LOCUS       BC027611                2788 bp    mRNA    linear   HUM 17-JUL-2006
DEFINITION  Homo sapiens zinc finger, SWIM-type containing 3, mRNA (cDNA clone
            MGC:27014 IMAGE:4829980), complete cds.
ACCESSION   BC027611
VERSION     BC027611.2
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2788)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 2788)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (08-APR-2002) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     On Aug 25, 2003 this sequence version replaced BC027611.1.
            Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: Miklos Palkovits, M.D., Ph.D.
            cDNA Library Preparation: Michael J. Brownstein (NHGRI) &  Shiraki
            Toshiyuki and Piero Carninci (RIKEN)
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Institute for Systems Biology
            http://www.systemsbiology.org
            contact: amadan@systemsbiology.org
            Anup Madan, Jessica Fahey, Erin Helton, Mark Ketteman, Anuradha
            Madan, Stephanie Rodrigues, Amy Sanchez and Michelle Whiting
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAK Plate: 34 Row: h Column: 15
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 57863254.
FEATURES             Location/Qualifiers
     source          1..2788
                     /db_xref="H-InvDB:HIT000040288"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:27014 IMAGE:4829980"
                     /tissue_type="Testis"
                     /clone_lib="NIH_MGC_97"
                     /lab_host="DH10B"
                     /note="Vector: pBluescriptR"
     gene            1..2788
                     /gene="ZSWIM3"
                     /db_xref="GeneID:140831"
                     /db_xref="HGNC:HGNC:16157"
     CDS             203..2293
                     /gene="ZSWIM3"
                     /codon_start=1
                     /product="zinc finger, SWIM-type containing 3"
                     /protein_id="AAH27611.1"
                     /db_xref="GeneID:140831"
                     /db_xref="HGNC:HGNC:16157"
                     /translation="MELGSCFKTYEDFKECFSAYKRENRCSFILRDCVSVRFHNLNHG
                     TSIREDILYVQVKFVCIRTQSNRKRTREADMCPAYLLLRYNERLDRLFISELNTQHIH
                     GDSKVASPGGDTTGKSQKTMCLQRLQPVQPTTKKDLDTAEKSLVEPSFCLDKVQVSSK
                     PEQEGITPSDLAKIAKVMKNFLKVDEGSMASFSVGDSQHLDRLSFQSSKMTDLFIRFP
                     ENLLLHRVENTQGHILYAFLVENKERESRVVHFAVLKAETVTSVAKMLSIFTEFNSDW
                     PKVKVVFVDPSFHYRAILQEIFPAARILLSIYHTTRLLEKKLHRSSANPSFKRLMKEA
                     LREAVFVTSEASLKNLCQMSQAVLDEDLFNFLQAHWFTCELLWYMHVRKGLLACNTYM
                     DSLDIVTSKVSSLFREQQSLLDCILCFVDYIDFFNTKGLKNLPTPPPKLKRARPASMP
                     LKSKKAFGICGESLTSLPAEETKPDAQQVQVQQQSQVPPSQVGMLDTLHQSGSELAYK
                     LCHNEWEVVQNSTHLVDMAGSSVDVQLLEDSHQVSKDGCSCSCSFQQWYHLPCRHILA
                     LLHTSQQPVGEAMVCRRWQKKYQYLLGPNGELQDRGMVPNTGQPEKQGRNDMIQDLSR
                     ELANLLMQTEGPELEERYSTLRKIVDIWAGPSQPSELFQQPGDFKDVGRLPFLWGKQE
                     EGEGFPPATAVMHY"
BASE COUNT          696 a          737 c          715 g          640 t
ORIGIN      
        1 aaatgcaccc ccttcctctt gtaacccggt caggcctagg gttcctccct gagttccaga
       61 ataggccacc cagttggggc ggacccttaa ggcattctgg gcccacgcct gcctataaac
