LOCUS       BC033253                3463 bp    mRNA    linear   HUM 18-AUG-2006
DEFINITION  Homo sapiens KIAA1602, mRNA (cDNA clone IMAGE:5444737), partial
            cds.
ACCESSION   BC033253
VERSION     BC033253.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 3463)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 3463)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (25-JUN-2002) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: DCTD/DTP
            cDNA Library Preparation: Rubin Laboratory
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Genome Sequence Centre,
            BC Cancer Agency, Vancouver, BC, Canada
            info@bcgsc.bc.ca
            Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
            Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
            Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
            Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
            Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
            Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
            Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
            Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
            Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 43 Row: m Column: 23.
FEATURES             Location/Qualifiers
     source          1..3463
                     /db_xref="H-InvDB:HIT000093009"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="IMAGE:5444737"
                     /tissue_type="Skin, melanoma, amelanotic"
                     /clone_lib="NIH_MGC_41"
                     /lab_host="DH10B-R"
                     /note="Vector: pOTB7"
     gene            <1..3463
                     /gene="KIAA1602"
                     /gene_synonym="FP1193"
                     /db_xref="GeneID:57701"
                     /db_xref="HGNC:HGNC:29321"
     CDS             <1..2723
                     /gene="KIAA1602"
                     /gene_synonym="FP1193"
                     /codon_start=3
                     /product="KIAA1602 protein"
                     /protein_id="AAH33253.1"
                     /db_xref="GeneID:57701"
                     /db_xref="HGNC:HGNC:29321"
                     /translation="QVKSKLQIGPPSPGEAQGPLLPSPARGLKFLKLPPTSEKSPSPG
                     GPQLSPQLPRNSRIPCRNSGSDGSPSPLLARRGLGGGELSPEGAQGLPTSPSPCYTTP
                     DSTQLRPPQSALSTTLSPGPVVSPCYENILDLSRSTFRGPSPEPPPSPLQVPTYPQLT
                     LEVPQAPEVLRSPGVPPSPCLPESYPYGSPQEKSLDKAGSESPHPGRRTPGNSSKKPS
                     QGSGRRPGDPGSTPLRDRLAALGKLKTGPEGALGSEKNGVPARPGTEKTRGPGKSGES
                     AGDMVPSIHRPLEQLEAKGGIRGAVALGTNSLKQQEPGLMGDPGARVYSSHSMGARVD
                     LEPVSPRSCLTKVELAKSRLAGALCPQVPRTPAKVPTSAPSLGKPNKSPHSSPTKLPS
                     KSPTKVVPRPGAPLVTKESPKPDKGKGPPWADCGSTTAQSTPLVPGPTDPSQGPEGLA
                     PHSAIEEKVMKGIEENVLRLQGQERAPGAEVKHRNTSSIASWFGLKKSKLPALNRRTE
                     ATKNKEGAGGGSPLRREVKMEARKLEAESLNISKLMAKAEDLRRALEEEKAYLSSRAR
                     PRPGGPAPGPNTGLGQVQGQLAGMYQGADTFMQQLLNRVDGKELPSKSWREPKPEYGD
                     FQPVSSDPKSPWPACGPRNGLVGPLQGCGKPPGKPSSEPGRREEMPSEDSLAEPVPTS
                     HFTACGSLTRTLDSGIGTFPPPDHGSSGTPSKNLPKTKPPRLDPPPGVPPARPPPLTK
                     VPRRAHTLEREVPGIEELLVSGRHPSMPAFPALLPAAPGHRGHETCPDDPCEDPGPTP
                     PVQLAKNWTFPNTRAAGSSSDPLMCPPRQLEGLPRTPMALPVDRKRSQEPSRPSPTPQ
                     GPPFGGSRTPSTSDMAEEGRVASGGPPGLETSESLSDSLYDSLSSCGSQG"
BASE COUNT          715 a         1194 c         1021 g          533 t
ORIGIN      
        1 ctcaggtgaa aagcaagctc caaattggcc ccccttctcc tggggaagct cagggacccc
       61 ttctgccctc tccagctagg ggtctcaagt ttctaaagct gcctccaacc tcggagaaga
      121 gccccagccc aggaggcccg cagctcagtc cccagctccc ccggaactcg cgaatcccct
      181 gtcggaacag tggctcagac ggcagcccct ccccactgtt ggcccgaagg ggtctgggtg
      241 gaggagagct gtccccagag ggggcgcaag gcctgcccac cagcccttca ccctgctaca
