LOCUS       BC033788                1814 bp    mRNA    linear   HUM 15-JUL-2006
DEFINITION  Homo sapiens tripartite motif-containing 17, mRNA (cDNA clone
            MGC:45102 IMAGE:5165609), complete cds.
ACCESSION   BC033788
VERSION     BC033788.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1814)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 1814)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (02-JUL-2002) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: Life Technologies, Inc.
            cDNA Library Preparation: Life Technologies, Inc.
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: National Institutes of Health Intramural
            Sequencing Center (NISC),
            Gaithersburg, Maryland;
            Web site: http://www.nisc.nih.gov/
            Contact: nisc_mgc@nhgri.nih.gov
            Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
            Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
            Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
            Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
            Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
            McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
            Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
            Young,A., Zhang,L.-H. and Green,E.D.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAK Plate: 68 Row: h Column: 7
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 68160929.
FEATURES             Location/Qualifiers
     source          1..1814
                     /db_xref="H-InvDB:HIT000041954"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:45102 IMAGE:5165609"
                     /tissue_type="Brain, adult medulla"
                     /clone_lib="NIH_MGC_119"
                     /lab_host="DH10B"
                     /note="Vector: pCMV-SPORT6"
     gene            1..1814
                     /gene="TRIM17"
                     /gene_synonym="RBCC"
                     /gene_synonym="terf"
                     /db_xref="GeneID:51127"
                     /db_xref="HGNC:HGNC:13430"
                     /db_xref="MIM:606123"
     CDS             150..1583
                     /gene="TRIM17"
                     /gene_synonym="RBCC"
                     /gene_synonym="terf"
                     /codon_start=1
                     /product="tripartite motif-containing 17"
                     /protein_id="AAH33788.1"
                     /db_xref="GeneID:51127"
                     /db_xref="HGNC:HGNC:13430"
                     /db_xref="MIM:606123"
                     /translation="MEAVELARKLQEEATCSICLDYFTDPVMTTCGHNFCRACIQLSW
                     EKARGKKGRRKRKGSFPCPECREMSPQRNLLPNRLLTKVAEMAQQHPGLQKQDLCQEH
                     HEPLKLFCQKDQSPICVVCRESREHRLHRVLPAEEAVQGYKLKLEEDMEYLREQITRT
                     GNLQAREEQSLAEWQGKVKERRERIVLEFEKMNLYLVEEEQRLLQALETEEEETASRL
                     RESVACLDRQGHSLELLLLQLEERSTQGPLQMLQDMKEPLSRKNNVSVQCPEVAPPTR
                     PRTVCRVPGQIEVLRGFLEDVVPDATSAYPYLLLYESRQRRYLGSSPEGSGFCSKDRF
                     VAYPCAVGQTAFSSGRHYWEVGMNITGDALWALGVCRDNVSRKDRVPKCPENGFWVVQ
                     LSKGTKYLSTFSALTPVMLMEPPSHMGIFLDFEAGEVSFYSVSDGSHLHTYSQATFPG
                     PLQPFFCLGAPKSGQMVISTVTMWVKG"
BASE COUNT          428 a          507 c          570 g          309 t
ORIGIN      
        1 cgggccgggc cgcagcctcc tgggcttcgt gggggcagac ccagcctttc ccggcagcga
       61 gcgctcggcc aggtgcacta ggcgctgtgc gggcccccct tccccgcgag tccctcaagc
      121 gggaacctgc ctcgtgtctc ccaggagcca tggaggctgt ggaactcgcc agaaaactgc
      181 aggaggaagc tacgtgctcc atctgtctgg attacttcac agaccctgtg atgaccacct
      241 gtggccacaa cttctgccga gcctgcatcc agctgagctg ggaaaaggcg aggggcaaga
      301 aggggaggcg gaagcggaag ggctccttcc cctgccccga gtgcagagag atgtccccgc
      361 agaggaacct gctgcccaac cggctgctga ccaaggtggc cgagatggcg cagcagcatc
      421 ctggtctgca gaagcaagac ctgtgccagg agcaccacga gcccctcaag cttttctgcc
      481 agaaggacca gagccccatc tgtgtggtgt gcagggagtc ccgggagcac cggctgcaca
      541 gggtgctgcc cgccgaggag gcagtgcagg ggtacaagtt gaagctggag gaggacatgg
      601 agtaccttcg ggagcagatc accaggacag ggaatctgca ggccagggag gagcagagct
      661 tagccgagtg gcagggcaag gtgaaggagc ggagagaacg cattgtgctg gagtttgaga
      721 agatgaacct ctacctggtg gaagaagagc agaggctcct ccaggctctg gagacggaag
      781 aagaggagac tgccagcagg ctccgggaga gcgtggcctg cctggaccgg cagggtcact
      841 ctctggagct gctgctgctg cagctggagg agcggagcac acaggggccc ctccagatgc
      901 tgcaggacat gaaggaaccc ctgagcagga agaacaacgt gagtgtgcag tgcccagagg
      961 ttgccccccc aaccagaccc aggactgtgt gcagagttcc cggacagatt gaagtgctaa
     1021 gaggctttct agaggatgtg gtgcctgatg ccacctccgc gtacccctac ctcctcctgt
     1081 atgagagccg ccagaggcgc tacctcggct cttcgccgga gggcagtggg ttctgcagca
     1141 aggaccgatt tgtggcttac ccctgtgctg tgggccagac ggccttctcc tctgggaggc
     1201 actactggga ggtgggcatg aacatcaccg gggacgcgtt gtgggccctg ggtgtgtgca
     1261 gggacaacgt gagccggaaa gacagggtcc ccaagtgccc cgaaaacggc ttctgggtgg
     1321 tgcagctgtc caaggggacc aagtacttat ccaccttctc tgccctaacc ccggtcatgc
     1381 tgatggagcc tcccagccac atgggcatct tcctggactt cgaagccggg gaagtgtcct
     1441 tctacagtgt aagcgatggg tcccacctgc acacctactc ccaggccacc ttcccaggcc
     1501 ccctgcagcc tttcttctgc ctgggggctc cgaagtctgg tcagatggtc atctccacag
     1561 tgaccatgtg ggtgaaagga tagacacaga ccgggggact cgggcactgc tcctggctct
     1621 gcagaaggtg tgggccttct gcttactgca ggccacctgc cagggttctc tggcatcacg
     1681 ctggcagcca ttagacacac aggggggttt ctcaaattct aaatataatt gtgattagaa
     1741 ctgtcaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa
     1801 aaaaaaaaaa aaaa
//