      121 cctcatagtg tgacctttga cccctggtgt gatcttgggc ccgggctggg accagcccct
      181 agtgtgggtt gtgggggcgg ccatggagct gggcagctgc ttcaagacct atgaggactt
      241 caaggagtgc ttcagcgcct acaaaaggga gaacaggtgc tccttcattc tcagggactg
      301 cgtctccgtc cgcttccaca acctcaacca tggcacctcc atccgcgaag acatcctgta
      361 tgtgcaggtg aaatttgtct gcattcggac ccaatcaaac aggaagagaa cgcgggaggc
      421 agacatgtgc ccagcgtact tgctcctaag gtacaacgag agactagata gactatttat
      481 cagtgaacta aacacacagc acatacatgg tgactctaaa gtggctagtc ctggaggaga
      541 caccactggc aaatctcaaa agacaatgtg cctgcagaga ctccagcctg tgcagcccac
      601 aaccaaaaaa gaccttgaca ctgccgagaa gtccctggtt gagccatcgt tttgcctaga
      661 taaggtacaa gtgtcctcaa agccagagca ggaaggcatc actccttctg acctggccaa
      721 gatagcaaaa gtgatgaaga actttcttaa ggtagatgag ggttccatgg cttccttcag
      781 tgtgggtgac agccagcacc tggaccggct cagcttccag agcagtaaga tgaccgacct
      841 gttcatccgc ttcccagaga atctcttgct acaccgggtg gagaacaccc agggccacat
      901 cctctatgct ttcttggtgg agaacaagga acgagaaagt cgagtggtgc actttgctgt
      961 gctcaaggcg gagacagtca cctctgtggc caagatgctg agcatcttca cagagttcaa
     1021 ctccgattgg cccaaggtca aggtggtctt tgtggaccct tcattccatt accgggctat
     1081 cctgcaggag atctttcctg ctgcccgcat cctcctttcc atctaccaca caacccgact
     1141 cttggagaag aagttgcatc gtagttcagc aaatccatcc tttaaaaggc tcatgaagga
     1201 agccctgcgg gaggccgtgt ttgtcacttc tgaagccagc ctgaaaaatc tctgccagat
     1261 gtcccaggcc gtactggatg aggatctctt caacttcctg caggcccact ggttcacctg
     1321 tgaactgctg tggtacatgc atgttaggaa gggcctgctt gcgtgtaaca cctacatgga
     1381 cagcctagac attgtcacca gcaaggtgtc aagcctcttt cgggaacagc agtcgctgct
     1441 ggactgcatc ctctgctttg tggattacat agacttcttt aataccaaag gcttgaagaa
     1501 cttgcccaca cctcctccca aattaaagag agctcggccg gcaagcatgc cactgaagtc
     1561 caagaaggct tttggaatct gtggagagag ccttaccagc ctccctgcag aagagaccaa
     1621 gccagacgca cagcaggtac aggtacagca gcagtcacaa gtgccgccct cgcaggttgg
     1681 catgctggac accttgcacc agagtggctc tgaactagcc tacaagctgt gccacaatga
     1741 gtgggaggtg gtacagaact ccacccacct ggtggacatg gctggctctt cagtggacgt
     1801 tcagctgcta gaggactctc accaggttag caaagatggc tgtagctgca gctgttcctt
     1861 tcaacaatgg taccacctgc catgccgaca cattttggct ctgctgcaca ccagccagca
     1921 gccggttggt gaagccatgg tgtgccgccg gtggcagaag aagtaccagt acctccttgg
     1981 gcccaatggg gagctccagg atcgtggtat ggtcccaaac acaggccagc ctgagaagca
     2041 aggacggaac gacatgattc aggacctaag cagggagtta gcaaacctgc tcatgcagac
     2101 cgaggggcca gagctggagg aacgctactc caccctgcgc aagattgtgg atatctgggc
     2161 tggcccctcc cagccatctg agctctttca gcagccagga gactttaagg acgtgggccg
     2221 cctccctttc ctctggggaa agcaagaaga aggggaggga ttccctcctg ctacagctgt
     2281 gatgcattat tgaagcactt tagctgaagc attggaccac aaacacttct ccttggaagt
     2341 gtgagagttt aaagtgggca ggacatacta gggtttagca ttttagccaa tgtcttccta
     2401 ggtggggcta ggaatattgt tacagtagag aggaagggaa ctccactgtg tgacagtcct
     2461 ttcaatctgc cccttttcag ccctactttt ggcattcctt gggagcctca gttgttgttc
     2521 aaggccaaag ttatctccgt gctgcaaggt caccctcttc ctcccccagc ccctgagatc
     2581 agatcttatt tgctctgcaa agatgaatcc ctgcctcagg ttagggtgag acaaaatcgg
     2641 tctggtaaaa gggcctgttt tcagggacaa agggaatgag gatgatcttt ggctgttgct
     2701 gctctttatg aagaatctta tttgtaactt tttattcata ttaaagttgt ttttaataaa
     2761 attaaacaag ggaaaaaaaa aaaaaaaa
//