LOCUS       BC032362                1098 bp    mRNA    linear   HUM 07-OCT-2003
DEFINITION  Homo sapiens triggering receptor expressed on myeloid cells 2, mRNA
            (cDNA clone MGC:40278 IMAGE:5240587), complete cds.
ACCESSION   BC032362
VERSION     BC032362.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1098)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 1098)
  AUTHORS   Strausberg,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-JUN-2002) National Institutes of Health, Mammalian
            Gene Collection (MGC), Cancer Genomics Office, National Cancer
            Institute, 31 Center Drive, Room 11A03, Bethesda, MD 20892-2590,
            USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: Life Technologies, Inc.
            cDNA Library Preparation: Life Technologies, Inc.
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: National Institutes of Health Intramural
            Sequencing Center (NISC),
            Gaithersburg, Maryland;
            Web site: http://www.nisc.nih.gov/
            Contact: nisc_mgc@nhgri.nih.gov
            Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
            Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
            Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
            Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
            Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
            McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
            Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
            Young,A., Zhang,L.-H. and Green,E.D.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAK Plate: 64 Row: o Column: 16
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 9507202.
FEATURES             Location/Qualifiers
     source          1..1098
                     /db_xref="H-InvDB:HIT000041510"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:40278 IMAGE:5240587"
                     /tissue_type="Brain, fetal, whole pooled"
                     /clone_lib="NIH_MGC_121"
                     /lab_host="DH10B"
                     /note="Vector: pCMV-SPORT6"
     gene            1..1098
                     /gene="TREM2"
                     /gene_synonym="Trem2a"
                     /db_xref="GeneID:54209"
                     /db_xref="MIM:605086"
     CDS             22..690
                     /gene="TREM2"
                     /gene_synonym="Trem2a"
                     /codon_start=1
                     /product="TREM2 protein"
                     /protein_id="AAH32362.1"
                     /db_xref="GeneID:54209"
                     /db_xref="MIM:605086"
                     /translation="MEPLRLLILLFVTELSGAHNTTVFQGVAGQSLQVSCPYDSMKHW
                     GRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQP
                     HDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSIS
                     RPSQGSHLPSCLSKEPLGRRNPLPTHFHPSPPGLHLSHQDSSSQRPLGCSLAWTEARD
                     TSTQ"
BASE COUNT          307 a          299 c          285 g          207 t
ORIGIN      
        1 ccttggctgg ggaagggtgg catggagcct ctccggctgc tcatcttact ctttgtcaca
       61 gagctgtccg gagcccacaa caccacagtg ttccagggcg tggcgggcca gtccctgcag
      121 gtgtcttgcc cctatgactc catgaagcac tgggggaggc gcaaggcctg gtgccgccag
      181 ctgggagaga agggcccatg ccagcgtgtg gtcagcacgc acaacttgtg gctgctgtcc
      241 ttcctgagga ggtggaatgg gagcacagcc atcacagacg ataccctggg tggcactctc
      301 accattacgc tgcggaatct acaaccccat gatgcgggtc tctaccagtg ccagagcctc
      361 catggcagtg aggctgacac cctcaggaag gtcctggtgg aggtgctggc agaccccctg
      421 gatcaccggg atgctggaga tctctggttc cccggggagt ctgagagctt cgaggatgcc
      481 catgtggagc acagcatctc caggccatct caaggctccc atctgccttc ttgtctctcc
      541 aaggagcctc ttggaaggag aaatcccctt cccacccact tccatccttc tcctcctggc
      601 ctgcatcttt ctcatcaaga ttctagcagc cagcgccctc tgggctgcag cctggcatgg
      661 acagaagcca gggacacatc cacccagtga actggactgt ggccatgacc cagggtatca
      721 gctccaaact ctgccagggc tgagagacac gtgaaggaag atgatgggag gaaaagccca
      781 ggagaagtcc caccagggac cagcccagcc tgcatacttg ccacttggcc accaggactc
      841 cttgttctgc tctggcaaga gactactctg cctgaacact gcttctcctg gaccctggaa
      901 gcagggactg gttgagggag tggggaggtg gtaagaacac ctgacaactt ctgaatattg
      961 gacattttaa acacttacaa ataaatccaa gactgtcata tttagctgga taaaaaaaaa
     1021 aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa
     1081 aaaaaaaaaa aaaaaaaa
//