LOCUS       BC034917                3535 bp    mRNA    linear   HUM 07-OCT-2003
DEFINITION  Homo sapiens Rho-related BTB domain containing 2, mRNA (cDNA clone
            MGC:45608 IMAGE:4647716), complete cds.
ACCESSION   BC034917
VERSION     BC034917.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 3535)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 3535)
  AUTHORS   Strausberg,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (29-JUL-2002) National Institutes of Health, Mammalian
            Gene Collection (MGC), Cancer Genomics Office, National Cancer
            Institute, 31 Center Drive, Room 11A03, Bethesda, MD 20892-2590,
            USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC
            cDNA Library Preparation: Rubin Laboratory
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Genome Sequence Centre,
            BC Cancer Agency, Vancouver, BC, Canada
            info@bcgsc.bc.ca
            Steven Jones, Jennifer Asano, Ian Bosdet, Yaron Butterfield,
            Susanna Chan, Readman Chiu, Chris Fjell, Erin Garland, Ran Guin,
            Letticia Hsiao, Martin Krzywinski, Reta Kutsche, Oliver Lee, Soo
            Sen Lee, Victor Ling, Carrie Mathewson, Candice McLeavy, Steven
            Ness, Pawan Pandoh, Anna-Liisa Prabhu, Parvaneh Saeedi, Jacqueline
            Schein, Duane Smailus, Michael Smith, Lorraine Spence, Jeff Stott,
            Michael Thorne, Miranada Tsai, Natasja van den Bosch, Jill Vardy,
            George Yang, Scott Zuyderduyn, Marco Marra.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 43 Row: g Column: 7
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 14165285.
FEATURES             Location/Qualifiers
     source          1..3535
                     /db_xref="H-InvDB:HIT000051250"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:45608 IMAGE:4647716"
                     /tissue_type="Eye, retinoblastoma"
                     /clone_lib="NIH_MGC_16"
                     /lab_host="DH10B-R"
                     /note="Vector: pOTB7"
     gene            1..3535
                     /gene="RHOBTB2"
                     /gene_synonym="DBC2"
                     /gene_synonym="KIAA0717"
                     /db_xref="GeneID:23221"
                     /db_xref="MIM:607352"
     CDS             350..2533
                     /gene="RHOBTB2"
                     /gene_synonym="DBC2"
                     /gene_synonym="KIAA0717"
                     /codon_start=1
                     /product="RHOBTB2 protein"
                     /protein_id="AAH34917.1"
                     /db_xref="GeneID:23221"
                     /db_xref="MIM:607352"
                     /translation="MDSDMDYERPNVETIKCVVVGDNAVGKTRLICARACNATLTQYQ
                     LLATHVPTVWAIDQYRVCQEVLERSRDVVDDVSVSLRLWDTFGDHHKDRRFAYGRSDV
                     VVLCFSIANPNSLHHVKTMWYPEIKHFCPRAPVILVGCQLDLRYADLEAVNRARRPLA
                     RPIKPNEILPPEKGREVAKELGIPYYETSVVAQFGIKDVFDNAIRAALISRRHLQFWK
                     SHLRNVQRPLLQAPFLPPKPPPPIIVVPDPPSSSEECPAHLLEDPLCADVILVLQERV
                     RIFAHKIYLSTSSSKFYDLFLMDLSEGELGGPSEPGGTHPEDHQGHSDQHHHHHHHHH
                     GRDFLLRAASFDVCESVDEAGGSGPAGLRASTSDGILRGNGTGYLPGRGRVLSSWSRA
                     FVSIQEEMAEDPLTYKSRLMVVVKMDSSIQPGPFRAVLKYLYTGELDENERDLMHIAH
                     IAELLEVFDLRMMVANILNNEAFMNQEITKAFHVRRTNRVKECLAKGTFSDVTFILDD
                     GTISAHKPLLISSCDWMAAMFGGPFVESSTREVVFPYTSKSCMRAVLEYLYTGMFTSS
