LOCUS       BC029925                2626 bp    mRNA    linear   HUM 30-SEP-2003
DEFINITION  Homo sapiens TYRO3 protein tyrosine kinase, mRNA (cDNA clone
            IMAGE:5113923), partial cds.
ACCESSION   BC029925
VERSION     BC029925.2
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2626)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 2626)
  AUTHORS   Strausberg,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-MAY-2002) National Institutes of Health, Mammalian
            Gene Collection (MGC), Cancer Genomics Office, National Cancer
            Institute, 31 Center Drive, Room 11A03, Bethesda, MD 20892-2590,
            USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     On Sep 16, 2003 this sequence version replaced BC029925.1.
            Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC
            cDNA Library Preparation: Life Technologies, Inc.
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Baylor College of Medicine Human Genome
            Sequencing Center
            Center code: BCM-HGSC
            Web site: http://www.hgsc.bcm.tmc.edu/cdna/
            Contact: amg@bcm.tmc.edu
            Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
            Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
            A.N., Gibbs, R.A.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAK Plate: 52 Row: g Column: 20
            This clone was selected for full length sequencing because it
            passed the following selection criteria: Hexamer frequency ORF
            analysis.
FEATURES             Location/Qualifiers
     source          1..2626
                     /db_xref="H-InvDB:HIT000091946"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="IMAGE:5113923"
                     /tissue_type="Cervix, carcinoma"
                     /clone_lib="NIH_MGC_12"
                     /lab_host="DH10B"
                     /note="Vector: pCMV-SPORT6"
     gene            <1..2626
                     /gene="TYRO3"
                     /gene_synonym="BYK"
                     /gene_synonym="RSE"
                     /db_xref="GeneID:7301"
                     /db_xref="MIM:600341"
     CDS             <1..1559
                     /gene="TYRO3"
                     /gene_synonym="BYK"
                     /gene_synonym="RSE"
                     /codon_start=3
                     /product="TYRO3 protein"
                     /protein_id="AAH29925.2"
                     /db_xref="GeneID:7301"
                     /db_xref="MIM:600341"
                     /translation="TVEGTRANLTGWDPQKDLIVRVCVSNAVGCGPWSQPLVVSSHDR
                     AGQQGPPHSRTSWVPVVLGVLTALVTAAALALILLRKRRKETRFGQAFDSVMARGEPA
                     VHFRAARSFNRERPERIEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSV
                     REAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRS
                     RAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQTLIRFMVDIACGMEYLSS
                     RNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLAD
                     NLYTVQSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEDVYDL
                     MYQCWSADPKQRPSFTCLRMELENILGQLSVLSASQDPLYINIERAEEPTAGGSLELP
                     GRDQPYSGAGDGSGMGAVGGTPSDCRYILTPGGLAEQPGQAEHQPESPLNETQRLLLL
                     QQGLLPHSSC"
     misc_feature    441..1244
                     /gene="TYRO3"
                     /gene_synonym="BYK"
                     /gene_synonym="RSE"
