LOCUS       BC030514                2550 bp    mRNA    linear   HUM 15-JUL-2006
DEFINITION  Homo sapiens tudor domain containing 3, mRNA (cDNA clone MGC:40253
            IMAGE:4998330), complete cds.
ACCESSION   BC030514
VERSION     BC030514.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2550)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 2550)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (07-MAY-2002) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC
            cDNA Library Preparation: Life Technologies, Inc.
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: National Institutes of Health Intramural
            Sequencing Center (NISC),
            Gaithersburg, Maryland;
            Web site: http://www.nisc.nih.gov/
            Contact: nisc_mgc@nhgri.nih.gov
            Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
            Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
            Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
            Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
            Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
            McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
            Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
            Young,A., Zhang,L.-H. and Green,E.D.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAK Plate: 64 Row: c Column: 17
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 13540575.
FEATURES             Location/Qualifiers
     source          1..2550
                     /db_xref="H-InvDB:HIT000041022"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:40253 IMAGE:4998330"
                     /tissue_type="Placenta, choriocarcinoma"
                     /clone_lib="NIH_MGC_10"
                     /lab_host="DH10B"
                     /note="Vector: pCMV-SPORT6"
     gene            1..2550
                     /gene="TDRD3"
                     /gene_synonym="FLJ21007"
                     /gene_synonym="RP11-459E2.1"
                     /db_xref="GeneID:81550"
                     /db_xref="HGNC:HGNC:20612"
     CDS             311..2266
                     /gene="TDRD3"
                     /gene_synonym="FLJ21007"
                     /gene_synonym="RP11-459E2.1"
                     /codon_start=1
                     /product="tudor domain containing 3"
                     /protein_id="AAH30514.1"
                     /db_xref="GeneID:81550"
                     /db_xref="HGNC:HGNC:20612"
                     /translation="MLRLQMTDGHISCTAVEFSYMSKISLNTPPGTKVKLSGIVDIKN
                     GFLLLNDSNTTVLGGEVEHLIEKWELQRSLSKHNRSNIGTEGGPPPFVPFGQKCVSHV
                     QVDSRELDRRKTLQVTMPVKPTNDNDEFEKQRTAAIAEVAKSKETKTFGGGGGGARSN
                     LNMNAAGNRNREVLQKEKSTKSEGKHEGVYRELVDEKALKHITEMGFSKEASRQALMD
                     NGNNLEAALNVLLTSNKQKPVMGPPLRGRGKGRGRIRSEDEEDLGNARPSAPSTLFDF
                     LESKMGTLNVEEPKSQPQQLHQGQYRSSNTEQNGVKDNNHLRHPPRNDTRQPRNEKPP
                     RFQRDSQNSKSVLEGSGLPRNRGSERPSTSSVSEVWAEDRIKCDRPYSRYDRTKDTSY
                     PLGSQHSDGAFKKRDNSMQSRSGKGPSFAEAKENPLPQGSVDYNNQKRGKRESQTSIP
                     DYFYDRKSQTINNEAFSGIKIEKHFNVNTDYQNPVRSNSFIGVPNGEVEMPLKGRRIG
                     PIKPAGPVTAVPCDDKIFYNSGPKRRSGPIKPEKILESSIPMEYAKMWKPGDECFALY
                     WEDNKFYRAEVEALHSSGMTAVVKFIDYGNYEEVLLSNIKPIQTEAWEEEGTYDQTLE
