LOCUS       BC036804                1147 bp    mRNA    linear   HUM 25-MAR-2004
DEFINITION  Homo sapiens chromosome 9 open reading frame 95, mRNA (cDNA clone
            MGC:46068 IMAGE:5727308), complete cds.
ACCESSION   BC036804
VERSION     BC036804.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1147)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 1147)
  AUTHORS   Strausberg,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (23-AUG-2002) National Institutes of Health, Mammalian
            Gene Collection (MGC), Cancer Genomics Office, National Cancer
            Institute, 31 Center Drive, Room 11A03, Bethesda, MD 20892-2590,
            USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: Invitrogen
            cDNA Library Preparation: Life Technologies, Inc.
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: National Institutes of Health Intramural
            Sequencing Center (NISC),
            Gaithersburg, Maryland;
            Web site: http://www.nisc.nih.gov/
            Contact: nisc_mgc@nhgri.nih.gov
            Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
            Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
            Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
            Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
            Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
            McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
            Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
            Young,A., Zhang,L.-H. and Green,E.D.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAK Plate: 79 Row: h Column: 12
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 8923529.
FEATURES             Location/Qualifiers
     source          1..1147
                     /db_xref="H-InvDB:HIT000051819"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:46068 IMAGE:5727308"
                     /tissue_type="Brain, hippocampus"
                     /clone_lib="NIH_MGC_124"
                     /lab_host="DH10B"
                     /note="Vector: pCMV-SPORT6"
     gene            1..1147
                     /gene="C9orf95"
                     /gene_synonym="FLJ20559"
                     /db_xref="GeneID:54981"
     CDS             246..773
                     /gene="C9orf95"
                     /gene_synonym="FLJ20559"
                     /codon_start=1
                     /product="C9orf95 protein"
                     /protein_id="AAH36804.1"
                     /db_xref="GeneID:54981"
                     /translation="MKTFIIGISGVTNSGKTTLAKNLQKHLPNCSVISQDDFFKPESE
                     IETDKNGFLQYDVLEALNMEKMMSAISCWMESARHSVVSTDQESAEEIPILIIEGFLL
                     FNYNTRVYQPPDSPGYFDGHVWPMYLKYRQEMQDITWEVVYLDGTKSEEDLFLQVYED
                     LIQELAKQKCLQVTA"
BASE COUNT          373 a          233 c          268 g          273 t
ORIGIN      
        1 caacgggggc tggaacccgg cgccgagagt agagaaaagg ggcctctggt gaccgcccct
       61 acctggcatc cctctaaccc aggaggagcg tggggaaagg ggctgtgggc ctctcgggga
      121 gcgagctgcg ggtagcggcg cactgggtac aggcgcgcgc ttggctgtcg cctctgccgc
      181 tgtgtttggg aggactcgaa ctggcgccag gaaatattag gaagctgtga ttttcaaagc
      241 taattatgaa aacatttatc attggaatca gtggtgtgac aaacagtggc aaaacaacac
      301 tggctaagaa tttgcagaaa cacctcccaa attgcagtgt catatctcag gatgatttct
      361 tcaagccaga gtctgagata gagacagata aaaatggatt tttgcagtac gatgtgcttg
      421 aagcacttaa catggaaaaa atgatgtcag ccatttcctg ctggatggaa agcgcaagac
      481 actctgtggt atcaacagac caggaaagtg ctgaggaaat tcccatttta atcatcgaag
      541 gttttcttct ttttaattat aatacaaggg tctatcagcc tccagactct ccgggatact
      601 ttgatggcca tgtgtggccc atgtatctaa agtacagaca agaaatgcag gacatcacat
      661 gggaagttgt gtacctggat ggaacaaaat ctgaagagga cctctttttg caagtatatg
      721 aagatctaat acaagaacta gcaaagcaaa agtgtttgca agtgacagca taaagacgga
      781 acacaacaaa tccttcctga agtgaattag gaaactccaa ggagtaattt aagaaccttc
      841 accaagatac aatgtatact gtggtacaat gacagccatt gtttcatatg tttgattttt
      901 attgcacatg gttttcccaa catgtggaac aataaatatc catgccaatg gacaggactg
      961 taccttagca agttgctccc tctccaggga gcgcatagat acagcagagc tcacagtgag
     1021 tcagaaagtc tccactttct gaacatagct ctataacaat gattgtcaaa cttttctaac
     1081 tggagctcag agtaagaaat aaagattaca tcacaatcca aaaaaaaaaa aaaaaaaaaa
     1141 aaaaaaa
//