LOCUS       BC021930                1685 bp    mRNA    linear   HUM 09-JUN-2008
DEFINITION  Homo sapiens KIAA1530, mRNA (cDNA clone IMAGE:4870256), complete
            cds.
ACCESSION   BC021930
VERSION     BC021930.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1685)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 1685)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (22-JAN-2002) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC/DCTD/DTP
            cDNA Library Preparation: Rubin Laboratory
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Genome Sequence Centre,
            BC Cancer Agency, Vancouver, BC, Canada
            info@bcgsc.bc.ca
            Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
            Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
            Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
            Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
            Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
            Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
            Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
            Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
            Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 40 Row: k Column: 18
            This clone was selected for full length sequencing because it
            passed the following selection criteria: Hexamer frequency ORF
            analysis
            This clone has the following problem: The cds is short compared to
            the longest cds in the locus.
FEATURES             Location/Qualifiers
     source          1..1685
                     /db_xref="H-InvDB:HIT000039308"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="IMAGE:4870256"
                     /tissue_type="Skin, melanotic melanoma, high MDR."
                     /clone_lib="NIH_MGC_49"
                     /lab_host="DH10B-R"
                     /note="Vector: pOTB7"
     gene            1..1685
                     /gene="KIAA1530"
                     /db_xref="GeneID:57654"
                     /db_xref="HGNC:HGNC:29304"
     CDS             433..1215
                     /gene="KIAA1530"
                     /codon_start=1
                     /product="KIAA1530 protein"
                     /protein_id="AAH21930.1"
                     /db_xref="GI:18314542"
                     /db_xref="GeneID:57654"
                     /db_xref="HGNC:HGNC:29304"
                     /translation="MDEEVSDPTSAAAQLRQLRDHLPPPSSASPSRALPEPQEAQKLA
                     AERARAPVVPYGVDLHYWGQELPTAGKIVKSDSQHRFWKPSEVEEEVVNADISEMLRS
                     RHITFAGKFEPVQHWCRAPRPDGRLCERQDRLKCPFHGKIVPRDDEGRPLDPEDRARE
                     QRRQLQKQERPEWQDPELMRDVEAATGQDLGSSRYSGKGRGKKRRYPSLTNLKAQADT
                     ARARIGRKVFAKAAVRRVVAAMNRMDQKKHEKFSNQFNYALN"
BASE COUNT          361 a          486 c          547 g          291 t
ORIGIN      
        1 gtggcctttc caagcggctg ccacctcagg cttgggtgct ggggagggct ccaggctgcc
       61 tacatctcac caccggagcc tgagctgccg gggctatggg cacagggtgc cgggcagtct
      121 gggctctcgc tgctgcccag cttctttcca gcctggcgaa tccatctgct caggctggca
      181 cttctgcaaa gcccggcagc acagtgtgtg aacagcgtgg ccacaaggcg ggactgccgg
      241 accccccgac gcacgccatg ttctggcaga gcgtggcctg agctgctgct ccgggcctca
      301 ccctcgcccg tgaggagcag atagcaggca cccacctcgg gactgttgga agatggcaca
      361 cgctaacgca tagggctgga ggcagcacca gagaaagaca cagttgtgcg gtgcttgcgg
      421 acgaggacga ggatggacga ggaggtgtcg gaccccacct ctgcggctgc tcagctgcgg
      481 cagctccggg accacttgcc tccaccctca tctgccagcc cctccagagc gttgccagag
      541 ccacaggagg cccagaagct ggcagcagag cgggcccggg cgcctgtggt gccctacggc
      601 gtggacctgc actactgggg ccaggagctc cccacagccg ggaagattgt caagtctgac
      661 tcccagcacc gcttctggaa gcccagcgag gtggaggagg aagtggtcaa tgccgacatc
      721 tccgagatgc tccggagccg ccacatcact tttgccggga agtttgagcc tgtgcagcac
      781 tggtgccgtg ccccgaggcc agacggccgg ctctgtgagc gccaagaccg gctgaagtgc
      841 cctttccatg ggaagattgt tccacgggac gacgaaggac ggccgctcga cccggaagac
      901 agggctcgtg agcagcggcg gcagctgcag aagcaggagc gcccggaatg gcaggaccct
      961 gagttgatga gagacgtgga agcagccaca gggcaggatc tcggctcatc caggtacagc
     1021 gggaaaggca gggggaagaa gaggaggtac cccagcctca ccaacctgaa ggctcaggct
     1081 gataccgccc gcgctcgcat tgggagaaaa gtcttcgcca aggcagctgt gcggagggta
     1141 gtggcagcca tgaaccggat ggaccagaag aagcacgaga agttttcaaa ccagtttaac
     1201 tacgcactga actagagagc ggggcccagt gcactggcca tcagcacttt ctccctctgc
     1261 cagtgtctca ggacagcaga gtgggcgtgg gtctgggcag taaccatgct ttgtctatta
     1321 ctgtgtttga tgtaaagaaa tggtgtgttg caatgccctg aaggtacggc cgctctgctg
     1381 ctacagggtt cggcatcgtc tggtgatggg tctggcctcg cagaagaggc cctcgggcct
     1441 ggagatgtga acacaggcag cgaccctgtt ccagagggct tctgcgagtc ctcgtgagac
     1501 cagtgcttgt cgtggtgtgg ggttcagcac ggacggaatg tgtgtgcagc tcagccttca
     1561 gagcgtgcat tccccagcca ggaggcgacc actcagagga actctgggaa acccactttt
     1621 gtgcaaatgc tgtttttaac acaaacacaa aggctagtga accgttcaaa aaaaaaaaaa
     1681 aaaaa
//