                     FRRGGDGQPRRSTRPTQQFYQPPRARN"
BASE COUNT          922 a          472 c          555 g          601 t
ORIGIN      
        1 ccacgcgtcc gccgcctgtg ggcgctgcaa acgccacact tttgctctac gaagaacctc
       61 ctcgcgactt tccaaggtat ctttcagatg aaggcattga agcttgcaca agctctccag
      121 acaaagtcaa tgtaaatgac atcatcctga ttgctctcaa tatctgagaa caattggcaa
      181 gaaattcctc cccagtgaca tcaatagtgg aaaggtagaa aagctcgaag gtccatgtgt
      241 tttgcaaatt caaaaaattc gcaatgttgc tgcaccaaag gataatgaag aatctcaggc
      301 tgcaccaagg atgctgcgat tacagatgac tgatggtcat ataagttgca cagcagtaga
      361 atttagttat atgtcaaaaa taagcctgaa cacaccacct ggaactaaag ttaagctctc
      421 aggcattgtt gacataaaaa atggattcct gctcttgaat gactctaaca ccacagttct
      481 tggtggtgaa gtggaacacc ttattgagaa atgggagtta cagagaagct tatcaaaaca
      541 caatagaagc aatattggaa ctgaaggtgg accaccgcct tttgtgcctt ttggacagaa
      601 gtgtgtatct catgtccaag tggatagcag agaacttgat cgaagaaaaa cattgcaagt
      661 tacaatgcct gtcaaaccta caaatgataa tgatgaattt gaaaagcaaa ggacggctgc
      721 tattgctgaa gttgcaaaga gcaaggaaac caagacattt ggaggaggtg gtggtggtgc
      781 tagaagtaat ctcaatatga atgctgctgg taaccgaaat agggaagttt tacagaaaga
      841 aaagtcaacc aaatcagagg gaaaacatga aggtgtctat agagaactgg ttgatgagaa
      901 agctctgaag cacataacgg aaatgggctt cagtaaggaa gcatcgaggc aagctcttat
      961 ggataatggc aacaacttag aagcagcact gaacgtactt cttacaagca ataaacagaa
     1021 acctgttatg ggtcctcctc tgagaggtag aggaaaaggc agggggcgaa taagatctga
     1081 agatgaagag gacctgggaa atgcaaggcc atcagcacca agcacattat ttgatttctt
     1141 ggaatctaaa atgggaactt tgaatgtgga agaacctaaa tcacagccac agcagcttca
     1201 tcagggacaa tacagatcat caaatactga gcaaaatgga gtaaaagata ataatcatct
     1261 gagacatcct cctcgaaatg ataccaggca gccaagaaat gaaaaaccgc ctcgttttca
     1321 aagagactcc caaaattcaa agtcagtttt agaaggcagt ggattaccta gaaatagagg
     1381 ttctgaaaga ccaagtactt cttcagtatc tgaagtatgg gctgaagaca gaatcaaatg
     1441 tgatagaccg tattctagat atgacagaac taaagatact tcatatcctt taggttctca
     1501 gcatagtgat ggtgctttta aaaaaagaga taactctatg caaagcagat caggaaaagg
     1561 tccctccttt gcagaggcaa aagaaaatcc acttcctcaa ggatctgtag attataataa
     1621 tcaaaaacgt ggaaaaagag aaagccaaac atctattcct gattattttt atgacaggaa
     1681 atcacaaaca ataaataatg aagctttcag tggtataaaa attgaaaaac attttaatgt
     1741 aaatactgat tatcagaatc cagttcgaag taatagtttc attggtgttc caaatggaga
     1801 agtagaaatg ccactgaaag gaagacgaat aggacctatt aagccagcag gacctgtcac
     1861 agctgtaccc tgtgatgata aaatatttta caatagtggg cccaaacgaa gatctgggcc
     1921 aattaagcca gaaaaaatac tagaatcatc tattcctatg gagtatgcaa aaatgtggaa
     1981 acctggagat gaatgttttg cactttattg ggaagacaac aagttttacc gggcagaagt
     2041 tgaagccctc cattcttcgg gtatgacagc agttgttaaa ttcattgact acggaaacta
     2101 tgaagaggtg ctactgagca atatcaagcc cattcaaaca gaggcatggg aggaagaagg
     2161 cacctacgat caaactctgg agttccgtag gggaggtgat ggccagccaa gacgatccac
     2221 tcggccaacc caacagtttt accaaccacc ccgggctcgg aactaatagg aaaagtagac
     2281 tctttgtgaa gaaacgagcc agtgactgaa acaccctggt ggaaacctgt tgacagacct
     2341 tccactttct cttcagaata agtagctgtg gtggatatta ttatttgaag aaagaaaaaa
     2401 cagattttag ggtggaaaaa acagtcaact cacacaaaga atggaaaaaa atactgagtt
     2461 aaattaagca aatacctttt acaagtgaaa ggaagaattt ttcttctgcc gtcaataaaa
     2521 ccattgtgct attaaaaaaa aaaaaaaaaa
//