LOCUS       BC025266                1886 bp    mRNA    linear   HUM 19-JUN-2006
DEFINITION  Homo sapiens taspase, threonine aspartase, 1, mRNA (cDNA clone
            MGC:39159 IMAGE:3929609), complete cds.
ACCESSION   BC025266
VERSION     BC025266.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1886)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 1886)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (05-MAR-2002) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: DCTD/DTP
            cDNA Library Preparation: Rubin Laboratory
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Genome Sequence Centre,
            BC Cancer Agency, Vancouver, BC, Canada
            info@bcgsc.bc.ca
            Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
            Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
            Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
            Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
            Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
            Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
            Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
            Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
            Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 42 Row: b Column: 8
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 8923201.
FEATURES             Location/Qualifiers
     source          1..1886
                     /db_xref="H-InvDB:HIT000039872"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:39159 IMAGE:3929609"
                     /tissue_type="Ovary, adenocarcinoma"
                     /clone_lib="NIH_MGC_9"
                     /lab_host="DH10B-R"
                     /note="Vector: pOTB7"
     gene            1..1886
                     /gene="TASP1"
                     /gene_synonym="dJ585I14.2"
                     /gene_synonym="FLJ20212"
                     /gene_synonym="MGC39159"
                     /db_xref="GeneID:55617"
                     /db_xref="HGNC:HGNC:15859"
                     /db_xref="MIM:608270"
     CDS             98..1360
                     /gene="TASP1"
                     /gene_synonym="dJ585I14.2"
                     /gene_synonym="FLJ20212"
                     /gene_synonym="MGC39159"
                     /codon_start=1
                     /product="taspase, threonine aspartase, 1"
                     /protein_id="AAH25266.1"
                     /db_xref="GeneID:55617"
                     /db_xref="HGNC:HGNC:15859"
                     /db_xref="MIM:608270"
                     /translation="MTMEKGMSSGEGLPSRSSQVSAGKITAKELETKQSYKEKRGGFV
                     LVHAGAGYHSESKAKEYKHVCKRACQKAIEKLQAGALATDAVTAALVELEDSPFTNAG
                     MGSNLNLLGEIECDASIMDGKSLNFGAVGALSGIKNPVSVANRLLCEGQKGKLSAGRI
                     PPCFLVGEGAYRWAVDHGIPSCPPNIMTTRFSLAAFKRNKRKLELAERVDTDFMQLKK
                     RRQSSEKENDSGTLDTVGAVVVDHEGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAE
                     NTGAHNPYSTAVSTSGCGEHLVRTILARECSHALQAEDAHQALLETMQNKFISSPFLA
                     SEDGVLGGVIVLRSCRCSAEPDSSQNKQTLLVEFLWSHTTESMCVGYMSAQDGKAKTH
                     ISRLPPGAVAGQSVAIEGGVCRLESPVN"
BASE COUNT          517 a          360 c          509 g          500 t
ORIGIN      
        1 gtgaaggctc ggggctgaag cggggtaatt cctctcctgc aattactttt ggatggaagt
       61 atgccccttt ctcagtagaa gatggtaatc ttggagaatg accatggaga aggggatgag
      121 ttctggagaa gggctgcctt ccagatcatc tcaggtttcg gctggtaaaa taacagccaa
      181 agagttggaa acaaagcagt cctataaaga gaaacgagga ggctttgtgt tggtgcatgc
      241 aggtgcaggt tatcattctg aatccaaagc caaggagtat aaacatgtat gcaaacgagc
      301 ttgtcagaag gcaattgaaa agctgcaggc cggtgctctt gcaactgacg cagtcactgc
      361 agcactggtg gaacttgagg attctccttt tacaaatgca ggaatgggat ctaatctaaa
      421 tctgttaggt gaaattgagt gtgatgccag cataatggat ggaaaatcct taaattttgg
      481 agcagttgga gcactgagtg gaatcaagaa cccagtctcg gttgccaaca gactcttatg
      541 tgaagggcag aagggcaagc tctcggctgg cagaattcct ccctgctttt tagttggaga
      601 aggagcctac agatgggcag tagatcatgg aataccctct tgccctccta acatcatgac
      661 cacaagattc agtttagctg catttaaaag aaacaagagg aaactagagc tggcagaaag
      721 ggtggacaca gattttatgc aactaaagaa aagaagacaa tcaagtgaga aggaaaatga
      781 ctcaggcact ttggacacgg taggcgctgt ggttgtggac cacgaaggga atgttgctgc
      841 tgctgtctcc agtggaggct tggccttgaa acatccgggg agagttgggc aggctgctct
      901 ttatggatgt ggctgctggg ctgaaaatac tggagctcat aacccctact ccacagctgt
      961 gagtacctca ggatgtggag agcatcttgt gcgcaccata ctggctagag aatgttcaca
     1021 tgctttacaa gctgaggatg ctcaccaagc cctgttggag actatgcaaa acaagtttat
     1081 cagttcacct ttccttgcca gtgaagatgg cgtgcttggc ggagtgattg tcctccgttc
     1141 atgcagatgt tctgccgagc ctgactcctc ccaaaataag cagacacttc tagtggaatt
     1201 tctgtggagc cacacgacgg agagcatgtg tgtcggatat atgtcagccc aggatgggaa
     1261 agccaagact cacatttcaa gacttcctcc tggtgcggtg gcaggacagt ctgtggcaat
     1321 cgaaggtggg gtgtgccgcc tggagagccc agtgaactga cccttcaggc tgagtgtgaa
     1381 gcgtctcaga ggcatttcag aacctgagct tttgggggtt tttaactgaa gttggttgtt
     1441 ttatctttct tgttttataa ttcctattgc aacctcgtgc actgctcgag acacaagtgc
     1501 tgctgtagtt agcgcttagt gacacgcggg cctttggtgg gtgagcggga ctgtgtgtga
     1561 gtgtgtgcgc gtatgtgcgc acatatgtgt atgtgtggag tatgtgtgtt tgcttctccg
     1621 tggatgaaat agaaactcct cattgtgtga ccaggaatgg ttaaatcatc tttacaaaat
     1681 gtgtgcttta actgtttaca agtaaaacct aaagttgcag gaaacatttt ttatttcgta
     1741 aagaggtacc aactgtcgct gatgtgatat gtcagaactg aagagtaaat ctacttgttt
     1801 aaatgacttg acagtggtag tgctccattt aataacagta ataagtaata aagtgttttt
     1861 atttgttaaa aaaaaaaaaa aaaaaa
//