LOCUS       BC030205                1430 bp    mRNA    linear   HUM 15-JUL-2006
DEFINITION  Homo sapiens tumor necrosis factor, alpha-induced protein 6, mRNA
            (cDNA clone MGC:34404 IMAGE:5208773), complete cds.
ACCESSION   BC030205
VERSION     BC030205.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1430)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 1430)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (07-MAY-2002) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: Life Technologies, Inc.
            cDNA Library Preparation: Life Technologies, Inc.
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: National Institutes of Health Intramural
            Sequencing Center (NISC),
            Gaithersburg, Maryland;
            Web site: http://www.nisc.nih.gov/
            Contact: nisc_mgc@nhgri.nih.gov
            Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
            Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
            Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
            Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
            Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
            McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
            Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
            Young,A., Zhang,L.-H. and Green,E.D.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAK Plate: 49 Row: i Column: 16.
FEATURES             Location/Qualifiers
     source          1..1430
                     /db_xref="H-InvDB:HIT000040979"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:34404 IMAGE:5208773"
                     /tissue_type="Lung, Spleen, fetal, pooled"
                     /clone_lib="NIH_MGC_122"
                     /lab_host="DH10B"
                     /note="Vector: pCMV-SPORT6"
     gene            1..1430
                     /gene="TNFAIP6"
                     /gene_synonym="TSG6"
                     /db_xref="GeneID:7130"
                     /db_xref="HGNC:HGNC:11898"
                     /db_xref="MIM:600410"
     CDS             45..878
                     /gene="TNFAIP6"
                     /gene_synonym="TSG6"
                     /codon_start=1
                     /product="tumor necrosis factor, alpha-induced protein 6"
                     /protein_id="AAH30205.1"
                     /db_xref="GeneID:7130"
                     /db_xref="HGNC:HGNC:11898"
                     /db_xref="MIM:600410"
                     /translation="MIILIYLFLLLWEDTQGWGFKDGIFHNSIWLERAAGVYHREARS
                     GKYKLTYAEAKAVCEFEGGHLATYKQLEAARKIGFHVCAAGWMAKGRVGYPIVKPGPN
                     CGFGKTGIIDYGIRLNRSERWDAYCYNPHAKECGGVFTDPKQIFKSPGFPNEYEDNQI
                     CYWHIRLKYGQRIHLSFLDFDLEDDPGCLADYVEIYDSYDDVHGFVGRYCGDELPDDI
                     ISTGNVMTLKFLSDASVTAGGFQIKYVAMDPVSKSSQGKNTSTTSTGNKNFLAGRFSH
                     L"
BASE COUNT          480 a          237 c          271 g          442 t
ORIGIN      
        1 gtgagcagcc cctaacaggc tgttacttca ctacaactga cgatatgatc atcttaattt
       61 acttatttct cttgctatgg gaagacactc aaggatgggg attcaaggat ggaatttttc
      121 ataactccat atggcttgaa cgagcagccg gtgtgtacca cagagaagca cggtctggca
      181 aatacaagct cacctacgca gaagctaagg cggtgtgtga atttgaaggc ggccatctcg
      241 caacttacaa gcagctagag gcagccagaa aaattggatt tcatgtctgt gctgctggat
      301 ggatggctaa gggcagagtt ggatacccca ttgtgaagcc agggcccaac tgtggatttg
      361 gaaaaactgg cattattgat tatggaatcc gtctcaatag gagtgaaaga tgggatgcct
      421 attgctacaa cccacacgca aaggagtgtg gtggcgtctt tacagatcca aagcaaattt
      481 ttaaatctcc aggcttccca aatgagtacg aagataacca aatctgctac tggcacatta
      541 gactcaagta tggtcagcgt attcacctga gttttttaga ttttgacctt gaagatgacc
      601 caggttgctt ggctgattat gttgaaatat atgacagtta cgatgatgtc catggctttg
      661 tgggaagata ctgtggagat gagcttccag atgacatcat cagtacagga aatgtcatga
      721 ccttgaagtt tctaagtgat gcttcagtga cagctggagg tttccaaatc aaatatgttg
      781 caatggatcc tgtatccaaa tccagtcaag gaaaaaatac aagtactact tctactggaa
      841 ataaaaactt tttagctgga agatttagcc acttataaaa aaaaaaaaag gatgatcaaa
      901 acacacagtg tttatgttgg aatcttttgg aactcctttg atctcactgt tattattaac
      961 atttatttat tatttttcta aatgtgaaag caatacataa tttagggaaa attggaaaat
     1021 ataggaaact ttaaacgaga aaatgaaacc tctcataatc ccactgcata gaaataacaa
     1081 gcgttaacat tttcatattt ttttctttca gtcatttttc tatttgtggt atatgtatat
     1141 atgtacctat atgtatttgc atttgaaatt ttggaatcct gctctatgta cagttttgta
     1201 ttatactttt taaatcttga actttataaa cattttctga aatcattgat tattctacaa
     1261 aaacatgatt ttaaacagct gtaaaatatt ctatgatatg aatgttttat gcattattta
     1321 agcctgtctc tattgttgga atttcaggtc attttcataa atattgttgc aataaatatc
     1381 cttgaacaca aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa
//