LOCUS       BC033168                1192 bp    mRNA    linear   HUM 07-OCT-2003
DEFINITION  Homo sapiens twist homolog 2 (Drosophila), mRNA (cDNA clone
            MGC:45796 IMAGE:4549629), complete cds.
ACCESSION   BC033168
VERSION     BC033168.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1192)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 1192)
  AUTHORS   Strausberg,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-JUN-2002) National Institutes of Health, Mammalian
            Gene Collection (MGC), Cancer Genomics Office, National Cancer
            Institute, 31 Center Drive, Room 11A03, Bethesda, MD 20892-2590,
            USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: DCTD/DTP/Gazdar
            cDNA Library Preparation: Rubin Laboratory
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Genome Sequence Centre,
            BC Cancer Agency, Vancouver, BC, Canada
            info@bcgsc.bc.ca
            Steven Jones, Jennifer Asano, Ian Bosdet, Yaron Butterfield,
            Susanna Chan, Readman Chiu, Chris Fjell, Erin Garland, Ran Guin,
            Letticia Hsiao, Martin Krzywinski, Reta Kutsche, Oliver Lee, Soo
            Sen Lee, Victor Ling, Carrie Mathewson, Candice McLeavy, Steven
            Ness, Pawan Pandoh, Anna-Liisa Prabhu, Parvaneh Saeedi, Jacqueline
            Schein, Duane Smailus, Michael Smith, Lorraine Spence, Jeff Stott,
            Michael Thorne, Miranada Tsai, Natasja van den Bosch, Jill Vardy,
            George Yang, Scott Zuyderduyn, Marco Marra.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 43 Row: e Column: 7
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 17981707.
FEATURES             Location/Qualifiers
     source          1..1192
                     /db_xref="H-InvDB:HIT000041823"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:45796 IMAGE:4549629"
                     /tissue_type="Lung, large cell carcinoma"
                     /clone_lib="NIH_MGC_18"
                     /lab_host="DH10B-R"
                     /note="Vector: pOTB7"
     gene            1..1192
                     /gene="TWIST2"
                     /gene_synonym="DERMO1"
                     /db_xref="GeneID:117581"
                     /db_xref="MIM:607556"
     CDS             185..667
                     /gene="TWIST2"
                     /gene_synonym="DERMO1"
                     /codon_start=1
                     /product="TWIST2 protein"
                     /protein_id="AAH33168.1"
                     /db_xref="GeneID:117581"
                     /db_xref="MIM:607556"
                     /translation="MEEGSSSPVSPVDSLGTSEEELERQPKRFGRKRRYSKKSSEDGS
                     PTPGKRGKKGSPSAQSFEELQSQRILANVRERQRTQSLNEAFAALRKIIPTLPSDKLS
                     KIQTLKLAARYIDFLYQVLQSDEMDNKMTSCSYVAHERLSYAFSVWRMEGAWSMSASH
                     "
     misc_feature    383..535
                     /gene="TWIST2"
                     /gene_synonym="DERMO1"
                     /note="HLH; Region: Helix-loop-helix DNA-binding domain"
                     /db_xref="CDD:pfam00010"
BASE COUNT          295 a          372 c          334 g          191 t
ORIGIN      
        1 ctagagtttc caaaaaagtt agaataactt cctctcccgg agacctcggt tttgcacaag
       61 ccggccttga aatcagagcc tttccagcaa ctccgagagc gtgtgctcgg cgaccgcggg
      121 cttggccagc ggcgcgcgct cggcgccccg gcgcccccag ccccacgcgc gccgggcggg
      181 cgccatggag gagggctcca gctcgcccgt gtcccccgtg gacagcctgg gcaccagcga
      241 ggaggagctc gagaggcagc ccaagcgctt cggccggaag cggcgctaca gcaagaagtc
      301 gagcgaagat ggcagcccga ccccgggcaa gcgcggcaag aagggcagcc ccagcgcgca
      361 gtccttcgag gagctgcaga gccagcgcat cctggccaac gtgcgcgagc gccagcgcac
      421 ccagtcgctc aacgaggcct tcgcggcgct gcgcaagatc atccccacgc tgccctctga
      481 caagctgagc aagatccaga cgctcaagct ggccgccagg tacatagact tcctctacca
      541 ggtcctgcag agcgacgaga tggacaataa gatgaccagc tgcagctacg tggcccacga
      601 gcgcctcagc tacgccttct ccgtgtggcg catggagggc gcgtggtcca tgtccgcctc
      661 ccactagcgc cgcgccaccc acctccggac cggcgcgcca ggaggagatt ctgaatgatg
      721 ctgccattgc cagaccttct gctaccaaac agagcgaaga ggaagagggg gcagtgtttg
      781 gtcaagacag cccacgaaac gttggcggga gtgagcacat tagcaatggc taagaacatg
      841 cttgaatcat ttgtaacaac ccaggacaga gatgccacaa gaggactttg gggaaaggcg
      901 aatccactca tacatcttgg agttgttttt tcaagttcag aaaatgaacc ttcaccaagg
      961 tcttggaaca tgaagcagag actctggtgc tgactctatc atttgagctc ctaagggtac
     1021 tcatgcccag tggagcatgc acaccagcaa caccgccaac accatctcgg tgtcccaccc
     1081 cttagaggag gaagaggaca cagaggggcg cccggtaata accctcattt cctctcttcc
     1141 accccaccac atcatcttaa taaaacatga aggtaaaaaa aaaaaaaaaa aa
//