LOCUS       BC032148                 757 bp    mRNA    linear   HUM 15-JUL-2006
DEFINITION  Homo sapiens troponin I type 2 (skeletal, fast), mRNA (cDNA clone
            MGC:29564 IMAGE:5020339), complete cds.
ACCESSION   BC032148
VERSION     BC032148.2
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 757)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 757)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (06-JUN-2002) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     On Aug 19, 2003 this sequence version replaced BC032148.1.
            Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC
            cDNA Library Preparation: Rubin Laboratory
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: National Institutes of Health Intramural
            Sequencing Center (NISC),
            Gaithersburg, Maryland;
            Web site: http://www.nisc.nih.gov/
            Contact: nisc_mgc@nhgri.nih.gov
            Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
            Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
            Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
            Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
            Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
            McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
            Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
            Young,A., Zhang,L.-H. and Green,E.D.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 39 Row: n Column: 18
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 50593000.
FEATURES             Location/Qualifiers
     source          1..757
                     /db_xref="H-InvDB:HIT000041447"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:29564 IMAGE:5020339"
                     /tissue_type="Muscle, rhabdomyosarcoma"
                     /clone_lib="NIH_MGC_17"
                     /lab_host="DH10B-R"
                     /note="Vector: pOTB7"
     gene            1..757
                     /gene="TNNI2"
                     /gene_synonym="AMCD2B"
                     /gene_synonym="DA2B"
                     /gene_synonym="FSSV"
                     /db_xref="GeneID:7136"
                     /db_xref="HGNC:HGNC:11946"
                     /db_xref="MIM:191043"
     CDS             62..610
                     /gene="TNNI2"
                     /gene_synonym="AMCD2B"
                     /gene_synonym="DA2B"
                     /gene_synonym="FSSV"
                     /codon_start=1
                     /product="troponin I type 2 (skeletal, fast)"
                     /protein_id="AAH32148.1"
                     /db_xref="GeneID:7136"
                     /db_xref="HGNC:HGNC:11946"
                     /db_xref="MIM:191043"
                     /translation="MGDEEKRNRAITARRQHLKSVMLQIAATELEKEESRREAEKQNY
                     LAEHCPPLHIPGSMSEVQELCKQLHAKIDAAEEEKYDMEVRVQKTSKELEDMNQKLFD
                     LRGKFKRPPLRRVRMSADAMLKALLGSKHKVCMDLRANLKQVKKEDTEKERDLRDVGD
                     WRKNIEEKSGMEGRKKMFESES"
BASE COUNT          209 a          195 c          251 g          102 t
ORIGIN      
        1 ctcaccctgg ggaattccaa gacattgtcc ttgaaggagg ctccaagctc aggacctcag
       61 gatgggagat gaggagaagc ggaacagggc catcacggcc cgcaggcagc acctgaagag
      121 cgtgatgctg cagatagcgg ccacggagct ggagaaggag gagagccgcc gtgaggcaga
      181 gaagcagaac tacctggcgg agcactgccc gccgctgcat atcccgggct ccatgtctga
      241 agtgcaggag ctctgcaaac agctgcacgc caagatcgat gcggctgaag aggagaagta
      301 cgacatggag gtgagggtgc agaagaccag caaggagctg gaggacatga accagaagct
      361 atttgatctg cggggcaagt tcaagcggcc cccactgcgg agggtgcgca tgtcggccga
      421 tgccatgctc aaggccctgc tgggctcgaa gcacaaggtg tgcatggacc tgagggccaa
      481 cctgaagcag gtcaagaagg aggacacaga gaaggagcgg gacctgcgag acgtgggtga
      541 ctggaggaag aacatcgagg agaagtctgg catggagggc cggaagaaga tgtttgagtc
      601 cgagtcctag gccactcgct gcccctacgc ctgccccggt gcccggctcc cagcagaaca
      661 tactagggag atgcacccag agcctgccag ggagggctgg cctcaccacc accgtcaata
      721 aaggatttga atccccaaaa aaaaaaaaaa aaaaaaa
//