LOCUS       BC024186                1685 bp    mRNA    linear   HUM 17-JUL-2006
DEFINITION  Homo sapiens zinc finger, MYND-type containing 12, mRNA (cDNA clone
            MGC:26592 IMAGE:4826255), complete cds.
ACCESSION   BC024186
VERSION     BC024186.2
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1685)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 1685)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (19-FEB-2002) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     On Aug 25, 2003 this sequence version replaced BC024186.1.
            Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: Miklos Palkovits, M.D., Ph.D.
            cDNA Library Preparation: Michael J. Brownstein (NHGRI) &  Shiraki
            Toshiyuki and Piero Carninci (RIKEN)
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Institute for Systems Biology
            http://www.systemsbiology.org
            contact: amadan@systemsbiology.org
            Anup Madan, Jessica Fahey, Erin Helton, Mark Ketteman, Anuradha
            Madan, Stephanie Rodrigues, Amy Sanchez and Michelle Whiting
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAK Plate: 33 Row: n Column: 18
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 34222153.
FEATURES             Location/Qualifiers
     source          1..1685
                     /db_xref="H-InvDB:HIT000039756"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:26592 IMAGE:4826255"
                     /tissue_type="Testis"
                     /clone_lib="NIH_MGC_97"
                     /lab_host="DH10B"
                     /note="Vector: pBluescriptR"
     gene            1..1685
                     /gene="ZMYND12"
                     /gene_synonym="DKFZp434N2435"
                     /db_xref="GeneID:84217"
                     /db_xref="HGNC:HGNC:21192"
     CDS             260..1357
                     /gene="ZMYND12"
                     /gene_synonym="DKFZp434N2435"
                     /codon_start=1
                     /product="zinc finger, MYND-type containing 12"
                     /protein_id="AAH24186.1"
                     /db_xref="GeneID:84217"
                     /db_xref="HGNC:HGNC:21192"
                     /translation="MNVIYPLAVPKGRRLCCEVCEAPAERVCAACTVTYYCGVVHQKA
                     DWDSIHEKICQLLIPLRTSMPFYNSEEERQHGLQQLQQRQKYLIEFCYTIAQKYLFEG
                     KHEDAVPAALQSLRFRVKLYGLSSVELVPAYLLLAEASLGLGRIVQAEEYLFQAQWTV
                     LKSTDCSNATHSLLHRNLGLLYIAKKNYEEARYHLANDIYFASCAFGTEDIRTSGGYF
                     HLANIFYDLKKLDLADTLYTKVSEIWHAYLNNHYQVLSQAHIQQMDLLGKLFENDTGL
                     DEAQEAEAIRILTSILNIRESTSDKAPQKTIFVLKILVMLYYLMMNSSKAQEYGMRAL
                     SLAKEQQLDVHEQSTIQELLSLISTEDHPIT"
BASE COUNT          444 a          416 c          368 g          457 t
ORIGIN      
        1 ctttctggac ttggactcct tgggagtcgt ttctcggcca tttgacccgt gggacttgtg
       61 ggttttgtgc tgctttttct ttctttcttc cccttttcca acttcagcaa tacacccaga
      121 tgttagtcga gtcacgtccc gccgccctct gcccttgaaa tgctggcaag tacgcagccc
      181 cgcgatcgtc acgtgacgcc ggggttcagc gtatccttgc tgggcaaccg tcttagagac
      241 cagcactgct ggctgcacca tgaatgtgat ctacccactg gcagtcccca aggggcgcag
      301 actctgctgt gaggtgtgcg aagccccagc cgagcgggtg tgcgcggcct gcacagtcac
      361 ttattactgt ggcgtggtac atcagaaggc tgactgggac agcatccatg agaaaatatg
      421 tcagctcttg attccactgc gcacttccat gcccttctac aattcagagg aagaacggca
      481 gcatggcctg cagcagctgc agcagcggca gaagtatttg attgaattct gctacaccat
      541 agcccagaaa tacctctttg aagggaaaca cgaagatgct gtaccagcag ctttgcagtc
      601 ccttcgcttc cgtgtgaagc tgtatggcct gagctccgta gagcttgtgc ctgcttacct
      661 gctgttggcc gaggccagcc ttggtctggg ccgaatcgtt caggctgaag aatatctatt
      721 ccaagcccag tggacagtcc tcaaatcaac tgactgtagt aatgccaccc actctttact
      781 gcatcggaat ctgggacttc tctatatagc taagaaaaac tatgaagagg cccgttatca
      841 tctggccaat gatatttatt ttgccagttg tgcatttgga acagaggaca ttaggacttc
      901 aggaggctac ttccacctgg ctaatatatt ctatgacctt aaaaagttgg acctggcaga
      961 cacattgtac accaaggtct ctgagatctg gcatgcatat ttgaacaatc actatcaagt
     1021 cctctcacag gctcacatcc aacaaatgga tttactgggc aaactatttg agaatgacac
     1081 tggcttggat gaagcccaag aagcagaagc cattcgcatc ctgacttcaa tcttgaacat
     1141 tcgagaatct acatctgaca aagcccccca aaaaaccatc tttgttctga agatcctggt
     1201 catgctttac tacctgatga tgaattcttc aaaggcacag gaatatggca tgagggccct
     1261 cagtctagcc aaagaacaac agcttgatgt ccatgagcaa agcaccattc aagagttatt
     1321 aagtctcatt tcaactgaag accatcccat tacttagtga cccatgagct ctgcatcaag
     1381 ggttattcca ggggctactg aagatctaat atattccagc cttgcacaac tgctttgagg
     1441 tactgtagac tgctgaagtt tccaccctct tcccctggga ttgcacacat agctgttatt
     1501 tttttcttac acagcatatt aagggaatat aaagctttag gcatagaaat cactaaaaac
     1561 tgtgtttgtc atgacctttg tacttgattt atcatgactt tgtatgactg agtaatatgt
     1621 agtcagatca ctaatatggt atttgtaatt aaactacaaa tagtttgtca aaaaaaaaaa
     1681 aaaaa
//