LOCUS       BC035673                2071 bp    mRNA    linear   HUM 04-NOV-2003
DEFINITION  Homo sapiens TAF2 RNA polymerase II, TATA box binding protein
            (TBP)-associated factor, 150kDa, mRNA (cDNA clone IMAGE:5741328),
            partial cds.
ACCESSION   BC035673
VERSION     BC035673.2
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2071)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 2071)
  AUTHORS   Strausberg,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (31-JUL-2002) National Institutes of Health, Mammalian
            Gene Collection (MGC), Cancer Genomics Office, National Cancer
            Institute, 31 Center Drive, Room 11A03, Bethesda, MD 20892-2590,
            USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     On Aug 25, 2003 this sequence version replaced BC035673.1.
            Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC
            cDNA Library Preparation: Life Technologies, Inc.
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: National Institutes of Health Intramural
            Sequencing Center (NISC),
            Gaithersburg, Maryland;
            Web site: http://www.nisc.nih.gov/
            Contact: nisc_mgc@nhgri.nih.gov
            Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
            Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
            Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
            Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
            Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
            McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
            Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
            Young,A., Zhang,L.-H. and Green,E.D.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAK Plate: 79 Row: k Column: 5
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 20357590.
FEATURES             Location/Qualifiers
     source          1..2071
                     /db_xref="H-InvDB:HIT000094016"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="IMAGE:5741328"
                     /tissue_type="Duodenum, adenocarcinoma"
                     /clone_lib="NIH_MGC_88"
                     /lab_host="DH10B"
                     /note="Vector: pCMV-SPORT6"
     gene            1..>2071
                     /gene="TAF2"
                     /gene_synonym="CIF150"
                     /gene_synonym="TAF2B"
                     /gene_synonym="TAFII150"
                     /db_xref="GeneID:6873"
                     /db_xref="MIM:604912"
     CDS             260..>2071
                     /gene="TAF2"
                     /gene_synonym="CIF150"
                     /gene_synonym="TAF2B"
                     /gene_synonym="TAFII150"
                     /codon_start=1
                     /product="TAF2 protein"
                     /protein_id="AAH35673.1"
                     /db_xref="GeneID:6873"
                     /db_xref="MIM:604912"
                     /translation="MPLTGVEPARMNRKKGDKGFESPRPYKLTHQVVCINNINFQRKS
                     VVGFVELTIFPTVANLNRIKLNSKQCRIYRVRINDLEAAFIYNDPTLEVCHSESKQRN
                     LNYFSNAYAAAVSAVDPDAGNGELCIKVPSELWKHVDELKVLKIHINFSLDQPKGGLH
                     FVVPSVEGSMAERGAHVFSCGYQNSTRFWFPCVDSYSELCTWKLEFTVDAAMVAVSNG
                     DLVETVYTHDMRKKTFHYMLTIPTAASNISLAIGPFEILVDPYMHEVTHFCLPQLLPL
                     LKHTTSYLHEVFEFYEEILTCRYPYSCFKTVFIDEAYVEVAAYASMSIFSTNLLHSAM
                     IIDETPLTRRCLAQSLAQQFFGCFISRMSWSDEWVLKGISGYIYGLWMKKTFGVNEYR
                     HWIKEELDKIVAYELKTGGVLLHPIFGGGKEKDNPASHLHFSIKHPHTLSWEYYTMFQ