                     PDLDDMKLIILANRLCLPHLVALTEQYTVTGLMEATQMMVDIDGDVLVFLELAQFHCA
                     YQLADWCLHHICTNYNNVCRKFPRDMKAMSPENQEYFEKHRWPPVWYLKEEDHYQRAR
                     KEREKEDYLHLKRQPKRRWLFWNSPSSPSSSAASSSSPSSSSAVV"
     misc_feature    398..973
                     /gene="RHOBTB2"
                     /gene_synonym="DBC2"
                     /gene_synonym="KIAA0717"
                     /note="RHO; Region: Rho (Ras homology) subfamily of
                     Ras-like small GTPases"
                     /db_xref="CDD:smart00174"
     misc_feature    1610..1759
                     /gene="RHOBTB2"
                     /gene_synonym="DBC2"
                     /gene_synonym="KIAA0717"
                     /note="BTB; Region: Broad-Complex, Tramtrack and Bric a
                     brac"
                     /db_xref="CDD:smart00225"
     misc_feature    1820..2143
                     /gene="RHOBTB2"
                     /gene_synonym="DBC2"
                     /gene_synonym="KIAA0717"
                     /note="BTB; Region: BTB/POZ domain. The BTB (for BR-C, ttk
                     and bab) or POZ (for Pox virus and Zinc finger) domain is
                     present near the N-terminus of a fraction of zinc finger
                     (pfam00096) proteins and in proteins that contain the
                     pfam01344 motif such as Kelch and a family of pox virus
                     proteins. The BTB/POZ domain mediates homomeric
                     dimerisation and in some instances heteromeric
                     dimerisation. The structure of the dimerised PLZF BTB/POZ
                     domain has been solved and consists of a tightly
                     intertwined homodimer. The central scaffolding of the
                     protein is made up of a cluster of alpha-helices flanked
                     by short beta-sheets at both the top and bottom of the
                     molecule. POZ domains from several zinc finger proteins
                     have been shown to mediate transcriptional repression and
                     to interact with components of histone deacetylase
                     co-repressor complexes including N-CoR and SMRT. The POZ
                     or BTB domain is also known as BR-C/Ttk or ZiN"
                     /db_xref="CDD:pfam00651"
BASE COUNT          810 a         1085 c          943 g          697 t
ORIGIN      
        1 gtccttcacc tgccttccca taagctggac tttggatccc agcccttaaa acccttgtgt
       61 tgtttcttcc tgcagacctg gtcgagaaca ctacttcagg acagggaata gtgacaggcc
      121 agcagagccc cagaggcgag gtggcagtaa acaagaatat gcacgcgcag tggaccactt
      181 ctgaaggtca acatataact ttctcatccc tgacatcaac tgtcatccct gtgagcagaa
      241 ccaactacca aaggagagag gagcctggag ggaacacaga gcgatgcaag cctggagaaa
      301 aggccccgat ggcccccaga agacctcttc agacagcatg tcccgtttaa tggattctga
      361 catggattat gaaaggccaa acgtagagac catcaagtgc gttgtggtgg gggacaacgc
      421 cgtgggtaag accaggctca tctgtgcccg cgcttgcaat gccaccctca cccagtacca
      481 gctgctggcc acgcatgtgc ccacagtatg ggccatcgac caatatcgtg tgtgccagga
      541 ggtgctggaa cgctcccgag acgtggtaga tgatgtcagc gtctctctgc gcctctggga
      601 cacctttgga gaccaccaca aagaccgtcg ctttgcttat gggagatctg atgtggtggt
      661 tctgtgcttc tccattgcca accccaattc cctccaccat gtcaagacca tgtggtaccc
      721 agaaatcaag cacttctgcc cccgagcacc tgtcatcttg gtgggctgcc agttggacct
