttacta
     1921 acatacatat taaatcaaag tatattctta aaagtacttg tgaagtaaaa tctttcttgt
     1981 gcattttcaa tacttgtaaa ctggaaatca gaaaatattt actatgaaca ggaaaatctg
     2041 acatatagcc ctttttgata tgtttattaa taatgattct taatggggct cataataagt
     2101 ttaatatgca cagcatctta gaaaagttta acctgcaaac acttttaaaa cataatgcct
     2161 acttgattta tatctataaa aagactgaca ggtaattata tttggaaaac atttaatgca
     2221 ctaactttaa agaaattgaa aattcaggtg gataaatagt cttacaaaag acaatgtgct
     2281 ttatgttata cctatagctt tggtcccatc tttaattgag aaacatttat ctgtataaaa
     2341 catatttttg gataaatata tatatatata tttgtatcgc tacagaaagg ctctaaaaag
     2401 catttgagga aaatatttgg ttcccttttc tataatcatc ctttaagatt cttatagcta
     2461 catttggttt attcatcata tttacagtat atatattgtt cttttcagtg ttcacatctt
     2521 gttccccatt tctcacttgt gtcaccagct gtttgtgcca tttttagtgt aaaagttgca
     2581 gacctattag atctgcagtt taagttgcca tgctgctagg aaattgtcct ttttctttct
     2641 agctgttaac ctacttcctg gaaaaagtag tagctctctg tagcattatg gagtttcagt
     2701 ggaaccaaat ttttgccatt aaaaactggc attatactga actatacatt gagaaatcaa
     2761 tcaaaataaa aatttttact ttcacaagtt gcaaaaaaaa aaaaaaaa
//