                     CKAHLVMRLIENRISMEFMLQVFNKLLSLASTASSQKFQSHMWSQMLVSTSGFLKSIS
                     NVSGKDIQPLIKQWVDQSGVVKFYGSFAFNRKRNVLELEIKQDYTSPGTQKYVGPLKV
                     TVQELDGSFNHTLQIEENSLKHDIPCHSKSRRNKKKKK"
     misc_feature    326..1510
                     /gene="TAF2"
                     /gene_synonym="CIF150"
                     /gene_synonym="TAF2B"
                     /gene_synonym="TAFII150"
                     /note="Peptidase_M1; Region: Peptidase family M1. Members
                     of this family are aminopeptidases. The members differ
                     widely in specificity, hydrolysing acidic, basic or
                     neutral N-terminal residues. This family includes
                     leukotriene-A4 hydrolase, this enzyme also has an
                     aminopeptidase activity"
                     /db_xref="CDD:pfam01433"
BASE COUNT          616 a          387 c          483 g          585 t
ORIGIN      
        1 ggacgcgtgg ggtagcttcg agcccttgtg gagaggagca tctctgtgac agaagcttgt
       61 cgacggcggc ttctaggagc tagtcgaagg agcgaggttg aggcgggcag cgacccgtca
      121 ggtcgctcac ctgggcaccg gccagctgcg agacgtgact tggggaccgc aggggagtgg
      181 agagtgtgag gtgccaaaga ctagtaatgc cccgtatgcc cctaggaagc cgggaagcca
      241 agctccgcgg gaccgcttca tgccgctgac tggtgtagag cccgccagaa tgaacaggaa
      301 gaaaggagac aagggctttg aaagcccaag gccatataaa ttaacccatc aggtcgtctg
      361 catcaacaac ataaatttcc agagaaaatc tgttgtggga tttgtggaac tgactatatt
      421 tcccacagtt gcaaacttga atagaatcaa gttgaacagc aaacagtgta gaatataccg
      481 agtaaggatc aatgatttag aggctgcttt tatttataat gacccaacct tggaagtttg
      541 tcacagtgaa tcaaaacaga gaaacctcaa ttatttttcc aatgcttatg cagctgcagt
      601 tagtgctgtg gaccctgatg caggaaatgg agaactttgc attaaggttc catcagagct
      661 atggaaacac gttgatgagt taaaggtcct gaagatacac atcaattttt ctttggatca
      721 gcccaaagga ggtcttcatt ttgtggtacc cagtgtagag ggaagtatgg cagagagagg
      781 tgctcatgtt ttctcttgtg ggtatcaaaa ttctacaaga ttttggttcc cttgtgttga
      841 ttcatactct gaattgtgta catggaaatt agaatttaca gtagatgctg caatggttgc
      901 tgtttctaat ggcgatttgg tggagacagt gtatactcat gatatgagga agaaaacttt
      961 ccattatatg cttaccattc ctacagcagc gtcaaatatc tccttggcca ttggaccatt
     1021 tgaaatactg gtagatccat acatgcatga ggttactcat ttttgtttgc cccaacttct
     1081 tccattgctg aaacatacca catcatacct tcatgaagtc tttgaatttt atgaagaaat
     1141 tcttacatgt cgttacccat actcctgttt taagactgtc ttcattgatg aggcttatgt
     1201 tgaagtggct gcttatgctt ccatgagcat ttttagcaca aatcttttac acagtgccat
     1261 gattatagat gagacacctt tgactagaag gtgtttagcc caatccttgg cccagcagtt
     1321 ttttggttgt ttcatatcta gaatgtcttg gtctgatgaa tgggtgctga agggaatttc
     1381 aggctatatc tatggacttt ggatgaaaaa aacttttggt gttaatgagt accgccattg
     1441 gattaaagag gagctagaca aaatagtggc atatgaacta aaaactggtg gggttttact
     1501 acatcccata tttggtggag gaaaagagaa ggataatccg gcttcccatc tacacttttc
     1561 aataaagcat ccacatacac tatcctggga atactacact atgtttcagt gtaaagccca
     1621 ccttgtgatg agattgattg aaaataggat cagtatggaa tttatgctac aagttttcaa
     1681 taaactgcta agtctggcta gtactgcttc atctcagaag ttccagtcac atatgtggag
     1741 tcagatgttg gtttccacat ctgggttttt gaaatccatt tcaaatgtct ctggcaaaga
     1801 tattcagccg ttaataaagc agtgggtaga tcagagtgga gtggtaaaat tttatggaag
     1861 ttttgcattt aatagaaaac gaaatgtctt ggaactggaa ataaaacagg actatacatc
     1921 tcctggaact cagaaatacg tgggaccact taaagtgaca gtgcaggagt tagatggatc
     1981 cttcaatcat acactgcaaa ttgaagaaaa cagccttaaa catgatatac cctgccattc
     2041 caaaagtaga aggaataaaa aaaaaaaaaa a
//