      781 gcgctacgct gacctggagg ctgtcaacag ggctaggcga cccttggcta ggcccatcaa
      841 acctaatgaa atcctgcccc cagagaaggg tcgggaggtg gccaaggagc tgggcatccc
      901 ctactatgag accagcgtgg tggcccagtt cggcatcaag gacgtctttg acaacgccat
      961 ccgagctgca ctcatctccc gccgccacct gcagttctgg aagtcccacc tccgcaatgt
     1021 gcagcggcct ctgctgcagg cacccttcct accccccaag ccaccgcccc cgatcatcgt
     1081 ggtgcccgac cctccctcca gcagcgagga gtgccccgcc cacctcctgg aggacccgct
     1141 ctgcgcggac gtcatcctgg tgctgcagga gcgggtgcgc atctttgccc acaagatcta
     1201 cctctccacc tcctcctcca agttctatga cctgttcctc atggacctga gtgaggggga
     1261 gctggggggc ccctcggagc cagggggcac ccacccagag gaccaccagg gccactctga
     1321 tcaacaccac caccatcacc accaccacca tgggcgagac ttcctgctcc gagcagccag
     1381 ctttgacgtg tgcgagagcg tggatgaggc tgggggctcc ggtcctgctg gcctccgtgc
     1441 ttccaccagc gacgggatct tacggggcaa cggaacaggg tacctaccgg gcaggggtcg
     1501 tgtgctgtct tcctggagcc gagcttttgt gagcatccag gaagagatgg cagaagatcc
     1561 tctcacctac aaatcccggc tgatggtggt ggtgaagatg gacagttcca tccagccggg
     1621 gcccttccgg gctgtcctca agtacctgta cacgggggag ctagatgaga acgagcgtga
     1681 cctcatgcac attgcccaca ttgctgagct gctcgaggtc tttgatctgc gcatgatggt
     1741 ggccaacatt ctcaacaatg aggccttcat gaaccaggag atcaccaagg ccttccacgt
     1801 ccgccggacc aaccgggtta aggagtgctt ggcaaaaggc accttctcag atgtgacctt
     1861 catcctggat gatggcacca tcagcgccca caagcccctg ttgatttcca gctgtgactg
     1921 gatggctgcc atgtttgggg ggccatttgt ggagagctcc acccgggagg tggtgtttcc
     1981 ctacacaagc aagagctgca tgcgggccgt gctggaatac ctctacaccg gcatgttcac
     2041 ctccagcccc gacctggatg acatgaagct catcattcta gccaaccgcc tctgcctgcc
     2101 acacctggtt gccctcacag agcagtacac agtgaccggg ctgatggaag cgacccagat
     2161 gatggtggac atcgatgggg acgtccttgt gttcctggaa ctggctcagt tccactgtgc
     2221 gtaccagctg gccgactggt gtctccacca catctgcacc aactacaaca acgtgtgccg
     2281 caagttcccc cgagacatga aggccatgtc cccagaaaac caggagtatt tcgagaagca
     2341 tcggtggcca cctgtgtggt acctgaagga ggaagatcat taccagcggg cacggaagga
     2401 gcgtgagaag gaggactacc tccacctcaa gcggcagccc aaacggcgtt ggctcttctg
     2461 gaacagtcca tcctccccgt cttcctcggc agcctcctcc tcatccccat cttcctcctc
     2521 ggctgtggtc tgagatgctg ccaccctctt ctgaccctgc tgctgttgtc cccatccgcc
     2581 ttcacccctc tgctcttccg catcacccca tccaccttac agggaccagg gggcccacgt
     2641 aaccaggacc cagagggtgg agctcttctt accagccacc gtggctcagc cagagaggag
     2701 ctgagccctg tggagcagaa cgggaaccac ctgcagaggt ccccagaccc aaagcaggac
     2761 gggagacaac tgcttggagg agcgaagagc cctggcattt tatctctggg tttgagagcc
     2821 ctagagtcaa agggaaagcc tcccagcctc cagggcttct ctgtgtgtct tggttgctgc
     2881 tctggccagg gaggcagccc cactcccagc aagcagaagt gatcctcgag ggtcctgccc
     2941 ctgttggcca tatctttcca ccgacggact tgagtgttgc atttgttttg tgggcatttc
     3001 cacacgaagc ctactcacac cctcactgga gaagtcaggg tagaaattga gccttcagag
     3061 cccaactcaa ggcttctaca tcctggggtg cagctgcaaa aggccagacg tggaaaggcc
     3121 tgtatcctgc cagtgtccct ccgtcccagg gggctgtgct ggcacagacc tgagaatggg
     3181 gacacaggtc attcagagct ccaggcctgg aagcagtgcc tcttggtgca acaagaaact
     3241 tctccctcac cccctccttt accctcagat ttggagatgg taaccaaagg aagcagctgg
     3301 gacaggtgga gaaggaagta ggaatgagtg cacggcgacc ccgtgctcct cagggccctc
     3361 ccctgcctct gggtggcact gctttttata gggtggggca aaattagcaa aaaacaaaaa
     3421 ccaatgacaa ccaaactgaa accgaaacga aaaatcaacg aacactctgt cctctatccc
     3481 tccaaagaat gaaaatcaga aaaagaaaaa aaaaaaaaaa aaaaaaaaaa aaaaa
//