LOCUS       BC021958                1464 bp    mRNA    linear   HUM 15-JUL-2006
DEFINITION  Homo sapiens abhydrolase domain containing 5, mRNA (cDNA clone
            MGC:8731 IMAGE:3920855), complete cds.
ACCESSION   BC021958
VERSION     BC021958.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1464)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 1464)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (22-JAN-2002) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC/DCTD/DTP
            cDNA Library Preparation: Life Technologies, Inc.
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Genome Sequence Centre,
            BC Cancer Agency, Vancouver, BC, Canada
            info@bcgsc.bc.ca
            Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
            Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
            Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
            Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
            Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
            Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
            Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
            Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
            Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAK Plate: 15 Row: m Column: 19.
FEATURES             Location/Qualifiers
     source          1..1464
                     /db_xref="H-InvDB:HIT000039313"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:8731 IMAGE:3920855"
                     /tissue_type="Skin, melanotic melanoma."
                     /clone_lib="NIH_MGC_72"
                     /lab_host="DH10B"
                     /note="Vector: pCMV-SPORT6"
     gene            1..1464
                     /gene="ABHD5"
                     /gene_synonym="CDS"
                     /gene_synonym="CGI58"
                     /gene_synonym="IECN2"
                     /gene_synonym="MGC8731"
                     /gene_synonym="NCIE2"
                     /db_xref="GeneID:51099"
                     /db_xref="HGNC:HGNC:21396"
                     /db_xref="MIM:604780"
     CDS             39..1088
                     /gene="ABHD5"
                     /gene_synonym="CDS"
                     /gene_synonym="CGI58"
                     /gene_synonym="IECN2"
                     /gene_synonym="MGC8731"
                     /gene_synonym="NCIE2"
                     /codon_start=1
                     /product="abhydrolase domain containing 5"
                     /protein_id="AAH21958.1"
                     /db_xref="GeneID:51099"
                     /db_xref="HGNC:HGNC:21396"
                     /db_xref="MIM:604780"
                     /translation="MAAEEEEVDSADTGERSGWLTGWLPTWCPTSISHLKEAEEKMLK
                     CVPCTYKKEPVRISNGNKIWTLKFSHNISNKTPLVLLHGFGGGLGLWALNFGDLCTNR
                     PVYAFDLLGFGRSSRPRFDSDAEEVENQFVESIEEWRCALGLDKMILLGHNLGGFLAA
                     AYSLKYPSRVNHLILVEPWGFPERPDLADQDRPIPVWIRALGAALTPFNPLAGLRIAG
                     PFGLSLVQRLRPDFKRKYSSMFEDDTVTEYIYHCNVQTPSGETAFKNMTIPYGWAKRP
                     MLQRIGKMHPDIPVSVIFGARSCIDGNSGTSIQSLRPHSYVKTIAILGAGHYVYADQP
                     EEFNQKVKEICDTVD"
BASE COUNT          493 a          286 c          315 g          370 t
ORIGIN      
        1 gcttcgagat aagtcccggc gcttgcgcgg cggcggctat ggcggcggag gaggaggagg
       61 tggactctgc cgacaccgga gagaggtcag gatggctaac tggttggctc cccacatggt
      121 gccctacgtc tatatcacac cttaaagaag ctgaagagaa gatgttaaaa tgtgtgcctt
      181 gcacatacaa aaaagaacct gttcgtatat ctaatggaaa taaaatatgg acactgaagt
      241 tctctcataa tatttcaaat aagactccac ttgtccttct ccatggtttt ggaggaggtc
      301 ttgggctctg ggcactgaat tttggagatc tttgcaccaa cagacctgtc tatgcttttg
      361 acctattggg ttttggacga agtagtagac ccaggtttga cagtgatgca gaagaagtgg
      421 agaatcagtt tgtggaatcc attgaagagt ggagatgtgc cctaggattg gacaaaatga
      481 tcttgcttgg gcacaaccta ggtggattct tggctgctgc ttactcgctg aagtacccat
      541 caagggttaa tcatctcatt ttagtggagc cttggggttt ccctgaacga ccagaccttg
      601 ctgatcaaga cagaccaatt ccagtttgga tcagagcctt gggagcagca ttgactccct
      661 ttaacccttt agctggccta aggattgcag gaccctttgg tttaagtcta gtgcagcgtt
      721 taaggcctga tttcaaacga aagtattctt caatgttcga agacgatact gtgacagaat
      781 acatctacca ctgtaatgtg cagactccaa gtggtgagac agctttcaag aatatgacta
      841 ttccttatgg atgggcaaaa aggccaatgc tccagcgaat tggtaaaatg caccctgaca
      901 ttccagtttc agtgatcttt ggcgcccgat cctgcataga tggcaattct ggcaccagca
      961 tccagtcctt acgaccacat tcatatgtga agacaatagc tattcttggg gcaggacatt
     1021 atgtatatgc agatcaacca gaagaattca accagaaagt aaaggagatc tgcgacactg
     1081 tggactgaac acactgaagc tctgatggga aaacctggtg actgatatag ttgttcagca
     1141 ataattcata gtctgtgatg aagagtagtg aatacaacac acaaccaggc agccttcttg
     1201 actatacttt gcacatgttt tctttaggaa ttcactcaca catttaaacc agttagtgcc
     1261 ttctagaaga atggctttcc tttctcctac acaaaattga aatatacaag tctctaaata
     1321 taataccttt aaataaaagg ttatttgtcc ctctgaaaaa aaaaaaaaaa aaaaaaaaaa
     1381 aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa
     1441 aaaaaaaaaa aaaaaaaaaa aaaa
//