      301 caaccccaga ctccacacag ctcagacccc cgcagtcagc cttgtccacc acgctgtccc
      361 caggcccagt ggtgtctccc tgctatgaga acattctgga cctttctcgg agcaccttta
      421 gggggccttc cccagagcca cctccatccc cactgcaggt gcccacctac ccacagctaa
      481 ctctggaggt accacaggcc cctgaggtcc tcagaagccc tggagtaccc cccagtcctt
      541 gcctcccaga atcgtacccc tatgggagcc cccaagagaa gagtttggac aaggcaggct
      601 cggagtctcc ccatcccggc cgcaggaccc caggcaactc atccaagaag cccagccagg
      661 ggtcaggacg gcgacctggg gatcctggca gcacacctct gcgggacaga ctggcggccc
      721 tggggaagct gaagacaggc cccgaggggg ccctgggctc agagaagaat ggggtgccag
      781 ccaggcctgg caccgaaaag acccggggac ctgggaagtc aggggagagt gctggagaca
      841 tggtgccctc catccacagg ccactggagc agctagaagc caaggggggg atacgggggg
      901 cagtggcctt gggcacaaac agcctgaagc agcaggaacc tggacttatg ggggatcccg
      961 gggcccgagt ctactcctct cactccatgg gggcccgggt ggacctggag cctgtctcac
     1021 caaggagctg cctcaccaaa gtggagctgg ccaagagccg gctggcaggg gccctgtgcc
     1081 cccaggtacc ccgtacccct gccaaagtgc caacctcagc cccaagcctg ggcaagccca
     1141 ataagagccc tcacagcagc cccaccaagc tcccttccaa gtcaccaacc aaggtggtgc
     1201 ctcgacctgg ggctccgcta gtcaccaagg agtcccccaa gcctgacaaa gggaagggcc
     1261 ctccctgggc agactgtggt agtaccacgg cccagtccac acccctagta cctggcccca
     1321 ctgacccaag tcagggccct gaggggctgg ccccacactc agccatcgag gagaaggtga
     1381 tgaagggcat tgaggagaac gtgctgcggc tccagggcca ggagcgagcc cctggcgccg
     1441 aggtcaagca ccgcaacacc agcagcatcg ccagctggtt cggccttaag aagagcaagc
     1501 tgccagcgct gaaccgccgc acagaggcca ccaagaacaa ggagggggct ggcgggggct
     1561 ccccgctccg gagggaagtc aagatggaag cccggaagct ggaggccgag agcctcaaca
     1621 tctccaagct gatggccaag gcggaagacc tgcgtcgggc actggaagag gagaaggcct
     1681 acctaagcag ccgggcccgg ccacggcctg gtggcccagc cccagggccc aacacggggc
     1741 tggggcaggt gcagggccag ctggctggca tgtaccaagg tgcagacacc ttcatgcagc
     1801 agctgctaaa cagggtggat ggcaaggagc tgccatccaa gagctggcgg gagcccaagc
     1861 ctgagtacgg ggatttccag ccggtgtctt ctgaccccaa gagcccctgg ccagcctgtg
     1921 ggccccggaa tggcctggtg ggccctcttc agggctgcgg aaaacctcct ggaaagccga
     1981 gcagcgagcc agggaggcgg gaagagatgc cctcggagga cagcctggcc gagccagtgc
     2041 ccacctcaca cttcacagcc tgtggctcct tgactcgaac cttggacagt ggcattggga
     2101 ccttcccacc cccagaccat ggtagcagtg ggacccccag caagaatctt cctaagacca
     2161 agccaccgcg gctggatccc ccacctgggg tacccccagc tcggccccca ccccttacca
     2221 aagtcccccg ccgcgcccac acactggagc gggaggtgcc aggcatagag gagctgctgg
     2281 tgagtgggcg gcaccccagc atgccagcct tccctgcact gctacccgct gctccgggcc
     2341 accggggcca tgagacctgt cctgatgatc cctgtgaaga cccaggcccc acccctcctg
     2401 tccagctggc caagaactgg accttcccca atactagggc agccggcagc tcctcggacc
     2461 ctctcatgtg cccaccccga caactggagg ggctgcccag gacccccatg gccctgcccg
     2521 tggaccggaa gcgaagccag gagcccagcc gcccgtcccc tacgccccag ggcccacctt
     2581 tcgggggtag ccgcaccccc agcacttcgg acatggccga ggaaggcaga gtggccagcg
     2641 ggggcccccc agggctggag acctcggagt ctctcagtga ctcactctac gactcgctgt
     2701 cctcttgtgg gagtcagggc tgaggggctg cgccacgcca cggccccgct ggagctgggg
     2761 accacagact ggaccggctc tcttcatgcc cagcccccgg agacggggac ccctccctga
     2821 agggaccaag gaggcaggtg gataagaagg tgaaaagggg gtccctggca caccccacca
     2881 cccactgctt cggcggatga gatgaccgtg cttagctcag ggagagaccc cgcccttggt
     2941 cccttctctc acccagagta aggctcttcc tggaagggac tgggggttaa aggccactgt
     3001 gtcgcagccc tccagtccct acttcaggct gagccatctt gtggtgctgg gcttcctgcc
     3061 caccagccgt gccatctctg cccaacccgg ctgctcctct gccccgaagc cctcgcgagg
     3121 ccctcctgga ggcccccgtg ctggtggagt ttgggggcca gggggacaag ttgccttctc
     3181 tctctgccct ggtcctccct gctgtctgga tggtgctgcc ctcctctgcc ccatgccttt
     3241 ggggtctgtt cgtccgtctt ttttgttgtt gtttttatat attgaagcgc ctggcccagc
     3301 ccccagcccc cagccccgca ctgcggttaa tttatgtgtt gtttaaaatg cggctgctct
     3361 gcttcctgcc tctgcttctg ccgtatccct aataaaatgt ggaggccccc aaaaaaaaaa
     3421 aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaa
//