                     /note="TyrKc; Region: Tyrosine kinase, catalytic domain"
                     /db_xref="CDD:smart00219"
BASE COUNT          575 a          712 c          784 g          555 t
ORIGIN      
        1 tgacagtgga ggggaccagg gccaatttga caggctggga tccccaaaag gacctgatcg
       61 tacgtgtgtg cgtctccaat gcagttggct gtggaccctg gagtcagcca ctggtggtct
      121 cttctcatga ccgtgcaggc cagcagggcc ctcctcacag ccgcacatcc tgggtacctg
      181 tggtccttgg tgtgctaacg gccctggtga cggctgctgc cctggccctc atcctgcttc
      241 gaaagagacg gaaagagacg cggtttgggc aagcctttga cagtgtcatg gcccggggag
      301 agccagccgt tcacttccgg gcagcccggt ccttcaatcg agaaaggccc gagcgcatcg
      361 aggccacatt ggacagcttg ggcatcagcg atgaactaaa ggaaaaactg gaggatgtgc
      421 tcatcccaga gcagcagttc accctgggcc ggatgttggg caaaggagag tttggttcag
      481 tgcgggaggc ccagctgaag caagaggatg gctcctttgt gaaagtggct gtgaagatgc
      541 tgaaagctga catcattgcc tcaagcgaca ttgaagagtt cctcagggaa gcagcttgca
      601 tgaaggagtt tgaccatcca cacgtggcca aacttgttgg ggtaagcctc cggagcaggg
      661 ctaaaggccg tctccccatc cccatggtca tcttgccctt catgaagcat ggggacctgc
      721 atgccttcct gctcgcctcc cggattgggg agaacccctt taacctaccc ctccagaccc
      781 tgatccggtt catggtggac attgcctgcg gcatggagta cctgagctct cggaacttca
      841 tccaccgaga cctggctgct cggaattgca tgctggcaga ggacatgaca gtgtgtgtgg
      901 ctgacttcgg actctcccgg aagatctaca gtggggacta ctatcgtcaa ggctgtgcct
      961 ccaaactgcc tgtcaagtgg ctggccctgg agagcctggc cgacaacctg tatactgtgc
     1021 agagtgacgt gtgggcgttc ggggtgacca tgtgggagat catgacacgt gggcagacgc
     1081 catatgctgg catcgaaaac gctgagattt acaactacct cattggcggg aaccgcctga
     1141 aacagcctcc ggagtgtatg gaggacgtgt atgatctcat gtaccagtgc tggagtgctg
     1201 accccaagca gcgcccgagc tttacttgtc tgcgaatgga actggagaac atcttgggcc
     1261 agctgtctgt gctatctgcc agccaggacc ccttatacat caacatcgag agagctgagg
     1321 agcccactgc gggaggcagc ctggagctac ctggcaggga tcagccctac agtggggctg
     1381 gggatggcag tggcatgggg gcagtgggtg gcactcccag tgactgtcgg tacatactca
     1441 cccccggagg gctggctgag cagccagggc aggcagagca ccagccagag agtcccctca
     1501 atgagacaca gaggcttttg ctgctgcagc aagggctact gccacacagt agctgttagc
     1561 ccacaggcag agggcatcgg ggccatttgg ccggctctgg tggccactga gctggctgac
     1621 taagccccgt ctgaccccag cccagacagc aaggtgtgga ggctcctgtg gtagtcctcc
     1681 caagctgtgc tgggaagccc ggactgacca aatcacccaa tcccagttct tcctgcaacc
     1741 actctgtggc cagcctggca tcagtttagg ccttggcttg atggaagtgg gccagtcctg
     1801 gttgtctgaa cccaggcagc tggcaggagt ggggtggtta tgtttccatg gttaccatgg
     1861 gtgtggatgg cagtgtgggg agggcaggtc cagctctgtg ggccctaccc tcctgctgag
     1921 ctgcccctgc tgcttaagtg catgcattga gctgcctcca gcctggtggc ccagctatta
     1981 ccacacttgg ggtttaaata tccaggtgtg cccctccaag tcacaaagag atgtccttgt
     2041 aatattccct tttaggtgag ggttggtaag gggttggtat ctcaggtctg aatcttcacc
     2101 atctttctga ttccgcaccc tgcctacgcc aggagaagtt gaggggagca tgcttccctg
     2161 cagctgaccg ggtcacacaa aggcatgctg gagtacccag cctatcaggt gcccctcttc
     2221 caaaggcagc gtgccgagcc agcaagagga aggggtgctg tgaggcttgc ccaggagcaa
     2281 gtgaggccgg agaggagttc aggaaccctt ctccataccc acaatctgag cacgctacca
     2341 aatctcaaaa tatcctaaga ctaacaaagg cagctgtgtc tgagcccaac ccttctaaac
     2401 ggtgaccttt agtgccaact tcccctctaa ctggacagcc tcttctgtcc caagtctcca
     2461 gagagaaatc aggcctgatg agggggaatt cctggaacct ggaccccagc cttggtgggg
     2521 gagcctctgg aatgcatggg gcgggtccta gctgttaggg acatttccaa gctgttagtt
     2581 gctgtttaaa atagaaataa aattgaagac taaaaaaaaa aaaaaa
//